Articles tagged with "quantum-computing"
New twist on classic material could advance quantum computing
Researchers at Penn State University have developed a novel approach to enhance the electro-optic properties of barium titanate, a classic material known since 1941 for its strong ability to convert electrical signals into optical signals. By reshaping barium titanate into ultrathin strained thin films, the team achieved over a tenfold improvement in the conversion efficiency of electrons to photons at room temperature compared to previous results at cryogenic temperatures. This breakthrough addresses a long-standing challenge, as barium titanate had not been widely commercialized due to fabrication difficulties and stability issues, with lithium niobate dominating the electro-optic device market instead. The improved material has significant implications for quantum computing and data center energy efficiency. Quantum technologies often require cryogenic conditions, but transmitting quantum information over long distances needs room-temperature optical links, which this advancement could enable. Additionally, data centers, which consume vast amounts of energy primarily for cooling, could benefit from integrated photonic technologies that use photons rather than electrons to transmit data
materialselectro-optic-materialsbarium-titanatequantum-computingenergy-efficiencydata-centersphotonicsWorld’s first linked time crystal could supercharge quantum computers
European researchers at Aalto University in Finland have, for the first time, successfully connected a time crystal to an external system, marking a significant breakthrough in quantum technology. Time crystals are a novel phase of matter proposed by Nobel Laureate Frank Wilczek, characterized by perpetual motion in their lowest energy state without energy input. Previously, time crystals had only been observed in isolated quantum systems, but the Aalto team demonstrated that a time crystal formed from magnons in a superfluid helium-3 environment can interact with a mechanical oscillator. This connection allowed them to adjust the time crystal’s properties, a feat not achieved before. The experiment involved pumping magnons—quasiparticles behaving like individual particles—into the superfluid cooled near absolute zero, creating a time crystal that maintained motion for up to 108 cycles (several minutes). As the time crystal’s motion faded, it coupled with a nearby mechanical oscillator, with changes in frequency analogous to known optomechanical phenomena used in gravitational wave detection.
quantum-computingtime-crystalquantum-sensorsoptomechanical-systemsultracold-physicsquantum-materialslow-temperature-physicsWorld’s first tunable nonlinear photonic chip targets quantum use
Researchers from NTT Research, Cornell University, and Stanford University have developed the world’s first programmable nonlinear photonic waveguide, a breakthrough device capable of switching between multiple optical functions on a single chip. This innovation challenges the traditional “one device, one function” limitation in photonics, where devices are fixed to a single task during fabrication. By using a silicon nitride core and projecting structured light patterns onto the chip, the device dynamically creates programmable regions of optical nonlinearity, enabling rapid reconfiguration of its optical functions. Demonstrated capabilities include arbitrary pulse shaping, tunable second-harmonic generation, holographic generation of spatio-spectrally structured light, and real-time inverse design of nonlinear-optical functions. The technology promises significant impacts across optical and quantum computing, communications, and tunable light sources by reducing costs, improving manufacturing yields, and enabling more compact, power-efficient optical systems. This flexibility is particularly valuable for quantum computing, where programmable quantum light sources and frequency converters can enhance
materialsphotonicsquantum-computingoptical-devicessilicon-nitridenonlinear-opticsprogrammable-chipUS team achieves 99% fidelity in quantum communication breakthrough
A research team at the University of Illinois Urbana-Champaign has achieved a major breakthrough in quantum communication by generating entangled photons at a telecom-band wavelength of 1389 nm using an array of ytterbium-171 (¹⁷¹Yb) atoms. This development enables high-fidelity (up to 99%) entanglement directly compatible with existing fiber-optic infrastructure, overcoming previous challenges related to signal degradation and efficiency loss caused by wavelength conversion. The team’s approach allows for parallelized entanglement generation across multiple atoms projected onto a commercial fiber array, significantly enhancing the scalability and performance of quantum networks. This scalable quantum networking architecture supports simultaneous, uniform, and high-fidelity entanglement across interconnected nodes with minimal crosstalk, a critical requirement for reliable quantum communication. Additionally, the researchers introduced a mid-circuit networking protocol to maintain coherence of data qubits during network operations, ensuring data stability even when multiple connections are active. Their findings indicate that with minor technical improvements,
quantum-communicationquantum-networkingquantum-processorsentangled-photonstelecom-band-photonsfiber-optic-communicationquantum-computingNew qubits operate at telecom frequencies, expand quantum potential
Researchers from the University of Chicago, UC Berkeley, Argonne National Laboratory, and Lawrence Berkeley National Laboratory have developed new molecular qubits that operate at telecommunications frequencies, marking a significant advance toward scalable quantum networks compatible with existing fiber-optic infrastructure. These qubits utilize erbium, a rare-earth element known for its clean optical properties and strong magnetic interactions, enabling them to bridge the gap between light (used for transmitting quantum information) and magnetism (fundamental to many quantum devices). This molecular platform allows quantum information to be encoded magnetically and accessed optically at wavelengths compatible with current telecommunications and silicon photonics technologies. Operating at telecom-band frequencies, these molecular qubits have potential applications beyond laboratory settings, including ultra-secure quantum communication, linking quantum computers over long distances, and nanoscale sensing in diverse environments such as biological systems or silicon-based chips. Their chemical flexibility and compatibility with existing optical infrastructure position them as promising building blocks for the future quantum internet. The research highlights the importance of synthetic molecular chemistry
quantum-computingquantum-internetmolecular-qubitstelecom-frequenciesoptical-fiber-networksquantum-communicationrare-earth-materialsIntegrated photonics can bring million-atom quantum trap to chips
Researchers at the University of California Santa Barbara have made significant advances in miniaturizing cold atom quantum experiments, traditionally confined to large, delicate laboratory setups, onto palm-sized photonic chips. By leveraging integrated photonics—technology that manipulates light on silicon nitride chips—they developed a 3D magneto-optical trap capable of cooling and trapping over a million rubidium atoms to ultra-cold temperatures (around 250 microkelvin). This breakthrough enables highly precise quantum measurements previously only possible in bulky optical tables, opening the door to portable quantum sensors for applications such as earthquake detection, sea level rise monitoring, gravitational experiments, and dark matter searches. A key challenge addressed by the team was the noise and instability of commercial lasers, which hinder quantum precision. In 2024, they engineered an ultra-low linewidth, self-injection-locked 780 nm laser integrated directly on the chip, significantly reducing noise and enhancing measurement sensitivity. This integration of lasers, mirrors, modulators, and stabilizers onto
quantum-computingintegrated-photonicsquantum-sensorssilicon-nitride-chipscold-atom-technologyminiaturized-quantum-devicesquantum-navigationLQMs vs. LLMs: when AI stops talking and starts calculating
The article discusses the emerging role of Large Quantitative Models (LQMs) as a new class of AI systems that differ fundamentally from Large Language Models (LLMs). Unlike LLMs, which are trained on internet text to generate language-based outputs, LQMs are purpose-built to work with numerical, scientific, and physical data, enabling them to simulate complex real-world systems in fields like chemistry, biology, and physics. Fernando Dominguez, Head of Strategic Partnerships at SandboxAQ—a company at the forefront of AI and quantum technology integration—explains that LQMs can generate novel data not available in existing datasets, such as simulating trillions of molecular interactions. This capability allows LQMs to accelerate drug discovery, financial modeling, and navigation, offering a more quantitative and practical approach to AI-driven innovation. A key example highlighted is SandboxAQ’s collaboration with UCSF’s Institute for Neurodegenerative Diseases, where LQMs enabled the simulation of over 5 million molecular compounds in
materialsAIquantum-computingdrug-discoverysimulationpharmaceuticalscybersecurityCat qubits stay stable for over an hour in quantum computing record
French quantum computing startup Alice & Bob has set a new record in qubit stability by demonstrating that their Galvanic Cat qubits can resist bit-flip errors for over an hour, a significant improvement from the previous record of 430 seconds (about seven minutes) achieved in 2024. Bit-flip errors are one of the main challenges in quantum computing, and extending the bit-flip lifetime to this extent marks a crucial step toward practical fault-tolerant quantum machines. The breakthrough was realized through a combination of software optimizations, experimental techniques, and advanced engineering on their latest qubit design, which also powers their 12-qubit Helium 2 chip. This advancement not only surpasses typical cosmic ray impact timescales, suggesting enhanced qubit robustness, but also enables more efficient error-correcting codes that could reduce the hardware requirements for large-scale quantum computers by up to 200 times. Alice & Bob reported bit-flip times between 33 and 60 minutes at a
materialsquantum-computingqubitscat-qubitsfault-tolerant-computingquantum-error-correctionsuperconducting-qubitsQuantum internet closer: New router transmits data with 99% fidelity
Researchers at Tohoku University have developed a breakthrough photonic quantum router capable of transmitting quantum information with over 99% fidelity and extremely low signal loss (0.06 dB or about 1.3%). This device is compatible with existing telecommunication networks and operates at nanosecond speeds, addressing a major hurdle in building scalable quantum communication systems. The router employs a novel parallelogram-shaped interferometer design that preserves photon polarization while reducing the number of optical components, thereby minimizing signal loss and enhancing stability. In a pioneering demonstration, the router successfully directed entangled photon pairs while maintaining an interference visibility of approximately 97%, confirming its ability to handle complex quantum states crucial for applications like distributed quantum computing and secure quantum communication. This development marks a significant step toward realizing a practical quantum internet, which relies on transmitting quantum data encoded in photons without loss or corruption. The new router combines essential features—low loss, high speed, noise-free operation, and telecom compatibility—making it a foundational component for
IoTquantum-internetphotonic-routerquantum-communicationtelecommunication-networksquantum-computingsecure-communicationHelium-3 mining on Moon: A new frontier for science and geopolitics
The article discusses the emerging interest in mining helium-3 from the Moon, highlighting its scientific, technological, and geopolitical significance. Helium-3, a rare, non-radioactive isotope embedded in the lunar regolith by billions of years of solar wind, holds promise for multiple advanced applications. It is crucial for cooling quantum computers to near absolute zero, enhancing medical imaging and security scanners, and potentially serving as a clean fusion fuel that produces minimal radioactive waste. These diverse uses make helium-3 a highly strategic resource, sparking a competitive race among nations, notably the United States, China, and Russia, with the European Union, India, and others also entering the fray. The Moon’s helium-3 reserves are estimated to be vast—possibly around a million metric tons—though dispersed at very low concentrations, requiring processing of large amounts of lunar soil. Earth’s supply is limited and insufficient to meet the anticipated demand from scaling quantum technologies and other uses. While helium-3 fusion remains theoretical and
energymaterialslunar-mininghelium-3fusion-fuelquantum-computingspace-explorationFirst 3D-printed ion traps hit 98% fidelity in quantum operations
Scientists from Lawrence Livermore National Laboratory (LLNL), in collaboration with UC Berkeley, UC Riverside, and UC Santa Barbara, have developed miniaturized quadrupole ion traps using high-resolution 3D printing, achieving quantum gate fidelities as high as 98%. These 3D-printed ion traps combine the stability advantages of traditional bulky 3D traps with the scalability of planar traps, overcoming a longstanding tradeoff in quantum computing hardware. The traps confine calcium ions at competitive frequencies and error rates, enabling stable ion manipulation, including two-ion position exchanges lasting minutes and high-fidelity two-qubit entangling gates. The use of ultrahigh-resolution two-photon polymerization printing allows rapid prototyping—printing full traps in about 14 hours or just electrodes in 30 minutes—significantly accelerating design iterations and enabling complex hybrid planar-3D geometries. This expanded design flexibility opens new avenues for optimizing and miniaturizing ion traps. The team plans to further
3D-printingion-trapsquantum-computingmaterials-engineeringminiaturizationquantum-informationadvanced-manufacturingScientists create quantum 'telephones' to connect long-distance atoms
Researchers at the University of New South Wales (UNSW) in Australia have successfully created quantum entanglement between two distant phosphorus atoms embedded in silicon, marking a significant advancement in quantum computing. Using electrons as a bridge, they established entangled states between the nuclear spins of atoms separated by up to 20 nanometers. This breakthrough was demonstrated through a two-qubit controlled-Z logic operation, achieving a nuclear Bell state with a fidelity of approximately 76% and a concurrence of 0.67. The findings, published in the journal Science, suggest that nuclear spin-based quantum computers can be developed using existing silicon technology and manufacturing processes. The key innovation lies in using electrons—capable of “spreading out” in space—to mediate communication between atomic nuclei that were previously isolated like people in soundproof rooms. By enabling these nuclei to “talk” over a distance via electron exchange interactions, the researchers effectively created quantum “telephones” that allow long-distance entanglement. This method is robust
quantum-computingsilicon-microchipsquantum-entanglementsemiconductor-technologyspin-qubitsnuclear-spinquantum-communicationWorld-first quantum computer made with standard laptop chips launched
Quantum Motion, a UK-based startup, has launched the world’s first full-stack quantum computer built using standard silicon chip technology found in smartphones and laptops. Deployed at the UK National Quantum Computing Centre (NQCC), this quantum computer is the first to utilize the complementary metal-oxide-semiconductor (CMOS) fabrication process, the same transistor technology used in conventional computers. A key innovation is the integration of cryoelectronics that connect qubits with control circuits operating at very low temperatures, enabling significant scalability of quantum processors. The system combines Quantum Motion’s Quantum Processing Unit (QPU) with a user interface and control stack compatible with industry-standard frameworks like Qiskit and Cirq, making it a comprehensive quantum computing solution. It features a compact, data center–friendly design occupying just three 19-inch server racks, with modular auxiliary equipment allowing easy integration and future upgrades without increasing the physical footprint. The QPU’s tile-based architecture supports expansion to millions of qubits per chip, aiming
materialsquantum-computingsilicon-chipsCMOS-technologyscalable-technologycryoelectronicsdata-center-integrationGoogle's quantum AI chip unlocks new exotic phase of matter
An international research team from the Technical University of Munich, Princeton University, and Google Quantum AI has experimentally observed a previously theorized exotic phase of matter—known as a Floquet topologically ordered state—using Google's 58-qubit quantum processor, Willow. This non-equilibrium quantum state arises in systems driven by time-periodic Hamiltonians, where the governing physical rules change in a predictable, cyclical manner. Unlike conventional phases of matter defined under equilibrium conditions, these out-of-equilibrium phases exhibit dynamic, time-evolving properties that traditional thermodynamics cannot describe. The team developed an interferometric algorithm to probe the topological structure of this state, enabling them to witness the dynamical transformation of exotic particles predicted by theory. This breakthrough demonstrates that quantum computers like Willow are not merely computational tools but also powerful experimental platforms for exploring complex quantum phenomena that are difficult or impossible to simulate classically. The discovery opens a new frontier in quantum simulation, transforming quantum processors into laboratories for investigating out-of-equilibrium quantum matter
quantum-computingexotic-matterquantum-AI-chipnon-equilibrium-quantum-statestopological-phasesGoogle-Quantum-AIquantum-materialsBreakthrough quantum algorithm solves a century-old math problem
Researchers have successfully employed a quantum algorithm to solve a century-old mathematical problem involving the factorization of group representations—a task previously deemed intractable for classical supercomputers. Conducted by Martín Larocca of Los Alamos National Laboratory and Vojtěch Havlíček of IBM, the study demonstrates that quantum computers can efficiently decompose complex symmetries into their fundamental building blocks, known as irreducible representations. This problem is analogous to prime factorization but applies to group theory, which is essential for describing system transformations in physics and material science. The breakthrough leverages quantum Fourier transforms, enabling computations that classical algorithms struggle with due to exponential complexity. This achievement exemplifies a clear quantum advantage, showcasing quantum computing’s potential to outperform classical methods on meaningful scientific problems. The ability to factor group representations efficiently has significant real-world applications, including calibrating particle detectors in physics, developing error-correcting codes in data transmission, and analyzing material properties for new material design. The research not only
quantum-computingquantum-algorithmsmaterials-sciencequantum-advantagecomputational-physicsquantum-Fourier-transformparticle-physicsUS scientists capture fleeting muons with new mobile detector
Researchers at the U.S. Department of Energy’s Oak Ridge National Laboratory (ORNL) have developed a new mobile muon detector that significantly enhances imaging capabilities for dense, shielded materials such as spent nuclear fuel. Inspired by a neutron detector designed over a decade ago for the Spallation Neutron Source, this device uniquely captures both muon energy and scattering angles in real time, improving image quality beyond previous muon tomography systems that typically recorded only one parameter. The detector’s development involved interdisciplinary collaboration between ORNL’s Neutron Sciences and Fusion and Fission Energy and Sciences directorates and is set to be deployed for practical measurements later this year. Muons, fundamental particles that decay within microseconds, provide a non-destructive means to probe deep into matter, but their fleeting nature has made detection challenging. By adapting wavelength-shifting fiber technology from neutron detectors, the ORNL team overcame this limitation, enabling real-time capture of muon interactions. Beyond nuclear fuel monitoring, the detector is expected to
energynuclear-energymuon-detectorparticle-detectionquantum-computingnuclear-safetyOak-Ridge-National-LaboratoryNew algorithm solves quantum computer's speed-of-light problem
Researchers from the Niels Bohr Institute, MIT, NTNU, and Leiden University have developed a new algorithm called Frequency Binary Search that enables quantum computers to reduce noise in qubits in real time. Noise, or decoherence, is a major challenge for quantum computing because qubits are highly sensitive to tiny environmental changes, which cause errors and disrupt their coherent quantum states. Traditional noise mitigation methods involve extensive measurements and corrections that are often too slow, resulting in delayed noise cancellation and reduced accuracy. The Frequency Binary Search algorithm addresses this by estimating qubit frequency shifts instantly using a Quantum Machines controller equipped with a Field Programmable Gate Array (FPGA), which processes data on the spot without sending it to a slower desktop computer. This real-time correction allows simultaneous calibration of many qubits with exponential precision using fewer than ten measurements, a significant improvement over the thousands typically required. By enabling immediate noise correction, this breakthrough brings quantum computers closer to reliable, large-scale operation, potentially unlocking their vast capabilities in fields like
quantum-computingqubitsnoise-reductiondecoherenceFPGAquantum-algorithmquantum-processorsEngineers transmit quantum data on everyday internet fiber cables
Engineers at the University of Pennsylvania have demonstrated that quantum signals can be transmitted over commercial fiber-optic internet cables alongside classical data using the same internet protocol (IP) that powers today’s web. Their innovation centers on a silicon “Q-chip” that pairs a measurable classical light signal with fragile quantum particles, allowing the classical signal to guide routing without disturbing the quantum information. This approach enables quantum and classical data to be packaged together and routed through existing internet infrastructure, achieving over 97% signal fidelity in tests conducted on Verizon’s live fiber network. The Q-chip’s design addresses a major challenge in scaling quantum networks: quantum particles collapse when measured, making traditional data routing methods unusable. By sending a classical “header” signal ahead of the quantum data, the system can perform routing and error correction without directly measuring the quantum states. The chip’s silicon-based fabrication allows for mass production and integration into current networks, though distance limitations remain since quantum signals cannot yet be amplified without loss. The researchers liken
IoTquantum-computingfiber-optic-communicationquantum-internetphotonicssilicon-chipnetwork-technologyAfter falling behind in generative AI, IBM and AMD look to quantum for an edge
IBM and AMD are collaborating to develop a commercially viable quantum computing architecture as a strategic move to regain competitiveness after lagging behind in the generative AI market. Their joint effort aims to create a scalable and open-source quantum system, making advanced quantum computing more accessible to researchers and developers. This initiative targets complex real-world applications such as drug and materials discovery, optimization, and logistics. By leveraging AMD’s AI-specialized chips and IBM’s expertise in quantum technology, the partnership seeks to position both companies as key infrastructure providers in the evolving tech landscape. IBM’s CEO, Arvind Krishna, emphasized the transformative potential of quantum computing to simulate the natural world and represent information in fundamentally new ways, highlighting the significance of this venture for future technological advancements.
materialsquantum-computingAI-chipsIBMAMDdrug-discoveryoptimizationStudy shows modular quantum systems work even with imperfect links
A recent study led by the University of California, Riverside, demonstrates through simulations that modular quantum computing systems can scale effectively even when the connections between individual quantum chips are imperfect and noisy. Traditionally, scaling quantum computers has been challenging due to fragile qubits and noisy inter-chip links, especially when chips operate in separate cryogenic environments. However, the research shows that as long as each chip maintains high fidelity, the inter-chip connections can tolerate noise levels up to ten times greater than those within a single chip without compromising the system’s ability to detect and correct errors. This finding suggests that building larger, fault-tolerant quantum computers may be achievable sooner than previously anticipated without waiting for perfect hardware. The study emphasizes that simply increasing the number of qubits is insufficient for practical quantum computing; fault tolerance is crucial. Logical qubits, which are the usable units in quantum programs, are formed by combining many physical qubits to enable error correction, often using techniques like the surface code. By simulating thousands of modular
quantum-computingfault-tolerancequantum-chipsquantum-systemserror-correctionscalable-quantum-computersquantum-hardwareQuantum breakthrough promises real-time humanoid robot control
Researchers from Shibaura Institute of Technology, Waseda University, and Fujitsu have developed a quantum computing-based method to improve humanoid robot posture control by leveraging quantum entanglement. Their approach uses qubits to represent the position and orientation of robot joints, with entanglement mirroring the interconnected movement of real joints. By combining quantum circuits for forward kinematics with classical computing for inverse kinematics, the hybrid system reduces computational complexity, cutting errors by up to 43% and speeding up calculations compared to traditional methods. Tests on Fujitsu’s quantum simulator and a 64-qubit quantum computer confirmed these improvements, enabling realistic full-body movement calculations for robots with 17 joints that would otherwise require excessive computing power and time. This breakthrough is significant for the future of humanoid robots, especially those working closely with humans, as it enables smoother, more lifelike, and real-time motion control without oversimplifying joint models. The method is already compatible with current noisy intermediate-scale quantum (N
robotquantum-computinghumanoid-robotsinverse-kinematicsquantum-entanglementrobotics-controlquantum-simulationQuantum-centric computing is already solving high-value chemistry challenges
IBM and Japan’s RIKEN Center have achieved a significant milestone in quantum chemistry by simulating the energy states of a complex molecule using a 77-qubit quantum processor—the largest number of qubits applied to a real-world quantum chemistry problem to date. This breakthrough was accomplished through a hybrid quantum-classical computing approach, combining IBM’s Heron quantum processor with RIKEN’s Fugaku supercomputer. This collaboration demonstrated that quantum-centric supercomputing, where quantum processing units (QPUs) work alongside classical CPUs and GPUs, can solve challenging chemistry problems previously thought to require fully fault-tolerant quantum computers. Their findings were published in Science Advances, highlighting that this hybrid model is not merely transitional but may represent the most effective near-term use of quantum computing. The hybrid approach leverages the strengths of both quantum and classical computing: quantum processors handle complex calculations that scale exponentially, while classical systems excel at tasks like data entry, memory access, and rendering graphics. Experts emphasize that classical computing remains highly
quantum-computinghybrid-computingsupercomputersquantum-processorsmaterials-researchenergy-simulationchemistry-challengesWrinkled 2D sheets may unlock faster, more efficient devices
Researchers at Rice University have discovered that tiny wrinkles in two-dimensional (2D) materials, such as molybdenum ditelluride, can precisely control electron spin, a quantum property that could revolutionize computing. Unlike traditional devices that rely on electron charge, spintronics uses electron spin states ("up" or "down") to process information, potentially enabling faster, smaller, and more energy-efficient devices. A major challenge in spintronics has been the rapid decay of spin information due to electron scattering, but the Rice team found that bending 2D materials creates a unique spin texture called a persistent spin helix (PSH), which preserves spin states even amid collisions. This effect arises from the flexoelectric polarization generated by uneven strain when the 2D sheet is bent—stretching on one side and compressing on the other—creating internal electric fields that split spin-up and spin-down electrons into distinct bands. The curvature-induced interaction is strongest in highly curved regions like wrinkles or
materials2D-materialsspintronicsenergy-efficient-deviceselectron-spinquantum-computingflexoelectric-polarizationWorld’s Smallest Cat 🐱✨
The article highlights a groundbreaking scientific achievement where researchers have created the world’s smallest "cat," not a living feline but a single rubidium atom precisely arranged using lasers and artificial intelligence. This atomic-scale creation symbolizes the cutting-edge advancements in quantum technology, showcasing the ability to manipulate individual atoms with extraordinary accuracy. This feat is more than a novelty; it represents a significant step toward the future of quantum computing. By controlling atoms at such a fine level, scientists aim to develop quantum machines capable of processing information far beyond the capabilities of current computers. The work underscores the potential of combining laser technology and AI to push the boundaries of quantum mechanics and computing innovation.
materialsquantum-computingAIlasersatomic-manipulationquantum-technologyprecision-engineeringFirst protein-based quantum bit could change biological research
Researchers at the University of Chicago Pritzker School of Molecular Engineering have developed the first protein-based quantum bit (qubit) by converting a living cell protein—enhanced yellow fluorescent protein (EYFP)—into a functional qubit. Unlike traditional quantum sensors that require extremely cold, controlled environments, this protein qubit operates effectively within the warm, noisy environment of living cells. The team demonstrated that the protein qubit exhibits quantum behaviors such as spin coherence and optically detected magnetic resonance, and can be initialized, manipulated with microwaves, and read out using light inside living cells. This breakthrough challenges the long-held belief that quantum phenomena cannot survive in biological systems and opens new possibilities for biological research. Although the protein qubits are currently less sensitive than diamond-based quantum sensors, their ability to be genetically encoded directly into living cells offers a unique advantage. This capability could enable unprecedented observation of biological processes at the molecular level, such as protein folding and early disease stages, potentially leading to quantum-enabled nanoscale MRI
materialsquantum-computingprotein-qubitquantum-sensormolecular-engineeringbiological-researchquantum-technologySchrödinger’s cat video made with 2,024 atoms in quantum breakthrough
A team of physicists from the University of Science and Technology of China has created what is described as the "world’s smallest cat video," depicting Schrödinger’s cat thought experiment using just 2,024 rubidium atoms. This quantum-level visualization uses optical tweezers—focused laser beams—to precisely manipulate individual atoms within a 230-micron-wide array. Machine learning algorithms enable real-time calculations that direct the lasers to rearrange all atoms simultaneously in just 60 milliseconds, a significant improvement over previous methods that moved atoms one by one. The glowing atoms form images representing key moments of the Schrödinger’s cat paradox, illustrating the concept of superposition where a particle exists in multiple states simultaneously. This breakthrough addresses a major bottleneck in neutral-atom quantum computing by enabling rapid, defect-free assembly of large atom arrays with high accuracy—reported as 99.97% for single-qubit operations and 99.5% for two-qubit operations. The technique is highly scalable, maintaining
materialsquantum-computingmachine-learningoptical-tweezersrubidium-atomsAIquantum-technologyCaltech uses sound to store quantum data 30 times longer than qubits
Caltech researchers have developed a novel quantum memory technique that converts quantum electrical signals from superconducting qubits into acoustic vibrations using a chip-scale mechanical oscillator, akin to a microscopic tuning fork. This hybrid approach leverages phonons—quantized sound waves vibrating at gigahertz frequencies—to store quantum information. Because these mechanical vibrations lose energy more slowly and are less prone to interference than electrical signals, the system achieves quantum state lifetimes up to 30 times longer than conventional superconducting qubits. This advancement addresses a key limitation of superconducting qubits, which excel at processing quantum information but suffer from short coherence times that restrict data storage. The team fabricated a nanoscale mechanical oscillator integrated with a superconducting qubit on a chip, enabling the storage and retrieval of quantum states as mechanical vibrations at extremely low temperatures. The slower propagation of acoustic waves allows for compact device design and reduces energy loss by preventing radiation into free space. These properties suggest the potential for scalable quantum memory solutions by integrating many such oscillators
quantum-computingquantum-memorysuperconducting-qubitsacoustic-vibrationschip-scale-oscillatorquantum-data-storagescalable-quantum-technology10x increase in atom array size boosts China’s quantum leap
Chinese researchers led by physicist Pan Jianwei at the University of Science and Technology of China have achieved a major breakthrough in quantum computing by creating the largest atom array to date. Their system can arrange over 2,000 rubidium atoms—each acting as a qubit—into precise two- and three-dimensional patterns within 60 milliseconds using a high-speed spatial light modulator and laser beam shaping. This array size is reportedly 10 times larger than previous systems, marking a significant leap in scalability and computational efficiency for neutral atom quantum processors. The team also developed an artificial intelligence system that simultaneously shifts every atom in real time, achieving single-qubit operation accuracy of 99.97%, two-qubit accuracy of 99.5%, and qubit state detection accuracy of 99.92%. They introduced a theoretical framework to balance readout fidelity and atomic retention, proposing a quantum circuit iteration rate (qCIR) metric to evaluate system performance. Their findings suggest that qCIRs of up
quantum-computingatom-arraysquantum-processorsAI-in-quantum-systemsrubidium-atomshigh-speed-spatial-light-modulatorqubit-fidelityScientists measure quantum distance in a solid for the first time ever
Scientists have, for the first time, experimentally measured the full quantum metric tensor of electrons in a real solid crystal, using black phosphorus. Quantum distance, a theoretical concept describing how similar or different two quantum states are, had long eluded direct measurement in materials due to the difficulty of capturing the subtle quantum geometry of electrons. By employing angle-resolved photoemission spectroscopy (ARPES) combined with synchrotron radiation at the Advanced Light Source, the researchers mapped the pseudospin texture of electrons in black phosphorus, enabling them to reconstruct the quantum distance and the full quantum metric tensor of Bloch electrons within the crystal. This breakthrough is significant because understanding quantum distances and the quantum metric tensor can illuminate anomalous quantum phenomena in solids, such as high-temperature superconductivity and resistance-free electrical conduction. Moreover, precise knowledge of quantum geometry is crucial for advancing quantum technologies, including the development of fault-tolerant quantum computers. While the current demonstration is limited to black phosphorus, the approach opens new avenues for exploring
materialsquantum-materialsblack-phosphorusquantum-distancesuperconductorsquantum-computingelectron-behaviorQuantum state unlocked in object at room temperature in world-first
Researchers from TU Wien and ETH Zurich have achieved a world-first by unlocking quantum states in glass nanoparticles at room temperature, bypassing the need for ultra-low temperatures typically required in quantum experiments. Their work focused on slightly elliptical nanoparticles smaller than a grain of sand, which were held in electromagnetic fields causing them to rotate around an equilibrium orientation. By using a system of lasers and mirrors capable of both supplying and extracting energy, the team was able to reduce the rotational energy of these particles, effectively bringing their motion close to the quantum ground state despite the particles being several hundred degrees hot. This breakthrough challenges the conventional understanding that quantum states can only be observed in systems cooled near absolute zero to isolate them from environmental disturbances. The researchers emphasized the importance of treating different degrees of freedom separately, which allowed them to manipulate the rotational movement independently and achieve quantum behavior at ambient temperatures. This advancement opens new avenues for studying quantum properties in larger objects and at practical temperatures, potentially accelerating developments in quantum sensing, computation, simulation, and crypt
materialsquantum-physicsnanoparticlesenergy-statesquantum-computingquantum-sensingroom-temperature-quantum-statesUS finds missing particle that makes quantum computing fully possible
Researchers at the University of Southern California (USC) have discovered a new class of particles called "neglectons," which could significantly advance universal quantum computing. Traditional quantum computers use qubits that are highly fragile and prone to errors, limiting their reliability. Topological quantum computing, which encodes information in the geometric properties of exotic particles called anyons, offers a promising error-resistant approach. However, the commonly studied Ising anyons only support a limited set of operations (Clifford gates) insufficient for universal quantum computing. USC mathematicians and physicists turned to a less-explored mathematical framework known as non-semisimple topological quantum field theories (TQFTs), which retain components previously discarded as "mathematical garbage" due to their zero quantum trace. These components revealed the neglectons, a new type of anyon that, when combined with Ising anyons, enable universal quantum computation through braiding alone. Notably, only one stationary neglecton is required
quantum-computingquantum-particlesanyonstopological-quantum-computingqubitserror-correctionquantum-informationGold coating breakthrough boosts quantum chip stability and scale
Researchers at the University of California, Riverside, led by physicist Peng Wei, have developed a breakthrough technique to enhance the stability and scalability of quantum chips by applying an ultra-thin gold coating to superconducting materials. Quantum computers rely on qubits, which are highly sensitive to environmental noise and microscopic material defects that disrupt their fragile quantum states. Wei’s team addressed this by depositing a uniform gold layer about ten atoms thick onto niobium, a common superconducting metal used in quantum processors. This gold layer smooths out surface imperfections that typically trap Cooper pairs—electron pairs responsible for superconductivity—thereby reducing noise and preserving qubit coherence without impairing the superconducting properties. The gold coating acts as a chemically inert, stable shield that prevents oxidation and environmental interference, striking a balance between thickness and superconductivity. This innovation is compatible with existing chip fabrication processes, making it attractive for commercial quantum computing development. The technique has garnered interest from leading institutions such as MIT, NIST, and SEEQC
materialsquantum-computingsuperconducting-materialsgold-coatingqubit-stabilityquantum-chipnanotechnologyPhotonic chip sets loss record, boosts quantum computing scale
Xanadu and HyperLight have jointly achieved a significant breakthrough in photonic chip technology, crucial for advancing scalable photonic quantum computers. By refining the fabrication process of thin-film lithium niobate (TFLN) chips, they reduced waveguide loss to below 2 dB per meter and electro-optic switch loss to just 20 milli-decibels (mdB), setting new industry records for low-loss performance. Importantly, these chips were produced using high-volume semiconductor manufacturing processes, demonstrating readiness for commercial-scale deployment and marking a key milestone in Xanadu’s 2025 hardware roadmap. This advancement addresses a critical challenge in photonic quantum computing, where minimizing optical loss is essential to reduce errors and enable scaling. The low-loss waveguides and switches allow photons to be guided and rerouted with minimal signal degradation, supporting the development of large-scale, fault-tolerant quantum computers. Building on their previous collaboration in the Aurora project—the world’s first fiber-networked photonic quantum
materialsphotonic-chipsquantum-computinglithium-niobatesemiconductor-fabricationelectro-optic-switchesquantum-hardwareIn a first, transmon qubit achieves a coherence time of one millisecond
Researchers at Aalto University in Finland have achieved a breakthrough in quantum computing by extending the coherence time of a superconducting transmon qubit to over one millisecond, with a median coherence time of about 0.5 milliseconds. This marks a new world record, significantly surpassing the previous best echo coherence times of around 0.6 milliseconds. The team accomplished this by using ultra-clean superconducting films, precise electron-beam lithography, and meticulous fabrication of Josephson junctions, all performed in a highly controlled cleanroom environment. Cooling the chip to near absolute zero and employing specialized low-noise amplifiers further preserved the qubit’s fragile quantum state. This advancement is crucial because longer coherence times allow qubits to perform more quantum operations before errors occur, enhancing the reliability and practicality of quantum computers. While this milestone is promising for the development of quantum sensors, simulators, and computers, scaling the technology to many qubits on a single chip with similar coherence remains a significant challenge. To
materialsquantum-computingsuperconducting-qubitstransmon-qubitcoherence-timequantum-technologyquantum-sensorsA strange quantum battery concept reveals the second law of entanglement
Researchers have demonstrated for the first time that quantum entanglement—a fundamental and mysterious connection between particles—can be manipulated reversibly, akin to energy in classical thermodynamics. This breakthrough was achieved by introducing the concept of an "entanglement battery," a quantum system that stores and supplies entanglement during transformations without loss. By allowing entanglement to flow in and out of this battery, the researchers resolved a long-standing challenge in quantum information science: the inability to perfectly reverse entanglement transformations under the traditional framework of local operations and classical communication (LOCC), which typically degrade entanglement. The study shows that in the asymptotic limit of many identical entangled states, transformations between different entangled states can be performed reversibly with rates determined by the relative amounts of entanglement, analogous to thermodynamic cycles involving energy and entropy. This framework not only advances the fundamental understanding of entanglement but also has practical implications for quantum computing, secure communication, and quantum networks. Furthermore
energyquantum-batteryquantum-entanglementquantum-informationthermodynamicsquantum-computingquantum-networksHarvard's ultra-thin chip breakthrough sets new standard for quantum optics
Researchers at Harvard University, led by Professor Federico Capasso, have developed a groundbreaking ultra-thin optical device called a metasurface that can perform complex quantum operations previously requiring numerous bulky components. This single, flat chip replaces traditional setups involving lenses, mirrors, and beam splitters used to control and entangle photons—key particles for quantum computing and networking. By miniaturizing the entire optical system into a stable, robust metasurface, the team addresses a major scalability challenge in photon-based quantum information processing. A novel design process was crucial to this breakthrough, employing graph theory to map the complex interference pathways of multi-photon quantum states onto nanoscale patterns on the metasurface. This approach unifies the metasurface design with the quantum state generation, enabling precise and systematic construction of devices tailored for specific quantum tasks. The metasurface’s monolithic design reduces optical loss and environmental sensitivity, and its fabrication via semiconductor industry techniques promises cost-effective, reproducible production. Beyond quantum computing, this technology has potential applications in
quantum-computingmetasurfacephotonicsoptical-devicesquantum-opticsnanoscale-materialsquantum-information-processingMicrosoft to build world's most powerful quantum computer in Denmark
Microsoft, in collaboration with Denmark’s investment fund EIFO and the Novo Nordisk Foundation, is launching QuNorth, a project aimed at building the world’s most powerful commercial quantum computer, named Magne, in the Nordic region. With a €80 million ($93 million) investment, QuNorth seeks to address the Nordic countries' current lack of access to advanced Level 2 quantum systems, which are crucial for conducting reliable and complex quantum computations. Magne will feature 50 logical qubits supported by 1,200 physical qubits, making it one of the first Level 2 quantum computers globally. This full-stack quantum computer will integrate hardware, software, operating systems, and control electronics, with Atom Computing providing the hardware and Microsoft supplying Azure software tailored to Atom’s neutral atom technology. Construction of Magne is set to begin in late 2025, with completion expected by early 2027. QuNorth will establish a leadership team, including a CEO and research positions in partnership with Microsoft,
quantum-computingMicrosoftquantum-technologyNordic-regionLevel-2-quantum-systemsAtom-ComputingQuNorth-projectGerman scientists use light to trigger quantum effects in crystals
Researchers at the University of Konstanz in Germany have demonstrated a novel way to alter the properties of a material at room temperature using light, a phenomenon previously unpredicted by theory. By employing laser pulses on iron ore hematite crystals, the team was able to excite pairs of magnons—quasiparticles representing collective electron spin excitations—at their highest magnetic resonance frequencies. This excitation changed the magnetic properties of the material, effectively transforming its "magnetic DNA" and creating a temporary new material with distinct characteristics. Notably, this effect was driven by light rather than temperature, enabling room-temperature manipulation, which is uncommon in quantum experiments. This breakthrough is significant because magnons, which behave like waves, can be controlled by lasers to transmit and store information at terahertz frequencies, making them promising candidates for future quantum technologies such as artificial intelligence and quantum computing. Unlike many modern quantum materials that rely on rare-earth elements or synthetic modifications, the use of abundant hematite crystals highlights the practical potential
materialsquantum-effectsmagnonslaser-pulsesmagnetic-propertiesquantum-computingartificial-intelligenceTurns out quantum secrets can’t be cracked by humans or AI alone
A team of physicists and machine learning (ML) experts collaborated to solve a longstanding puzzle in condensed matter physics involving frustrated magnets—materials whose magnetic components do not align conventionally and exhibit unusual behaviors. Specifically, they investigated what happens to a quantum spin liquid state in a type of magnet called a "breathing pyrochlore" when cooled near absolute zero. While the spin liquid state, characterized by constantly fluctuating magnetic moments, was known to exist, the researchers had been unable to determine its behavior at even lower temperatures. The breakthrough came through a novel AI-human collaboration. The ML algorithm, developed by experts at LMU Munich, was designed to classify magnetic orders and was particularly interpretable, requiring no prior training and working well with limited data. By feeding Monte Carlo simulation data of the cooling spin liquid into the algorithm, the team identified previously unnoticed patterns. They then reversed the simulations, effectively heating the magnetic state, which helped confirm the nature of the low-temperature phase. This iterative dialogue between
materialsquantum-materialsmachine-learningcondensed-matter-physicsquantum-magnetsspin-liquidsquantum-computingIndia eyes global quantum computer push — and QpiAI is its chosen vehicle
QpiAI, an Indian startup specializing in integrating AI with quantum computing for enterprise applications, has secured $32 million in a Series A funding round co-led by the Indian government under its $750 million National Quantum Mission and Avataar Ventures. Valued at $162 million post-money, this investment underscores India’s strategic push to become a global quantum computing leader. The National Quantum Mission, launched in 2023, targets the development of intermediate-scale quantum computers (50–1,000 qubits) and related quantum technologies such as satellite-based quantum communications and quantum materials over the next eight years. QpiAI, one of eight startups selected for government grants, has developed India’s first full-stack quantum computer, QpiAI-Indus, featuring 25 superconducting qubits, and integrates AI to enhance quantum chip design and error correction. Founded in 2019 and headquartered in Bengaluru with subsidiaries in the U.S. and Finland, QpiAI focuses on real-world quantum applications in sectors like
quantum-computingAI-integrationquantum-materialssuperconducting-qubitsquantum-hardwarematerial-discoveryquantum-device-fabricationScientists probe whether gravity and space-time alter quantum world
A recent study by researchers from Stevens Institute of Technology, University of Illinois, and Harvard University explores how quantum networks can be used to investigate the effects of curved space-time on quantum theory, probing the intersection of Einstein’s General Theory of Relativity and quantum mechanics. Their work, published in PRX Quantum, introduces a protocol leveraging entangled W-states and quantum teleportation to distribute quantum effects across network nodes, enabling experimental tests of quantum theory under gravitational influences. This approach could provide new insights into whether gravity alters quantum mechanics, addressing a longstanding challenge in physics. The researchers highlight that while quantum mechanics effectively describes atomic and subatomic behavior, it remains unclear how or if gravity modifies these quantum effects, especially given the differences from classical physics at larger scales. Quantum networks, beyond their anticipated role in creating a global quantum internet and ultra-secure communications, offer a novel platform to experimentally study fundamental physics in curved space-time—something classical computing cannot achieve. This research opens pathways toward testing and potentially unifying quantum
quantum-networksquantum-mechanicsquantum-gravityquantum-internetquantum-entanglementquantum-computingquantum-technologyGermany creates first-ever hybrid alloy for next-gen quantum chips
Researchers in Germany have developed a groundbreaking hybrid semiconductor alloy composed of carbon, silicon, germanium, and tin (CSiGeSn), marking the first stable material of its kind. Created by teams at Forschungszentrum Jülich and the Leibniz Institute for Innovative Microelectronics, this new compound belongs to Group IV of the periodic table, ensuring full compatibility with existing CMOS chip manufacturing processes. The addition of carbon to the silicon-germanium-tin matrix enables unprecedented control over the band gap, a key factor influencing electronic and photonic properties, potentially allowing innovations such as room-temperature lasers and efficient thermoelectric devices. This advancement overcomes previous challenges in combining these four elements due to differences in atomic size and bonding behavior, achieved through an advanced chemical vapor deposition (CVD) technique. The resulting material maintains the delicate crystal lattice structure essential for chip fabrication and is visually indistinguishable from conventional wafers. The team successfully demonstrated the first light-emitting diode (LED) based on a quantum well
materialssemiconductorquantum-computingalloysiliconphotonicsmicroelectronicsBreakthrough silicon chip fuses photonics and quantum generators
Researchers from Boston University, UC Berkeley, and Northwestern University have developed the world’s first integrated electronic–photonic–quantum chip using standard 45-nanometer semiconductor technology. This breakthrough device combines twelve synchronized quantum light sources, known as “quantum light factories,” on a single chip, each generating correlated photon pairs essential for quantum computing, sensing, and secure communication. The chip integrates microring resonators, on-chip heaters, photodiodes, and embedded control logic to maintain real-time stabilization of the quantum light generation process, overcoming challenges posed by temperature fluctuations and manufacturing variations. The innovation lies in embedding a real-time feedback control system directly on the chip, enabling continuous correction of misalignments and drift, which is critical for scalable quantum systems. The team successfully adapted quantum photonics design to meet the stringent requirements of a commercial CMOS platform, originally developed for AI and supercomputing interconnects. This collaboration demonstrates that complex quantum photonic systems can be reliably built and stabilized within commercial semiconductor
quantum-computingphotonicssemiconductor-technologyquantum-light-sourcesintegrated-circuitsquantum-sensorschip-manufacturingStartups Weekly: Still running
The "Startups Weekly: Still running" article provides a comprehensive roundup of recent developments in the startup ecosystem, highlighting key funding rounds, strategic moves, and emerging trends. Notably, design company Figma is preparing for an IPO that could raise up to $1.5 billion, signaling strong investor interest. Meanwhile, startups like Cluely are gaining traction with aggressive marketing and growing revenues, and fintech entrepreneur Darragh Buckley has achieved a significant milestone with his new venture, Increase. The newsletter also touches on corporate challenges in adopting AI tools, with insights from Brex illustrating broader industry struggles. On the venture capital and funding front, several notable deals are underway: Revolut is seeking a new funding round, SpaceX is raising capital, and micromobility and climate-focused startups like Terra CO2 and Tulum Energy are making strides in sustainability. Genesis AI is advancing foundational models for robotics, while Israeli quantum startup Qedma secures investment from IBM, emphasizing collaborative progress in quantum
robotAIstartupsenergyhydrogen-technologyquantum-computingmaterialsPhysicists double qubit coherence, opening door to faster quantum computing
Researchers at Aalto University in Finland have achieved a breakthrough in quantum computing by doubling the coherence time of transmon qubits, reaching an echo coherence time of 1 millisecond—significantly surpassing the previous record of approximately 0.6 milliseconds. Coherence time measures how long a qubit can maintain its quantum state without errors caused by environmental noise, which is critical for performing complex quantum operations with high fidelity. Longer coherence times reduce the reliance on extensive quantum error correction, a major hurdle in scaling quantum computers to practical, fault-tolerant devices. The team fabricated high-quality transmon qubits using superconducting materials sourced from Finland’s national research institute, VTT, and utilized advanced cleanroom facilities at Aalto University. This advancement not only marks a significant scientific milestone but also strengthens Finland’s position as a global leader in quantum technology. Supported by initiatives like the Finnish Quantum Flagship and the Academy of Finland’s Centre of Excellence in Quantum Technology, the researchers anticipate that industrial and commercial
materialsquantum-computingqubitssuperconducting-materialscoherence-timequantum-technologyquantum-error-correctionScientists isolate lone spinon in breakthrough for quantum magnetism
Scientists have achieved a significant breakthrough in quantum magnetism by isolating a lone spinon, a quasiparticle previously thought to exist only in pairs. Spinons arise as quantum disturbances in low-dimensional magnetic systems, particularly one-dimensional spin chains, where flipping a single electron spin creates a ripple that behaves like a particle carrying spin ½. Historically, spinons were observed only in pairs, reinforcing the belief that they could not exist independently. However, a new theoretical study by physicists from the University of Warsaw and the University of British Columbia demonstrated that a single unpaired spin can move freely through a spin-½ Heisenberg chain, effectively acting as a solitary spinon. This theoretical finding gained experimental support from recent work led by C. Zhao, published in Nature Materials, which observed spin-½ excitations in nanographene-based antiferromagnetic chains consistent with lone spinon behavior. The ability to isolate and understand single spinons has profound implications for quantum science, as spinons are closely
quantum-magnetismspinonsquantum-materialsmagnetic-materialsquantum-computingnanographenequantum-entanglementFirst zero-temp symmetry break hits 80% fidelity in quantum test
An international team of researchers from China, Spain, Denmark, and Brazil has achieved a significant breakthrough by simulating spontaneous symmetry breaking (SSB) at absolute zero temperature using a superconducting quantum processor. This marks the first time SSB has been simulated at zero temperature with about 80% fidelity, representing a major milestone in condensed matter physics and demonstrating new quantum computing applications. SSB is a fundamental phenomenon in physics that explains the emergence of complex structures and conservation laws, but observing it at near absolute zero is challenging due to material immobility. Classical computers have struggled with such simulations, which are typically limited to temperatures above zero and require extensive processing time. The researchers leveraged quantum computing’s unique capabilities—entanglement and superposition—to overcome these limitations. Unlike classical computers that process computations sequentially, quantum processors handle multiple possibilities simultaneously, exponentially speeding up simulations. The experiment used a quantum circuit of seven superconducting qubits made from aluminum and niobium alloys, operating near one millikelvin
quantum-computingsuperconducting-qubitsquantum-simulationmaterials-sciencecondensed-matter-physicsquantum-processorslow-temperature-physicsIsraeli quantum startup Qedma just raised $26 million, with IBM joining in
Israeli quantum computing startup Qedma has raised $26 million in a Series A funding round led by Israeli VC firm Glilot+, with participation from existing investors like TPY Capital, new investors including Korean Investment Partners, and notably IBM. Qedma specializes in quantum error mitigation software, particularly its flagship product QESEM (quantum error suppression and error mitigation), which analyzes and reduces noise-induced errors in quantum computations both during execution and in post-processing. This approach enables more accurate quantum circuit runs on current hardware without waiting for full error correction advancements at the hardware level. IBM’s involvement reflects its strategy to foster a collaborative quantum ecosystem by partnering with companies focused on software layers, complementing its own hardware and software development efforts. IBM’s VP of Quantum, Jay Gambetta, emphasized the importance of community efforts to achieve scientifically accepted definitions of “quantum advantage”—the point where quantum computers demonstrably outperform classical ones. Qedma’s CEO, Asif Sinay, expressed optimism that the company could
quantum-computingerror-correctionquantum-softwareIBMquantum-advantagequantum-hardwarematerials-scienceQuantum ‘translator’: A tiny silicon chip links microwaves and light like never before
Researchers at the University of British Columbia have developed a tiny silicon chip that acts as a highly efficient quantum "translator," converting signals between microwaves (used in quantum computing) and light (used in communication) with up to 95% efficiency and almost zero noise. This conversion is crucial because microwaves, while integral to quantum computers, cannot travel long distances effectively, whereas optical photons can. The chip achieves this by incorporating tiny magnetic defects in silicon that trap electrons; these electrons flip states to mediate the conversion without absorbing energy, preserving the fragile quantum information and entanglement necessary for quantum communication. This innovation addresses a major challenge in creating a quantum internet, enabling quantum computers to remain entangled over long distances, potentially across cities or continents. Unlike previous devices, the UBC chip works bidirectionally, adds minimal noise, and operates with extremely low power consumption using superconducting materials. While still theoretical and requiring physical realization, this design represents a significant advance toward secure, ultra-fast quantum networks that
quantum-computingsilicon-chipquantum-communicationmicrowave-to-optical-conversionquantum-internetquantum-materialsphotonicsCryo chip runs qubits at -273°C using just 10 microwatts of power
Researchers at the University of Sydney have developed a cryogenic control chip capable of operating directly alongside quantum bits (qubits) at near absolute zero temperatures (milli-kelvin range) while consuming just 10 microwatts of power. This chip, designed using standard CMOS technology, controls spin qubits—data stored in the magnetic orientation of single electrons—and maintains qubit coherence and fidelity without measurable degradation compared to conventional room-temperature setups. The chip’s low power consumption and minimal noise interference enable scalable quantum computing systems potentially reaching millions of qubits without significant energy increases. Led by Professor David Reilly, the team demonstrated that their cryogenic chip causes negligible fidelity loss in single- and two-qubit operations and does not reduce coherence times, overcoming a major hurdle in building large-scale quantum computers. The research is driving commercial interest, with Emergence Quantum, co-founded by Reilly and Dr. Thomas Ohki, aiming to bring this technology to market. This advance supports efforts to integrate silicon qubits with
energyquantum-computingcryogenic-technologylow-power-electronicssilicon-chipqubitsquantum-controlUltra-efficient amplifier slashes quantum computer's power use by 90%
Researchers at Chalmers University of Technology have developed a novel amplifier for quantum computers that reduces power consumption by 90% compared to existing models. This breakthrough addresses a critical challenge in quantum computing—decoherence, which occurs when heat and electromagnetic interference from amplifiers disrupt qubit states during measurement. The new amplifier activates only when needed, significantly cutting heat generation and thus minimizing errors in qubit readout. This advancement could enable the construction of larger, more stable quantum computers with increased numbers of qubits and improved computational performance. The key innovation lies in the amplifier’s pulse-operated functionality, which allows it to switch on briefly and precisely to read qubit signals without continuous power use. The team overcame the challenge of rapid activation by implementing a smart control system using genetic programming, enabling the amplifier to respond within 35 nanoseconds. This highly sensitive, low-noise semiconductor amplifier represents the most efficient transistor-based design currently achievable and is expected to help overcome a major technical bottleneck in scaling quantum computers.
energyquantum-computingamplifier-technologypower-efficiencydecoherence-reductionmicrowave-electronicssemiconductor-amplifiersJapan connects quantum and classical in historic supercomputing first
Japan has unveiled the world’s most advanced quantum–classical hybrid computing system by integrating IBM’s latest 156-qubit Heron quantum processor with its flagship Fugaku supercomputer. This historic installation, located in Kobe and operated by Japan’s national research lab RIKEN, represents the first IBM Quantum System Two deployed outside the U.S. The Heron processor offers a tenfold improvement in quality and speed over its predecessor, enabling it to run quantum circuits beyond the reach of classical brute-force simulations. This fusion of quantum and classical computing marks a significant step toward “quantum-centric supercomputing,” where the complementary strengths of both paradigms are harnessed to solve complex problems. The direct, low-latency connection between Heron and Fugaku allows for instruction-level coordination, facilitating the development of practical quantum-classical hybrid algorithms. Researchers at RIKEN plan to apply this system primarily to challenges in chemistry and materials science, aiming to pioneer high-performance computing workflows that benefit both scientific research and industry
quantum-computingsupercomputinghybrid-computingmaterials-sciencehigh-performance-computingIBM-QuantumRIKENWorld’s first quantum satellite computer launched in historic SpaceX rideshare
The world’s first quantum satellite computer was launched into orbit on June 23, 2025, aboard a SpaceX Falcon 9 rocket as part of the Transporter 14 rideshare mission. Developed by an international team led by Philip Walther at the University of Vienna, this compact photonic quantum processor is designed to operate approximately 550 kilometers above Earth. The satellite aims to test the durability and performance of quantum hardware in the harsh conditions of space, including extreme temperature fluctuations, radiation, and vibrations. The device was assembled rapidly in a clean room at the German Aerospace Center, marking a significant engineering achievement. This quantum computer’s primary advantage lies in its ability to perform edge computing in orbit, processing data onboard rather than transmitting raw data back to Earth. This capability can enhance applications such as forest fire detection by reducing energy consumption and improving response times. Utilizing light-based optical systems, the processor efficiently handles complex computational tasks like Fourier transforms and convolutions. The system is adaptable for future missions and holds
quantum-computingsatellite-technologyspace-technologyenergy-efficiencyedge-computingEarth-observationphotonic-quantum-computerMIT builds new superconducting chip to power future quantum computers
Researchers at MIT’s Plasma Science and Fusion Center have developed a superconducting diode (SD)-based rectifier chip that converts alternating current (AC) to direct current (DC) at cryogenic temperatures, aiming to streamline power delivery in superconducting classical and quantum computers. This innovation addresses a critical challenge in quantum computing: reducing thermal and electromagnetic noise caused by numerous wires connecting ultra-cold components to ambient temperature systems. By integrating four superconducting diodes on a single chip, the team achieved efficient AC to DC conversion, potentially enhancing qubit stability and reducing interference, which is vital for the practical realization of quantum computers. Beyond quantum computing, the superconducting diode technology has broader applications, including serving as isolators or circulators to protect qubit signals and playing a role in dark matter detection circuits used in experiments at CERN and Berkeley National Laboratory. This advancement promises to make superconducting electronics more energy-efficient and practical, potentially revolutionizing computing power in the era of increasing demands from technologies like artificial intelligence. The
energysuperconducting-electronicsquantum-computingsuperconducting-diodepower-efficiencycryogenic-technologyMIT-researchNew approach allows to insert, monitor quantum defects in real time
Researchers from the UK’s universities of Oxford, Cambridge, and Manchester have developed a novel two-step fabrication method that enables the precise insertion and real-time monitoring of quantum defects—specifically Group IV centers such as tin-vacancy centers—in synthetic diamonds. These quantum defects, created by implanting single tin atoms into diamond with nanometer accuracy using a focused ion beam, serve as spin-photon interfaces essential for storing and transmitting quantum information. The process is activated and controlled via ultrafast laser annealing, which excites the defect centers without damaging the diamond and provides spectral feedback for in-situ monitoring and control during fabrication. This breakthrough addresses a major challenge in reliably producing Group IV quantum defects, which are prized for their high symmetry and favorable optical and spin properties. The ability to monitor defect activation in real time allows researchers to efficiently and precisely create quantum emitters, paving the way for scalable quantum networks that could enable ultrafast, secure quantum computing and sensing technologies. The method’s versatility also suggests
quantum-defectsdiamond-materialsnanoscale-engineeringquantum-computingquantum-sensingmaterials-sciencequantum-technologyWorld’s first fault-tolerant quantum PC from IBM to launch by 2029
IBM plans to launch the world’s first large-scale, fault-tolerant quantum computer, named Quantum Starling, by 2029. This system will feature 200 logical qubits capable of performing over 100 million quantum operations, representing a 20,000-fold increase in operational capacity compared to current quantum computers. Starling will be developed at a new IBM Quantum Data Center in Poughkeepsie, New York, and will serve as the foundation for a more advanced system, Quantum Blue Jay, which aims to have 2,000 logical qubits and execute one billion operations. The development of fault-tolerant quantum computers hinges on creating logical qubits from clusters of physical qubits to detect and correct errors, enabling large-scale quantum computations without faults. IBM is advancing this goal through innovations such as quantum low-density parity check (qLDPC) codes, which significantly reduce the number of physical qubits needed for error correction by about 90% compared to other methods. IBM’s roadmap also includes intermediate milestones like the Quantum Loon processor (testing qLDPC components in 2025), Quantum Kookaburra (a modular processor integrating quantum memory and logic in 2026), and Quantum Cockatoo (linking Kookaburra modules into a networked system by 2027). These efforts aim to unlock practical, scalable quantum computing with applications in drug discovery, materials science, and chemistry.
quantum-computingIBMfault-tolerant-quantum-computerlogical-qubitsquantum-operationsmaterials-researchenergy-efficient-computingTiny quantum processor outshines classical AI in accuracy, energy use
Researchers led by the University of Vienna have demonstrated that a small-scale photonic quantum processor can outperform classical AI algorithms in machine learning classification tasks, marking a rare real-world example of quantum advantage with current hardware. Using a quantum photonic circuit developed at Italy’s Politecnico di Milano and a machine learning algorithm from UK-based Quantinuum, the team showed that the quantum system made fewer errors than classical counterparts. This experiment is one of the first to demonstrate practical quantum enhancement beyond simulations, highlighting specific scenarios where quantum computing provides tangible benefits. In addition to improved accuracy, the photonic quantum processor exhibited significantly lower energy consumption compared to traditional hardware, leveraging light-based information processing. This energy efficiency is particularly important as AI’s growing computational demands raise sustainability concerns. The findings suggest that even today’s limited quantum devices can enhance machine learning performance and energy efficiency, potentially guiding a future where quantum and classical AI technologies coexist symbiotically to push technological boundaries and promote greener, faster, and smarter AI solutions.
quantum-computingphotonic-quantum-processorartificial-intelligenceenergy-efficiencymachine-learningquantum-machine-learningsupercomputingNew laser crystals boost quantum tech and cut rare earth reliance
materialslaser-technologyquantum-computingrare-earth-elementsoptical-materialsfiber-opticsenvironmental-monitoringRare graphite flakes behave as both superconductor and magnet at 300 K
materialssuperconductivitygraphenemagnetismenergyquantum-computingresearchScientists turn simple clay into base for quantum computer in Norway
materialsquantum-computingclaysemiconductor-propertiesenvironmental-sustainabilitysuperconductorsresearch-collaborationWorld’s fastest quantum switch built by US team for ultra-fast AI
materialsquantum-computinggrapheneultrafast-computingAI-hardwaretransistorslaser-technologyCông ty Mỹ tuyên bố khai thác helium-3 trên Mặt Trăng
robotenergyhelium-3lunar-miningspace-resourcesadvanced-reactorsquantum-computingCan Quantum Computers Handle Energy’s Hardest Problems?
energyquantum-computingNRELenergy-storagepower-grid-reliabilitycomputational-problemsadvanced-computingMeet the companies racing to build quantum chips
quantum-computingquantum-chipstech-startupstechnology-innovationqubitscybersecuritymaterials-science