RIEM News LogoRIEM News

Articles tagged with "graphene"

  • MIT gets first 'direct view' of exotic superconductivity in graphene

    MIT physicists have achieved a major breakthrough by obtaining the first direct measurement of unconventional superconductivity in magic-angle twisted tri-layer graphene (MATTG), a material made of three stacked and twisted atom-thin carbon sheets. Using a novel experimental platform that combines electron tunneling with electrical transport measurements, the team directly observed MATTG’s superconducting gap, which exhibits a distinctive V-shaped profile unlike the flat gap seen in conventional superconductors. This finding confirms that the superconducting mechanism in MATTG is fundamentally different and likely arises from strong electronic interactions rather than lattice vibrations, marking a crucial step toward understanding and designing new superconductors. This research advances the global pursuit of room-temperature superconductors, which could revolutionize technology by enabling zero-energy-loss power grids, practical quantum computers, and more efficient medical imaging devices. The study, led by MIT physicists including Jeong Min Park and Shuwen Sun and senior author Pablo Jarillo-Herrero, builds on the emerging field of “twistronics

    materialssuperconductivitygraphenequantum-materialsenergy-efficient-technologyroom-temperature-superconductorsMIT-research
  • Top 10 most expensive cars in the world that blend power with luxury

    The article highlights the top 10 most expensive cars in the world for 2025, emphasizing their blend of power, luxury, and exclusivity. These vehicles are described as bespoke masterpieces that combine advanced engineering with artisanal craftsmanship, often produced in extremely limited quantities. Leading the list is the Rolls-Royce La Rose Noire Droptail, priced at $30 million, notable for its intricate design featuring over 1,600 hand-laid wooden pieces and personalized 24K gold accents. Another Rolls-Royce, the Boat Tail, follows closely at $28 million, distinguished by its hand-hammered aluminum body and a unique mechanically actuated butterfly rear deck designed for aerodynamic efficiency and durability. Other standout cars include the Bugatti La Voiture Noire at $18.8 million, which incorporates cutting-edge materials like graphene-infused resin and a powerful 1500 HP W16 engine with advanced turbocharging technology. The Pagani Zonda HP Barchetta ($17 million)

    materialscarbon-fibergraphenetitanium-alloyautomotive-engineeringadvanced-materialsluxury-cars
  • Scientists turn plastic waste into super material for batteries

    Scientists from Shenyang Agricultural University and affiliated institutions in China have developed a method to convert plastic waste into high-performance carbon materials such as carbon nanotubes, graphene, and porous carbon. These materials have significant potential for use in energy storage devices like lithium-ion batteries and supercapacitors, offering a way to both reduce plastic pollution and enhance battery performance. A notable technique highlighted is flash Joule heating, which efficiently produces high-quality graphene from plastic waste in milliseconds with very low energy consumption. The research emphasizes the environmental and economic benefits of transforming plastic waste into valuable carbon products, contributing to a circular carbon economy by linking pollution control with renewable energy applications. The porous carbon derived from plastic waste demonstrated energy storage capacities close to theoretical limits for selenium batteries, along with excellent stability. Beyond energy storage, these carbon materials can also aid environmental cleanup by capturing greenhouse gases and removing contaminants from wastewater. However, the team acknowledges technical challenges remain, such as optimizing catalyst design and improving product selectivity, before the technology can be

    energymaterialsplastic-waste-recyclingcarbon-materialsbattery-technologysustainable-materialsgraphene
  • Graphene boosts accuracy in lithium detection, could help make reliable sensors

    Researchers at the International Iberian Nanotechnology Laboratory (INL) have demonstrated that integrating graphene into solid-contact lithium-selective electrodes significantly improves lithium detection accuracy and sensor reliability. Graphene’s unique electrical and surface properties—such as high capacitance, hydrophobicity, and minimal potential drift—make it an ideal ion-to-electron transducer. This enhancement addresses longstanding challenges in sensor technology related to precision, durability, and stable voltage readings by preventing water layer formation and ensuring efficient ion signal transmission. The study, published in Microchemical Journal as part of the NGS–New Generation Storage project, highlights graphene-modified electrodes’ superior performance compared to other materials. This advancement supports the development of next-generation potentiometric sensors with exceptional sensitivity, reproducibility, and robustness. Potential applications span healthcare monitoring, energy storage systems, industrial processes, and environmental analysis, where reliable and accurate lithium measurement is critical. Overall, leveraging graphene’s properties paves the way for more dependable and versatile lithium sensors capable of maintaining consistent

    graphenelithium-sensorsenergy-storagematerials-sciencesensor-technologynanotechnologyelectrode-design
  • China claims new jet coating can survive 1,800°F and block radar

    Chinese researchers from Peking University and Harbin Engineering University have developed an ultra-thin, heat-resistant coating designed to enhance stealth capabilities of fighter jets by absorbing radar waves. This metasurface coating, only 0.1 millimeters thick, can withstand extreme temperatures up to 1,832°F (1,000°C) and maintain its radar-absorbing properties under high-speed airflow conditions typical of supersonic flight. Created by depositing graphene onto a silica fabric substrate and then patterning it with lasers, the resulting graphene-silica fiber membrane is lightweight, flexible, and durable, capable of reducing radar reflection by up to -42 decibels without adding significant weight or altering aircraft structure. The technology represents a significant advancement in stealth materials, potentially applicable not only to military aircraft like China’s J-20 stealth fighter but also to satellites, drones, and hypersonic vehicles exposed to harsh thermal and electromagnetic environments. This innovation contrasts with current U.S. stealth coatings, which are fragile,

    materialsadvanced-coatingsgraphenestealth-technologyelectromagnetic-absorptionthermal-stabilityaerospace-materials
  • Quantum study cracks decades-old mystery of trapped quantum electrons

    A research team from TU Wien has resolved a longstanding puzzle in condensed matter physics regarding which electrons escape from a solid material when it is bombarded with electrons. While it was previously believed that electrons with sufficient energy would simply leave the material, experimental evidence showed discrepancies that energy alone could not explain. The study reveals the existence of specific quantum "doorway states" that govern electron emission. These doorway states are particular quantum states above the energy threshold that allow electrons to escape, acting as "open doors" to the outside, whereas other states with similar energy do not permit emission. The researchers demonstrated that not all electrons with enough energy can leave the solid; only those occupying these doorway states can do so. Additionally, some doorway states only appear when a material has more than five layers, highlighting the importance of material layering in electron emission behavior. This discovery not only clarifies why materials with similar electron energy levels can exhibit very different emission characteristics but also opens new avenues for designing layered materials with tailored electronic properties. The

    materialsquantum-physicselectron-emissioncondensed-matter-physicsgrapheneenergy-statesquantum-materials
  • Duke engineers break size barrier to print recyclable electronics

    Duke University engineers have developed a novel printing technique called high precision capillary printing that enables the creation of fully functional, recyclable carbon-based electronics at sub-micrometer scales. This breakthrough overcomes a previous size limitation of 10 micrometers, allowing the printing of thin-film transistors (TFTs) with features separated by tiny gaps that enhance electrical performance. The team used inks derived from nanocellulose, graphene, and carbon nanotubes, which can be printed on various substrates including glass, silicon, and flexible materials like paper. These advances could enable environmentally friendly manufacturing of electronic displays, reducing energy consumption and greenhouse gas emissions compared to traditional methods. While the printed transistors are not intended to replace high-performance silicon chips, they show promise for applications in display technologies, particularly OLEDs, which demand higher current and multiple transistors per pixel. The technology could significantly reduce the environmental footprint of the $150 billion display industry and help revitalize U.S. manufacturing in a market currently dominated

    materialsrecyclable-electronicsprinted-electronicscarbon-based-transistorsnanocellulosegraphenecarbon-nanotubes
  • New graphene material makes supercapacitors rival lead-acid batteries

    Engineers at Monash University have developed a novel graphene-based material, called multiscale reduced graphene oxide (M-rGO), that enables supercapacitors to achieve energy storage comparable to lead-acid batteries while delivering power at much faster rates. This breakthrough addresses a longstanding limitation in supercapacitors, which traditionally store charge electrostatically but have had lower energy density due to inefficient use of carbon materials’ surface area. By applying a rapid thermal annealing process to natural graphite, the researchers created highly curved graphene structures with optimized ion pathways, resulting in devices that combine high energy density (up to 99.5 Wh/L) with exceptional power density (up to 69.2 kW/L) and excellent cycle stability. The new M-rGO material is compatible with scalable production methods and leverages abundant Australian graphite resources, making it promising for commercialisation. Monash spinout Ionic Industries is already producing commercial quantities of this graphene material and collaborating with energy storage partners to bring the technology to market

    energygraphenesupercapacitorsenergy-storagematerials-sciencebattery-technologycarbon-materials
  • New acetone breath test could offer quicker diabetes screening

    Researchers at Penn State have developed a novel graphene-based breath sensor that can rapidly and inexpensively detect diabetes and prediabetes by measuring acetone levels in exhaled breath. The device uses a combination of laser-induced porous graphene and zinc oxide to selectively identify acetone, a biomarker linked to diabetes risk when present above 1.8 parts per million. Unlike traditional diabetes tests that require blood draws or lab visits, this sensor provides results within minutes by simply exhaling into a bag and dipping the sensor, eliminating the need for induced sweat or complex lab analysis. The sensor’s design overcomes challenges such as moisture interference by incorporating a membrane that blocks water molecules while allowing acetone to pass through, enhancing detection accuracy. Currently, the test requires breath collection in a bag to avoid environmental airflow disruption, but future iterations aim to enable direct detection under the nose or inside a mask. Beyond diabetes screening, the researchers envision broader health applications by tracking acetone fluctuations related to diet and exercise. The study,

    materialsgraphenesensor-technologydiabetes-detectionzinc-oxidebreath-analysishealth-monitoring
  • Lab-grown brain cells steer robot dog, advancing Alzheimer's study

    US scientists at the University of California San Diego have developed a novel technique called Graphene-Mediated Optical Stimulation (GraMOS) that uses graphene’s optoelectronic properties to stimulate and accelerate the maturation of lab-grown human brain organoids. Unlike traditional methods that rely on genetic modification or direct electrical currents, GraMOS is biocompatible and noninvasive, converting light into gentle electrical signals that encourage neurons to connect and mature faster. This advancement addresses the major limitation of slow brain organoid development, enhancing their utility for studying neurological diseases such as Alzheimer’s and enabling faster drug testing. In a groundbreaking demonstration, the researchers connected graphene-interfaced brain organoids to a robotic dog, allowing the organoids to process sensory input and generate neural responses that enabled the robot to avoid obstacles within 50 milliseconds. This neuro-biohybrid system exemplifies the potential for living brain cells to interface with machines, opening possibilities for applications in prosthetics, adaptive robotics, and biological computing. The

    robotgraphenebrain-organoidsbrain-machine-interfaceoptoelectronicsneurological-disease-researchAlzheimer's-study
  • New quantum phonon interference sets stage for next-gen sensors

    Researchers at Rice University have demonstrated a groundbreaking advancement in phonon interference, achieving interference effects two orders of magnitude stronger than previously observed. By intercalating a few layers of silver atoms between graphene and a silicon carbide substrate—a process called confinement heteroepitaxy—they created a unique two-dimensional metal interface that enhances vibrational mode interactions in silicon carbide. This strong phonon interference, characterized by Fano resonance patterns detected via Raman spectroscopy, reveals highly sensitive vibrational signals that can distinguish even single dye molecules on the surface, enabling label-free single-molecule detection with a simple, scalable setup. This discovery marks a significant step in harnessing phonons—quantum units of vibration that carry heat and sound—as effective carriers of quantum information, comparable to electrons and photons. Unlike bulk metals, the atomically thin 2D metal layer produces unique quantum interference pathways purely from phonon interactions, without electronic contributions. The findings open new avenues for phonon-based quantum sensing, molecular detection, energy harvesting, and

    quantum-sensingphonon-interference2D-materialsgraphenesilicon-carbidemolecular-detectionenergy-technology
  • Record-breaking single-photon detector ends need for cryogenics

    Researchers at ICFO have developed a groundbreaking single-photon detector capable of sensing mid-infrared photons at significantly higher temperatures—around 25 Kelvin—compared to conventional detectors that require cryogenic cooling below 1 Kelvin. This advance eliminates the need for bulky, energy-intensive cryogenic systems, making the technology more practical for integration into photonic circuits. The detector is constructed from stacked two-dimensional materials, specifically bilayer graphene sandwiched between hexagonal boron nitride layers, precisely aligned to create a moiré pattern that induces a bistability effect. This bistability allows the device to switch between two stable states when triggered by a single photon, enabling detection without ultra-low temperatures. The novel detection mechanism differs fundamentally from traditional superconducting and semiconductor detectors by operating near an electrical tipping point, where a single photon acts as a trigger to switch the device’s state. This approach enhances sensitivity to long-wavelength photons and has potential applications in astronomy, quantum communication, and medical imaging by improving the

    materialsgraphenephoton-detectorquantum-communication2D-materialsmid-infrared-detectioncryogenics
  • US Startup Lyten (Still) Aims For A Lithium-Sulfur EV Battery

    US startup Lyten is advancing lithium-sulfur battery technology with ambitions to capture significant market share in low-cost battery energy storage systems across the US and Europe. The company has been developing a lithium-sulfur EV battery in collaboration with automaker Stellantis, aiming for commercial deployment potentially by 2030. Lithium-sulfur batteries offer advantages over traditional lithium-ion cells, including lower weight, reduced cost, and the ability to use existing lithium-ion manufacturing lines, although challenges with mechanical and chemical degradation remain. Since May 2024, Lyten has been shipping pouch-type lithium-sulfur battery samples to automakers in the US and EU from its pilot facility in California. A key differentiator for Lyten is its proprietary Lyten 3D Graphene™ technology, which enhances battery performance by increasing energy density—approaching twice that of lithium-ion batteries—while eliminating 85% of mined minerals like nickel, cobalt, and graphite. Lyten has also expanded its automotive applications of

    energylithium-sulfur-batteryEV-batteryenergy-storagegrapheneelectric-vehiclesbattery-technology
  • Chinese scientists detect rare quantum friction in folded graphene

    Chinese scientists from the Lanzhou Institute of Chemical Physics, led by Professors Zhang Junyan and Gong Zhenbin, have experimentally observed quantum friction in folded graphene for the first time. By precisely folding graphene layers to create controlled curvature and internal strain, they altered electron behavior at the nanoscale. This strain forced electrons into fixed energy states called pseudo-Landau levels, reducing energy loss as heat and resulting in a nonlinear, sometimes decreasing friction pattern as the number of graphene layers increased. Their findings challenge classical friction models and provide the first direct evidence of quantum friction occurring between two solid surfaces. The research, conducted at ultra-low temperatures using a carefully engineered graphene system, opens new avenues for understanding friction at the atomic scale. The team plans to investigate whether similar quantum friction effects occur in other materials and under more practical conditions. Ultimately, this work could lead to technologies that better manage or minimize energy loss in nanoscale electronics and quantum computing devices by exploiting quantum friction phenomena. The study was published in Nature Communications

    materialsgraphenequantum-frictionnanotechnologyenergy-efficiencynanomaterialsquantum-physics
  • AI-powered graphene tongue detects flavors with 98% precision

    Scientists have developed an AI-powered artificial tongue using graphene oxide within a nanofluidic device that mimics human taste with remarkable accuracy. This system integrates both sensing and computing on a single platform, enabling it to detect chemical signals and classify flavors in real time, even in moist conditions similar to the human mouth. Trained on 160 chemicals representing common flavors, the device achieved about 98.5% accuracy in identifying known tastes (sweet, salty, sour, and bitter) and 75-90% accuracy on 40 new flavors, including complex mixtures like coffee and cola. This breakthrough marks a significant advancement over previous artificial taste systems by combining sensing and processing capabilities. The sensor exploits graphene oxide’s sensitivity to chemical changes, detecting subtle conductivity variations when exposed to flavor compounds. Coupled with machine learning, it effectively recognizes flavor patterns much like the human brain processes taste signals. The researchers highlight potential applications such as restoring taste perception for individuals affected by stroke or viral infections, as well as uses

    grapheneartificial-tongueAImaterials-sciencesensorsmachine-learningnanotechnology
  • Quantum miracle: Graphene shows spin currents without any magnets

    Researchers at Delft University of Technology have achieved a groundbreaking feat by generating and detecting quantum spin currents in graphene without the use of external magnetic fields. Traditionally, inducing the quantum spin Hall (QSH) effect in graphene required strong magnetic fields, which are impractical for on-chip integration. By placing graphene atop a layered magnetic material called chromium thiophosphate (CrPS₄), the team harnessed magnetic proximity effects to induce spin-orbit coupling and exchange interactions in graphene. This combination opened an energy gap and enabled electrons to flow along graphene’s edges with aligned spins, demonstrating the QSH effect in a magnet-free environment. In addition to observing the QSH effect at cryogenic temperatures, the researchers discovered an anomalous Hall (AH) effect that persisted even at room temperature, where electrons deflect sideways without an external magnetic field. The coexistence of these effects suggests practical pathways for developing ultrathin, spin-based quantum devices. The stable, topologically protected spin currents in graphene could facilitate long-distance

    graphenespintronicsquantum-devicesmaterials-scienceenergy-efficient-electronicsquantum-spin-Hall-effectmagnetic-proximity-effect
  • Graphene’s strange twist is a boon for true superconductivity: Study

    The article discusses recent research on magic-angle twisted trilayer graphene (MATG), a novel form of graphene composed of three atom-thick layers twisted at specific angles, which exhibits unconventional superconductivity. Unlike traditional superconductors, MATG’s superconducting behavior defies established theories, making it a subject of intense scientific investigation. Researchers constructed Josephson junctions incorporating MATG to probe its superconducting properties beyond simple resistance measurements, confirming true superconductivity through observations such as magnetic field expulsion and Cooper pair formation. A key finding of the study is MATG’s exceptionally high kinetic inductance—about 50 times greater than most known superconductors—indicating that Cooper pairs in MATG respond very slowly to changing currents. This property is highly desirable for quantum technologies, including ultra-sensitive photon detectors and superconducting qubits for quantum computing. Additionally, the researchers identified an inverse relationship between kinetic inductance and critical current, shedding light on the coherence length of the superconducting electron pairs. Although MATG is not

    materialsgraphenesuperconductivityquantum-devicestwisted-trilayer-graphenemagic-angle-graphenequantum-materials
  • Rare graphite flakes behave as both superconductor and magnet at 300 K

    materialssuperconductivitygraphenemagnetismenergyquantum-computingresearch
  • World’s fastest quantum switch built by US team for ultra-fast AI

    materialsquantum-computinggrapheneultrafast-computingAI-hardwaretransistorslaser-technology