Articles tagged with "supply-chain"
Critical minerals and rare earth supply
The article highlights the crucial role of critical minerals in supporting the global energy transition, digital infrastructure, and defense capabilities, with the market valued at approximately US$328 billion in 2024 and expected to surpass US$770 billion by 2040 under net-zero scenarios. However, the supply chain faces significant risks due to extreme geographic concentration, especially China’s dominance in processing—accounting for about 70% of refining across 19 of 20 strategic minerals. This vulnerability was underscored by China’s 2025 export controls on rare earths, gallium, and germanium, which disrupted global markets and caused European rare earth prices to spike dramatically. Demand for key minerals like lithium and copper is rapidly increasing, with lithium demand rising nearly 30% in 2024 and projected to grow fivefold by 2040, while copper faces a potential 30% supply shortfall by 2035. Addressing these supply challenges will require substantial investment—estimated at US$500-
energycritical-mineralsrare-earth-elementssupply-chainmining-investmentrecycling-technologiesgeopolitical-risksChoke Points Are The Enemy Of Globalization - CleanTechnica
The article from CleanTechnica, referencing economist Paul Krugman, highlights the vulnerabilities inherent in the globalized supply chain due to numerous "choke points"—critical narrow passages or dependencies in international trade. Despite efforts by the U.S. government to reduce reliance on foreign suppliers, no country, including the U.S., is self-sufficient in producing all raw materials, components, and finished goods. The Strait of Hormuz is a well-known example, but other choke points exist globally, such as Taiwan’s dominance in semiconductor production and South Korea’s role in memory chips. Disruptions in these areas, like those caused by geopolitical conflicts or trade disputes, can significantly impact global manufacturing, as seen when Volkswagen’s electric car production slowed due to a Ukrainian supplier’s disruption after Russia’s invasion. Krugman explains that the complexity and interdependence of global production—termed “hyperglobalization”—have grown dramatically since the 1980s, with products like the iPhone relying on
energysupply-chainsemiconductorsrare-earthsglobalizationmanufacturingtradeUltrahuman ramps up U.S. push with Ring Pro as Oura tightens its grip
Ultrahuman, a Bengaluru-based health-tech startup, is intensifying its efforts to revive its U.S. smart ring business following U.S. Customs and Border Protection approval for its new Ring Pro model. This approval comes after a U.S. International Trade Commission ruling favored competitor Oura, restricting Ultrahuman’s imports of its previous Ring Air model and causing up to $50 million in lost sales. The U.S. market remains crucial, accounting for about 60% of global smart ring sales, which are rapidly growing. During Ultrahuman’s import restrictions, Oura significantly expanded its U.S. market share from 63.3% to 85%, while Ultrahuman’s share dropped from 24.6% to low single digits. Ultrahuman’s CEO Mohit Kumar downplayed the impact, expecting a quick recovery as the company rebuilds its supply chain and distribution over the next five to six months. The Ring Pro features a redesigned unibody metal structure, longer
IoTsmart-ringswearable-technologyhealth-techUltrahumanOurasupply-chainNew US Navy contract speeds up stealth nuclear submarine program
The US Navy has awarded General Dynamics Electric Boat a $15.38 billion contract modification to accelerate the Columbia-class nuclear-powered ballistic missile submarine (SSBN) program. This funding aims to address supply chain disruptions and delays that have slowed the delivery of the first submarines in the 12-vessel fleet, which is set to replace the aging Ohio-class submarines by the 2030s. The Columbia-class submarines, measuring 560 feet in length and capable of speeds over 20 knots with a diving depth exceeding 800 feet, will be the largest in the Navy’s history. They are armed with 16 Trident D5 ballistic missiles and feature advanced stealth technologies, including noise-reducing propulsion and acoustic coatings. The program has faced challenges such as supply chain disruptions linked to the COVID-19 pandemic, delayed material deliveries, and redesign efforts. Additionally, the US submarine supplier base has significantly contracted from about 17,000 suppliers in 1980 to 3,500 in
energynuclear-powersubmarine-technologydefensesupply-chainstealth-technologypropulsion-systemsInside a $1.1B deal to reshore critical minerals refining
The U.S. and Europe face significant challenges in nickel mining and refining, critical for batteries, electronics, and defense, due to permitting and environmental concerns. Currently, Indonesia and China dominate nickel refining, with Chinese companies controlling about 75% of Indonesia’s refining capacity, effectively controlling over half the global supply. This geopolitical dependence has prompted companies to explore domestic refining solutions. One such company, Nth Cycle, has developed a modular electrochemical system to refine nickel and other critical minerals from scrap and waste sources. After starting production in Ohio with a capacity of 3,100 metric tons, Nth Cycle secured a $1.1 billion deal with commodity trader Trafigura to quadruple its output, signaling a shift toward reshoring critical mineral refining and recycling. Nth Cycle’s technology contrasts with traditional large-scale refineries by being smaller, less capital-intensive, and scalable, allowing profitable operation at lower volumes (as low as 6,000 metric tons per year). This modular approach is particularly suited
energymaterialsbattery-recyclingnickel-refiningcritical-mineralselectrochemical-systemsupply-chainCarmaker League Table Shows EV Supply Chains Are Becoming Even Cleaner — Thanks To Strong EU Rules - CleanTechnica
The fourth edition of the Lead the Charge Auto Supply Chain Leaderboard highlights significant progress among global automakers in creating cleaner, more sustainable electric vehicle (EV) supply chains. Driven largely by stringent EU regulations, particularly the Batteries Regulation, carmakers are increasingly adopting low-carbon materials like steel and aluminum, improving transparency, and engaging suppliers directly to address environmental and social impacts. Industry leaders such as Tesla, Volvo, Mercedes, Ford, and Volkswagen are advancing at twice the pace of other companies, with Tesla ranking first overall and Volvo leading in supply chain decarbonization. Notably, EU automakers (except Stellantis) dominate the top rankings, while some large manufacturers like Toyota and Chinese state-owned companies lag behind despite their scale. The report also underscores rapid improvements among Chinese automakers, with Geely emerging as a top East Asian performer by implementing best practices in battery decarbonization, recycling, and human rights. BYD, the largest EV maker globally, has begun establishing supplier codes of conduct
energyelectric-vehiclessupply-chaindecarbonizationsustainable-materialsautomotive-industryEU-regulationsMemory shortage could cause the biggest dip in smartphone shipments in over a decade
The global smartphone market is facing its largest single-year shipment decline in over a decade, primarily due to a severe shortage of RAM driven by increased demand for AI-related computing and data centers. Analyst firm IDC forecasts a 12.9% drop in smartphone shipments in 2026, reducing shipments from 1.26 billion devices in 2025 to 1.12 billion. Counterpoint similarly predicts a 12% decline. This memory shortage is causing smartphone prices to rise sharply, with IDC projecting a 14% increase in average selling price (ASP) to a record $523. The shortage is expected to disproportionately impact lower-end smartphones, especially those priced under $100, potentially making such devices uneconomical to produce and leading to significant shipment declines in regions like the Middle East, Africa, China, and Asia Pacific. The memory crisis is seen as a structural market reset, likely to drive consolidation as smaller and low-end vendors exit the market or face sharp declines due to supply constraints and reduced
materialsmemory-shortagesmartphone-shipmentsRAM-pricesmobile-technologysupply-chainsemiconductor-industryUrban mine: US e‑waste becomes stable source of critical minerals
Researchers at the University of Houston have developed a new supply-chain model aimed at transforming U.S. electronic waste (e-waste) into a profitable and stable domestic source of critical minerals such as gold, lithium, and cobalt. E-waste, which includes discarded phones, tablets, batteries, and circuit boards, is the fastest-growing solid waste stream globally and poses environmental hazards when improperly disposed of. Beyond environmental concerns, e-waste represents a significant loss of valuable materials that the U.S. currently imports, many of which are essential for electric vehicles, advanced electronics, military systems, and renewable energy technologies. Securing these materials domestically is a strategic priority amid rising global demand and geopolitical challenges. The key innovation from the University of Houston team is a collaborative cost-sharing framework that coordinates the fragmented e-waste recycling ecosystem, which includes manufacturers, collectors, processors, and recovery firms. This model shifts the system from competition to partnership, enabling more equitable profit sharing and making large-scale recycling financially sustainable. By
materialse-waste-recyclingcritical-mineralssupply-chainlithiumcobaltsustainable-materials-managementFrom Courtroom to Capital Markets: Why US Tariff Instability Matters - CleanTechnica
The article discusses the implications of the U.S. Supreme Court’s recent decision limiting presidential authority to impose broad tariffs under a specific emergency statute. While this ruling might seem to reduce tariff-related uncertainty, it has instead introduced new layers of risk and volatility in capital markets. The administration’s immediate response to continue tariffs under alternative legal authorities, combined with a refusal to refund previously collected tariffs, creates substitution and retroactivity risks. These risks complicate market pricing, affecting procurement contracts, lender conditions, and investor expectations, particularly in capital-intensive sectors like clean technology. Clean energy infrastructure—comprising steel, copper, lithium, transformers, and other long-lead components—is highly sensitive to tariff volatility because of its reliance on large upfront investments and long asset lifetimes. Increased uncertainty in trade policy raises the weighted average cost of capital (WACC), which in turn increases the levelized cost of energy (LCOE). Even small increases in WACC can make marginal clean energy projects economically unviable, slowing deployment
energyclean-energytariffscapital-marketssupply-chainclean-technologyinfrastructureSpaceX vets raise $50M Series A for data center links
Three former SpaceX engineers—Travis Brashears, Cameron Ramos, and Serena Grown-Haeberli—have founded Mesh Optical Technologies, a Los Angeles-based startup focused on mass-producing optical transceivers. These devices convert optical signals into electrical signals for computers and are critical for data centers, especially those supporting large-scale AI workloads with multiple GPUs. Mesh recently raised $50 million in a Series A funding round led by Thrive Capital. The founders identified limitations in the current optical transceiver market while working on SpaceX’s next-generation satellites and aim to produce 1,000 units daily within a year to qualify for bulk orders by 2027-2028. Mesh is positioning itself as a U.S.-based alternative to the market currently dominated by Chinese suppliers, addressing potential national security concerns related to AI infrastructure dependence on foreign components. Thrive Capital partner Philip Clark emphasized the strategic importance of domestic supply chains for AI data centers. The company’s design innovations include eliminating a power-hungry component
IoTdata-centersoptical-transceiversAI-hardwareenergy-efficiencymanufacturing-automationsupply-chainItalian startup secures parts to build tiny nuclear reactors by 2028
Terra Innovatum Global N.V., an Italian startup specializing in micro-modular nuclear reactors, has achieved a significant milestone by securing its supply chain for both critical and non-critical components needed to build its SOLO reactor. The SOLO reactor, conceptualized in 2018, is designed as a tiny nuclear fission unit with a maximum capacity of 1 MWe, scalable up to 1 GW through modular deployment. Its unique features include the use of off-the-shelf components for cost-effectiveness and rapid deployment, as well as fuel flexibility supporting both LEU+ and HALEU fuels. These reactors are intended to replace fossil-fuel-powered thermal plants and can provide electricity and heat for industrial processes, especially in off-grid or mini-grid settings. The secured supply chain covers nuclear-grade critical components such as the pressure vessel, cooling tubes, control mechanisms, instrumentation, and reactor fuel, which represent the highest barriers to nuclear reactor construction. Additionally, non-nuclear grade yet mission-critical components like helium circul
energynuclear-reactorsmicro-modular-reactorssmall-modular-reactorsclean-energypower-generationsupply-chainChinese parts challenge Optimus humanoid robot production goals in US
Tesla CEO Elon Musk aims to shift production of the Optimus humanoid robot to the US by repurposing its Fremont EV factory, targeting an ambitious output of 1 million units annually. However, Tesla faces a significant challenge due to its heavy reliance on Chinese-made components, which constitute the majority of Optimus’s parts such as actuators, motors, reducers, and vision systems. Morgan Stanley estimates that removing Chinese components from the supply chain would increase costs from $46,000 to $131,000 per unit, conflicting with Tesla’s goal to reduce the robot’s price to around $20,000. Currently, core components are manufactured in China, while final assembly occurs in the US, reflecting a supply chain similar to Apple’s iPhone production. Tesla has developed strong partnerships with Chinese suppliers over the past three years, benefiting from China’s low-cost manufacturing, government subsidies, tax incentives, and research funding in the humanoid robotics sector. The company plans to launch the Optimus V3 model
roboticshumanoid-robotsTesla-Optimusrobot-manufacturingsupply-chainChina-manufacturingrobot-production-costsHere’s the truth: Canada can’t build the car market of the future without exposure to China - Clean Energy Canada
The article from Clean Energy Canada discusses the critical role of China in shaping the future of Canada’s automotive market, particularly in electric vehicles (EVs). While Ontario Premier Doug Ford opposed allowing 49,000 Chinese EVs into Canada at low tariffs, fearing harm to domestic industry, Prime Minister Mark Carney emphasized the need for Canada to compete in the future market, not past ones. The federal government announced plans to give preferential market access to foreign automakers that build EVs in Canada, a strategy inspired by Canada’s success in attracting Japanese manufacturers in the 1980s. This dual approach—allowing a controlled quota of Chinese EV imports and incentivizing domestic production by foreign firms—aims to enhance Canada’s competitiveness by learning from global leaders like China, Korea, and Germany. The article highlights that while Canada’s EV sales declined in 2025, global EV sales surged, with China leading the market and setting technological standards. China’s dominance offers Canada an opportunity to form partnerships and attract
energyelectric-vehiclesautomotive-industryclean-energyChinasupply-chainmanufacturingScaling Solar Smarter: Innovation, Supply Chains, & the Future of Clean Energy - CleanTechnica
The article summarizes a CleanTech Talk episode featuring Marty Rogers, General Manager for SolarEdge North America, who shares insights on the future of solar energy innovation, supply chains, and sustainability. Rogers emphasizes the critical role of reshoring solar manufacturing to the U.S., with SolarEdge investing in production facilities in Florida, Texas, and Utah to produce key components like inverters and circuit boards. This strategy aligns with the Inflation Reduction Act’s domestic content incentives, aiming to enhance supply chain resilience, reduce dependence on global trade, and support domestic job creation and clean technology leadership. SolarEdge is also committed to sustainability beyond product deployment, focusing on decarbonizing its operations through responsible sourcing, waste reduction, and energy-efficient design. Innovation in solar inverters is shifting towards intelligent, grid-connected devices that integrate power management, storage, and load control using AI and software-defined systems. This evolution improves reliability, installer experience, and lowers lifetime costs. The article highlights growing trends across residential, commercial, and grid services
energysolar-energyclean-energyenergy-storageenergy-innovationsupply-chainsustainabilityRio Tinto Expands Solar Power Capacity at Kennecott - CleanTechnica
Rio Tinto has expanded its solar power capacity at the Kennecott copper operations in Utah by energizing a new 25-megawatt (MW) solar plant, adding to the existing 5MW plant completed in 2023. This brings Kennecott’s total solar capacity to 30MW, sufficient to power about 1,026 average American homes annually and reduce the mine’s Scope 2 carbon emissions by approximately 6%, equivalent to removing 4,400 cars from the road each year. The 25MW plant, constructed in partnership with Bechtel and completed ahead of schedule, features over 71,000 solar panels that incorporate tellurium produced onsite—a critical mineral used in solar technology. Kennecott began producing tellurium in 2022 as a byproduct of copper refining, making it one of only two U.S. producers of this mineral. The tellurium is processed into thin-film semiconductor materials by 5N Plus Inc. in Canada
energysolar-powerrenewable-energycritical-mineralstelluriumsupply-chainsustainabilityWe All Pay For Protectionism - CleanTechnica
The article "We All Pay For Protectionism" from CleanTechnica discusses the broad negative impacts of protectionist trade policies on consumers, small businesses, entrepreneurs, and manufacturers. Protectionism, through increased taxes and trade barriers, distorts markets and leads to higher costs for consumers, who end up overpaying for products. Small businesses face squeezed margins and reduced sales due to higher costs of goods, threatening their viability. Entrepreneurs and manufacturers struggle because domestic industrial capabilities and capital are often insufficient to compete with global supply chains, particularly those in China, which benefits from massive industrial ecosystems and a large, skilled engineering workforce that accelerates product development and manufacturing. The article emphasizes that no single country produces all components of modern electronics or technology products; instead, global supply chains involve parts sourced from multiple countries. Protectionism that isolates countries weakens this interconnected technology ecosystem, making innovation more difficult and costly, especially for startups and small businesses that rely on off-the-shelf parts and cannot afford custom manufacturing. Even large
energymanufacturingsupply-chaintradeindustrial-capabilitytechnology-ecosysteminnovationWorld-first Iron Nitride permanent magnet facility set to be built in US
Niron Magnetics, a US-based company, is set to build the world’s first full-scale manufacturing facility for Iron Nitride permanent magnets in Sartell, Minnesota, with operations expected to begin in early 2027. The new 190,000-square-foot plant will have an annual production capacity of 1,500 tons of these magnets, which are made from abundant and domestically sourced iron and nitrogen rather than rare earth materials. This breakthrough technology aims to create a resilient and sustainable US supply chain for permanent magnets critical to industries such as automotive, defense, industrial motors, consumer electronics, and renewable energy. The project, managed by Wood under an engineering, procurement, and construction management (EPCM) contract, represents a significant advancement in sustainable magnet production at scale. Niron Magnetics’ Iron Nitride magnets offer high magnetization without relying on rare earth elements, reducing supply chain vulnerabilities and environmental impacts associated with traditional magnet manufacturing. The Sartell facility builds on the success of a pilot plant
materialspermanent-magnetsiron-nitridesustainable-manufacturingsupply-chainadvanced-manufacturingenergy-applicationsJapan starts world-first mission to mine rare earths from seabed
Japan has initiated a pioneering month-long deep-sea mission to extract rare earth elements from mud located 6 kilometers beneath the ocean surface near Minamitori Island, about 1,900 kilometers southeast of Tokyo. This mission, conducted by the test mining vessel Chikyu, aims to achieve the world’s first continuous recovery of rare earth-rich mud from such depths. The project represents a significant technological milestone and is part of Japan’s strategic effort to develop a domestic source of critical minerals essential for electric vehicles, electronics, and defense systems, thereby reducing its heavy reliance on China, which currently supplies around 60% of Japan’s rare earth imports. The initiative follows years of preparation and comes amid escalating diplomatic and trade tensions with China, which has tightened controls on critical mineral exports and recently banned dual-use item exports to Japan. Japan has invested approximately $250 million since 2018 into this project, though no reserve estimates or production targets have been disclosed. If successful, the mission could diversify Japan’s rare
energymaterialsrare-earth-elementsdeep-sea-miningelectric-vehiclessupply-chainJapanTrump's Greenland bid to break China's rare earth grip falls short
The article discusses former President Donald Trump’s renewed interest in acquiring Greenland as a strategic move to reduce U.S. dependence on China for rare earth elements, which are vital for modern technologies such as electric vehicles, wind turbines, and military hardware. Trump has framed Greenland as a geopolitical necessity to prevent Chinese and Russian influence in the Arctic and has even suggested military action if Denmark refuses to sell the territory. However, experts emphasize that Greenland’s harsh environment, lack of infrastructure, and complex geology make mining rare earth elements there extremely challenging and costly, with no commercial mines currently operational despite significant estimated deposits. Greenland’s remoteness means mining companies would need to build infrastructure from scratch, including roads, power generation, and housing for skilled workers. Environmental risks also pose a major hurdle, as rare earth extraction involves toxic chemicals and potential radioactive contamination, threatening Greenland’s fragile Arctic ecosystem and its growing tourism industry. Compared to other global supply options, Greenland remains a risky and long-term prospect rather than a quick solution to
rare-earth-elementsminingGreenlandsupply-chainmaterials-scienceenergy-technologygeopoliticsEV Price War Over In China? - CleanTechnica
The article discusses the recent shift in the Chinese electric vehicle (EV) market, where a prolonged price war among domestic automakers appears to have ended. Over the past few years, Chinese EV manufacturers aggressively lowered prices to capture market share, leading to rapid sales growth and extremely fast automotive development cycles. However, the Chinese government intervened last year, urging major automakers to curb the intense price competition to prevent market instability and potential crashes. As a result, while price adjustments still occur, the focus has shifted from undercutting prices to enhancing product strength by introducing innovative features and technological advancements. Chinese EV companies are now leading the global automotive industry in terms of technology, market direction, and supply chain development, surpassing the traditional dominance of European and U.S. automakers in China. Foreign automakers, particularly German and Japanese firms, are responding by increasing their research and development efforts within China and leveraging the local EV supply chain to remain competitive. Additionally, regulatory changes in China, such as stricter
energyelectric-vehiclesautomotive-industryChinaEV-markettechnology-innovationsupply-chainNuclear startups are back in vogue with small reactors, and big challenges
The nuclear industry is experiencing a resurgence, driven by significant investment in startups focused on small modular reactors (SMRs). Unlike traditional nuclear plants, which are massive, costly, and prone to delays—as exemplified by the Vogtle 3 and 4 reactors in Georgia that were eight years late and over $20 billion over budget—these startups aim to build smaller reactors that can be mass-produced. The rationale is that smaller reactors can be added incrementally to meet power demands and benefit from manufacturing efficiencies that reduce costs over time. However, experts remain uncertain about the scale of these cost reductions, though startups are betting on them being substantial. Despite abundant capital, the industry faces significant manufacturing challenges, particularly a shortage of skilled human capital and lost industrial expertise in the U.S. due to decades of offshoring and a lack of new factory construction. This shortage spans all levels, from factory floor operators to executives, hindering the ability to scale production efficiently. Yet, some optimism exists as startups are increasingly
energynuclear-energysmall-modular-reactorsmanufacturing-challengessupply-chainindustrial-manufacturingstartup-innovationWhy electric motor makers are moving away from rare-earth magnets
The electric motor industry is increasingly moving away from reliance on rare-earth (RE) magnets, particularly neodymium-iron-boron (NdFeB) magnets, due to supply-chain vulnerabilities and geopolitical risks. Currently, about 95% of new electric vehicle (EV) motors use rare-earth magnets, most of which are sourced from China, a dominant player controlling roughly 70% of rare-earth mining and 90% of permanent-magnet production. Chinese export restrictions and price volatility have exposed automakers to significant strategic risks, prompting companies like BMW, Volkswagen, GM, Nissan, and suppliers such as Aptiv and BorgWarner to explore rare-earth-free motor designs. These alternatives include induction, wound-field, switched-reluctance, and other magnetless motors, with projections indicating a 15% annual growth in demand for rare-earth-free motors and a potential tripling of their market share by 2037. Despite the push for rare-earth-free motors, there are notable trade-offs in performance
energyelectric-motorsrare-earth-magnetsEV-technologysupply-chainsustainable-materialsautomotive-innovationFrom Roombas to e-bikes, why are hardware startups going bankrupt?
The recent bankruptcies of hardware companies iRobot, Luminar, and Rad Power Bikes highlight the significant challenges facing hardware startups today. Each company struggled with a combination of tariff pressures, supply chain disruptions, and changing market dynamics, underscoring the difficulties of manufacturing physical products amid global trade tensions and competition from low-cost overseas producers. These failures serve as a cautionary tale for hardware startups, illustrating how external economic and geopolitical factors can severely impact their viability. The article also references a discussion on TechCrunch’s Equity podcast, where hosts analyze what went wrong for these once-promising companies and explore broader tech industry topics, including Amazon’s substantial investment in OpenAI and new AI regulatory approaches under the Trump administration. Overall, the piece emphasizes the precarious nature of hardware ventures in the current global environment and the need for startups to navigate complex supply chains and market shifts carefully.
robote-bikeshardware-startupssupply-chaintariffsphysical-productsbankruptcyEnergy Minerals Observatory: The Data Deficits in Critical Supply Chains - CleanTechnica
The article from CleanTechnica introduces the Energy Minerals Observatory, a new initiative by the U.S. Energy Information Administration (EIA) aimed at addressing significant data gaps in critical minerals supply chains essential for energy technologies. Critical minerals like copper, cobalt, and silicon are vital for clean energy but suffer from less transparent markets compared to mature energy sectors such as oil and coal. The Observatory plans to enhance data collection and analysis, including field studies on minerals like graphite, vanadium, and zirconium in 2026. The article highlights that both supply- and demand-side data deficiencies hinder accurate price discovery, market analysis, and forecasting for these minerals. On the supply side, the article points out several challenges: timely and regularly updated data on reserves and production are scarce due to underreporting, proprietary data, and inconsistent reporting standards. Unlike oil and gas, critical minerals lack established global price benchmarks, and production costs vary widely due to geographic, environmental, and operational factors. Long development timelines for mining projects
energycritical-mineralssupply-chainminingdata-transparencyenergy-technologymarket-analysisCompany backed by Donald Trump Jr.’s firm nabs $620M government contract
Vulcan Elements, a startup specializing in rare-earth magnets, has secured a $620 million contract from the U.S. Department of Defense. This contract is part of a larger $1.4 billion partnership involving the U.S. government and ReElement Technologies aimed at expanding and strengthening the domestic supply of magnets. Vulcan Elements is backed by 1789 Capital, an investment firm that Donald Trump Jr. joined as a partner in 2024 and which has invested in the company. This government contract is notable for being the largest ever awarded by the Pentagon’s Office of Strategic Capital. In 2025, at least four companies backed by 1789 Capital have received government contracts. The firm also invests in other prominent tech companies like SpaceX and Anduril, both long-time government contractors. Despite the connections, Vulcan Elements and a spokesperson for Trump Jr. have denied any involvement by Trump Jr. in the contract negotiations.
materialsrare-earth-magnetssupply-chaindefense-contractVulcan-ElementsReElement-Technologiesstrategic-capitalWhy custom-part sourcing is breaking hardware teams
The article discusses the persistent challenge hardware teams face in sourcing custom mechanical parts, a problem that remains critical in 2025 despite advances in hardware development and AI-driven acceleration. Traditional sourcing methods—instant-quote platforms and contracting local machine shops—each have significant drawbacks. Instant-quote platforms often lead to inflated costs, lack transparency, and inconsistent quality, while local shops suffer from limited capacity, long lead times, and supply-chain vulnerabilities exacerbated by geopolitical and trade uncertainties. These bottlenecks hinder engineering velocity, which is increasingly crucial for competitive advantage in industries like aerospace, defense, robotics, and industrial machinery. To address these issues, the article introduces Jiga, a specialized sourcing platform designed specifically for professional engineering teams working on complex hardware. Unlike typical instant-quote marketplaces, Jiga offers a vetted network of machine shops, global sourcing capabilities, and a communication interface that facilitates direct interaction between engineers and suppliers. This approach ensures reliable production pipelines, quality assurance, and capacity planning, transforming sourcing from a
roboticshardware-sourcingsupply-chainmanufacturingengineeringindustrial-machineryaerospace-partsMissing in Action? Europe’s Mineral Finance Approach - CleanTechnica
The article from CleanTechnica discusses Europe’s current challenges and shortcomings in financing critical mineral projects essential for the clean energy transition. Despite multiple EU initiatives aimed at securing resilient supply chains for raw materials like battery metals, Europe lags significantly behind global competitors, particularly China, which has invested over USD 15 billion in such projects since 2020. In contrast, EU companies have invested only USD 1.7 billion, all in Argentina. A key issue identified is the fragmented and limited role of European Export Credit Agencies (ECAs) in supporting extractive projects, especially compared to coordinated, whole-of-government approaches seen in countries like China, the US, and Canada. The EU lacks a strategic mechanism to deploy its substantial financing capacity (over EUR 100 billion) effectively and cohesively. The article highlights concerns about the current standards governing ECAs, noting gaps in due diligence, monitoring, disclosure, and grievance handling, which result in inconsistent and often minimal transparency regarding supported projects. This undermines efforts
energymaterialsmineral-financecritical-raw-materialsclean-energy-technologiessupply-chainEuropean-UnionAnother fire breaks out at aluminum plant that supplies Ford
A second significant fire has erupted at the Novelis aluminum plant in Oswego, New York, which supplies sheet metal for Ford’s trucks, including the all-electric F-150 Lightning. This four-alarm fire began on the morning of November 20, 2025, and remains unextinguished. The plant previously experienced a major fire in September that halted operations and was estimated by Ford to potentially cost the company around $2 billion. Despite a smaller fire in October, Novelis had planned to resume production in December. The September fire had already forced Ford to scale back production across its F-150 lineup, prioritizing gas and hybrid models over the electric version. The impact of this latest fire on Ford’s production and supply chain remains unclear, as neither Ford, Novelis, nor the Oswego Fire Department have provided immediate comments. The disruption has also affected other automakers like Stellantis and Nissan, which rely on the same aluminum supplier. Ford had begun slowly ramping up truck production in
energyaluminummanufacturingautomotive-industryelectric-vehiclessupply-chainindustrial-fireTesla To Phase Out Chinese Made Parts For US Cars Within Two Years - CleanTechnica
Tesla plans to phase out the use of Chinese-made parts for its U.S.-market vehicles within the next two years, reflecting broader shifts in supply chain strategies amid ongoing U.S.-China trade tensions and pandemic-related disruptions. The company has quietly informed suppliers to source parts from outside China, aiming to mitigate risks associated with tariffs, trade uncertainties, and geopolitical conflicts. Tesla has also encouraged Chinese suppliers to establish operations in Mexico and Southeast Asia to circumvent tariffs directly targeting China. Additionally, Tesla is transitioning its lithium-iron-phosphate battery production from China to Nevada starting next year. This move aligns with a wider trend among U.S. automakers, as General Motors (GM) is similarly working to reduce reliance on Chinese parts by instructing suppliers to eliminate Chinese content by 2027. GM is focusing on strengthening its North American supply chain and is open to sourcing from countries outside China, Russia, and Venezuela to enhance supply chain resilience. Both Tesla and GM’s strategies underscore a growing emphasis on supply chain diversification
energyautomotive-industrysupply-chainbatteriesmanufacturingtrade-relationsTeslaTesla moves to eliminate China-sourced components in US vehicles
Tesla is actively reducing its reliance on China-sourced components for vehicles produced in the US, following a broader industry trend exemplified by companies like General Motors. The company has already replaced some China-made parts with alternatives from other countries and plans to transition all remaining China-made components within the next year or two. This shift was initially prompted by supply chain disruptions during the Covid-19 pandemic and has accelerated due to steep US tariffs on Chinese imports and geopolitical tensions affecting chip supplies. Tesla’s sales of China-made electric vehicles have also declined sharply, with a nearly 10% drop in October compared to the previous year and a 32.3% decrease in production at its Shanghai plant from September. The US remains Tesla’s largest market, where vehicles are manufactured domestically. Additionally, Tesla has instructed thousands of suppliers to eliminate China-made components, reflecting a wider push among US automakers to reduce dependence on Chinese parts amid export restrictions on rare earths and magnets critical for vehicle production.
energyelectric-vehiclessupply-chainautomotive-componentsrare-earth-materialstariffsmanufacturingCanadian Ports Can Use The 2025 Federal Budget To Win Trade & Cut Diesel - CleanTechnica
The 2025 Canadian federal budget includes a significant but understated commitment to trade and infrastructure through the $5 billion Trade Diversification Corridors Fund, aimed at enhancing ports, rail, airports, and digital infrastructure over seven years. This fund reflects a strategic shift by Ottawa to reduce reliance on the U.S. market by improving logistics and opening new export routes, with goals centered on increasing efficiency, diversifying transportation corridors, and encouraging private investment. Although not explicitly framed as a climate initiative, the fund’s objectives align closely with port electrification efforts, which can improve reliability, reduce energy costs, and lower exposure to volatile fossil fuel markets. Canadian ports currently consume large amounts of fossil fuels for operations, resulting in significant greenhouse gas emissions, local air pollution, noise, and health impacts on workers and nearby communities. The transition to electrification—using electric cranes, yard tractors, and shore power—offers multiple benefits, including lower operating costs, reduced emissions, and enhanced energy security through integration with solar and battery
energyportselectrificationtrade-infrastructurefossil-fuelsrenewable-energysupply-chainChina is rolling back rare earth mineral restrictions, White House saus
The White House announced that following a recent trade agreement between U.S. President Donald Trump and Chinese President Xi Jinping, China will roll back its restrictions on rare earth minerals. Specifically, China will suspend export limitations and resume issuing general licenses for exporting rare earths, gallium, germanium, antimony, and graphite to benefit U.S. end users and their global suppliers. These measures effectively reverse the export controls China imposed in April 2025 and October 2022, which had required foreign companies to obtain licenses for even small quantities of these critical minerals. China is the world’s largest producer of rare earth minerals, essential for manufacturing various technology products. The previous Chinese restrictions had prompted the Trump administration to respond with plans for 100% tariffs on Chinese goods. However, as part of the new trade deal, the White House is now halting those tariff plans and pausing other tariffs on Chinese imports for one year, signaling a de-escalation in trade tensions related to critical mineral supplies.
rare-earth-mineralsmaterials-sciencesupply-chaintrade-policytechnology-manufacturingexport-restrictionscritical-materialsRivian will pay $250M to settle lawsuit over R1 price hike
Rivian has agreed to pay $250 million to settle a class-action shareholder lawsuit stemming from the company's 2022 price hikes on its R1 pickup truck and SUV. The lawsuit accused Rivian of making misleading statements about the costs of building the R1 electric vehicles in its 2021 IPO filings, which allegedly contributed to the stock price decline following the price increase announcement. While Rivian denies any wrongdoing, the settlement requires approval from a U.S. District Court judge. If approved, $67 million will be covered by the company’s directors’ and officers’ liability insurance, with the remaining $183 million paid from cash reserves; Rivian had $4.8 billion in cash as of mid-2024. The settlement arrives as Rivian faces challenges with lagging R1 sales, compounded by tariffs and the loss of federal EV tax credits. The company is restructuring, including layoffs of over 600 employees and CEO RJ Scaringe assuming interim chief marketing officer duties. Meanwhile, Riv
energyelectric-vehiclesRivianEV-manufacturingautomotive-industrysupply-chainelectric-SUVsUS, Australia strike $8.5B rare earths deal to cut China reliance
The United States and Australia have signed a landmark $8.5 billion agreement to develop rare earth and critical mineral projects, aiming to reduce dependence on China and strengthen supply chains vital for defense, technology, and manufacturing. The deal includes an initial $1 billion investment over six months from both countries, with the White House later clarifying that over $3 billion will be invested in critical mineral projects in that period. Additionally, the U.S. Export-Import Bank will issue letters of interest totaling more than $2.2 billion, potentially unlocking up to $5 billion in further investments. Key projects involve rare earth processing in Australia, a trilateral venture with Japan, and a Pentagon-backed gallium refinery in Western Australia. This initiative comes amid escalating U.S.-China trade tensions, particularly after China imposed strict export controls on rare earths, which are essential for high-performance magnets used in defense systems, semiconductors, robotics, and electric vehicles. The U.S. aims to build a supply chain
rare-earthscritical-mineralssupply-chainUS-Australia-dealrare-earth-processingdefense-technologyelectric-vehiclesSlate Auto’s electric truck: See it first at TechCrunch Disrupt 2025
At TechCrunch Disrupt 2025, Slate Auto CEO Chris Barman will unveil the company’s new electric truck live on stage, marking the first public reveal of this next-generation commercial EV. Barman will also discuss Slate Auto’s innovative approach to the commercial electric vehicle market, covering aspects from design and manufacturing to the challenges of hardware innovation, supply chain management, and startup-scale production in a capital-intensive industry. This event promises an unfiltered insider perspective on building a vehicle company focused on affordability, personalization, and advanced technology. Chris Barman brings extensive experience to Slate Auto, having held leadership roles at Chrysler, Eaton Corporation, and HCL Technologies, with expertise in autonomous driving, electrical systems, and driver-assistance technologies. Her background as a mechanical engineer and MBA, combined with her commitment to mentoring women engineers, underscores her leadership in the EV space. TechCrunch Disrupt 2025, held October 27–29 in San Francisco, will gather over 10,000 industry leaders,
energyelectric-vehiclesEV-manufacturingautomotive-technologyhardware-innovationsupply-chaincommercial-trucksThe Effect Of Tariffs On The Auto Industry — It's Not Just EV Manufacturers That Are Hurting - CleanTechnica
The article discusses the widespread negative impact of tariffs imposed by the Trump administration on the global auto industry, affecting not only electric vehicle (EV) manufacturers but the entire automotive supply chain. Tariffs ranging from 7.5% to 25% on automobiles and auto parts have significantly increased production costs, leading to higher vehicle prices for consumers. The complex network of suppliers, many of which are small to midsize companies with slim profit margins, is particularly vulnerable. These suppliers face pressure to adapt by diversifying production, which introduces inefficiencies and longer lead times. Additionally, the shift toward electric vehicles adds uncertainty, as many combustion engine parts may become obsolete, while the administration’s policies favoring internal combustion engines further cloud the industry's future. Internationally, the tariffs are straining relationships with key automotive trading partners such as Japan, Germany, South Korea, China, and Canada. These countries have large automotive parts sectors employing hundreds of thousands of workers, and the tariffs are driving up costs and threatening jobs.
energyelectric-vehiclesautomotive-industrytariffssupply-chainmanufacturingmaterialsThe Trump administration is going after semiconductor imports
The Trump administration is reportedly considering a new policy aimed at boosting U.S. semiconductor production by enforcing a 1:1 manufacturing ratio. Under this approach, domestic semiconductor companies would be required to produce as many chips in the U.S. as their customers import from overseas manufacturers. Companies failing to meet this ratio could face tariffs, although the timeline for achieving this target remains unclear. This move is part of President Donald Trump’s broader efforts, initiated in August, to impose tariffs on the semiconductor industry and encourage reshoring of chip manufacturing. While the ratio-based policy could eventually increase domestic chip production, it poses significant challenges in the short term. Semiconductor manufacturing plants are complex and costly to build, with long lead times before becoming operational. For example, Intel’s Ohio plant, initially expected to open in 2025, has been delayed until 2030. Meanwhile, Taiwan Semiconductor Manufacturing Company (TSMC) has announced plans to support chip production infrastructure in the U.S., but details remain sparse. The proposed
materialssemiconductor-manufacturingchip-productiontariffssupply-chaintechnology-policyUS-manufacturingThe Trump admin is going after semiconductor imports
The Trump administration is reportedly considering a new policy aimed at boosting U.S. semiconductor production by enforcing a 1:1 manufacturing ratio. Under this approach, U.S. semiconductor companies would be required to produce domestically the same number of chips as their customers import from overseas. Companies failing to meet this ratio could face tariffs, although the timeline for achieving this target remains unclear. This move follows President Trump's discussions since August about imposing tariffs on the semiconductor industry to encourage reshoring of chip manufacturing. While the ratio-based policy could eventually increase domestic semiconductor output, it poses risks to the U.S. chip industry in the short term, as manufacturing capacity is currently insufficient to meet demand. Building new semiconductor fabrication plants is a complex and lengthy process, exemplified by Intel’s Ohio plant, which has been delayed multiple times and now aims to open in 2030. Meanwhile, Taiwan Semiconductor Manufacturing Company (TSMC) has announced plans to support U.S. chip production infrastructure, though details are sparse. Overall,
materialssemiconductorchip-manufacturingtariffssupply-chainUS-manufacturingtechnology-policyDoorstep raises $8M seed to help find missing food deliveries
Doorstep, a startup founded by Shashwat Murarka and Sheel Patel, has raised $8 million in a seed funding round led by Canaan Partners to address the challenge of missing food deliveries during the "last mile" of the supply chain. The company’s technology integrates with existing delivery platforms like Uber Eats and DoorDash, using phone sensors to track drivers inside buildings—such as when they enter, take elevators, and reach the correct doorstep—where standard GPS fails. This real-time, verifiable data helps automate dispute resolution and validate deliveries, reducing customer frustration and improving proof-of-delivery accuracy without compromising user or driver privacy. The funding will enable Doorstep to transition from pilot to full production and expand its engineering and product teams. Murarka emphasized that unlike hardware-based competitors (e.g., building sensors or lockers), Doorstep’s software solution is more scalable and cost-effective. Currently active across all US states, the company aims not only to reduce fraud and refund disputes but also to rebuild
IoTdelivery-trackingGPS-technologysupply-chainsensor-technologylast-mile-logisticsfood-deliveryInnovation In Copper Extraction Is Accelerating Amid Soaring Demand - CleanTechnica
The article from CleanTechnica highlights the accelerating innovation in copper extraction driven by soaring global demand, primarily fueled by the energy transition. Copper is essential for electrification across sectors such as transport, renewable energy, and electricity infrastructure, with demand projected to rise from nearly 27 million tonnes in 2024 to 37 million tonnes by 2050. The International Energy Agency (IEA) warns of a potential 30% supply deficit by 2035 due to declining ore grades—down 40% since 1991—and increasing complexity and costs in mining operations. Key demand drivers include construction, electricity networks, electric vehicles (EVs), industrial machinery, and renewable energy installations, with EV copper demand expected to increase sevenfold by 2050. In response to these challenges, venture capital interest is growing in next-generation copper extraction technologies that promise faster, cleaner, and more efficient recovery methods. However, regulatory hurdles, high capital costs, and integration risks pose significant barriers to scaling these innovations quickly
energycopper-extractionelectrificationrenewable-energyelectric-vehiclesmining-innovationsupply-chainHowToRobot launches service to ease sourcing of automation - The Robot Report
HowToRobot, a Denmark-based company, has launched a new AI-powered sourcing service aimed at simplifying the automation procurement process for manufacturers and supply chains. Traditionally, obtaining competitive quotes for automation projects can take months due to the complexity of scoping projects, developing specifications, and soliciting proposals. HowToRobot’s service uses artificial intelligence to interact with buyers, gather detailed requirements, and generate structured project briefs that are then sent to a global network of over 20,000 suppliers, including those offering sensors, end effectors, and complete robotic systems. This approach significantly reduces the time needed to define requirements, match suppliers, review quotes, and arrange financing, potentially compressing a process that once took months into just days. The service evolved from HowToRobot’s consulting experience, addressing challenges faced by buyers new to automation who often struggle to properly scope projects or understand what features are necessary. The AI guides users through key process steps by asking targeted questions based on industry-specific knowledge, such as welding or pallet
roboticsautomationartificial-intelligencemanufacturingsupply-chainindustrial-robotsautomation-sourcingNatron’s liquidation shows why the US isn’t ready to make its own batteries
The recent liquidation of sodium-ion battery startup Natron underscores the significant challenges the U.S. faces in establishing a domestic battery manufacturing industry. Despite having $25 million in orders for its Michigan factory, Natron was unable to deliver products without UL certification—a process that can take several months. Investor reluctance to provide additional funding amid this delay led to a cash crunch, and attempts by the primary shareholder to sell the company stake failed. Consequently, Natron is undergoing liquidation through an “assignment for the benefit of creditors,” a process aimed at a swift asset sale outside of court. This case exemplifies the difficulties startups encounter in scaling battery production without consistent industrial policies and long-term investor commitment, as battery manufacturing typically requires a decade or more to mature. Natron’s struggles are part of a broader pattern of failures among Western battery manufacturers attempting to compete with established Asian supply chains and expertise. The sodium-ion technology, while potentially cheaper due to sodium’s abundance, has been undermined by a lithium price war in
energybatteriessodium-ionbattery-manufacturingsupply-chainlithium-ionenergy-storageWhy the US government is taking a stake in Intel
The Trump administration aims to establish U.S. dominance in artificial intelligence by revitalizing domestic semiconductor manufacturing, a critical component for AI technology. To support this goal, the administration converted a government grant intended for semiconductor manufacturing into an equity stake in Intel, contingent on Intel maintaining majority ownership of its foundry business over the next five years. Intel’s foundry unit, which manufactures custom chips, has faced challenges including regulatory setbacks, leadership changes, and strategic uncertainty since its 2021 launch and subsequent failed acquisition attempts. Former Intel board member Lip-Bu Tan briefly returned in early 2025 with a turnaround plan focused on refocusing the company and workforce, but his ties to China raised concerns among U.S. lawmakers, leading to his abrupt resignation. Shortly afterward, Intel secured a significant investment from SoftBank and finalized the U.S. government’s deal, which positions the government as a passive investor aligned with Intel’s interests. This unprecedented move reflects the administration’s commitment to reshoring semiconductor manufacturing, though questions
semiconductorschip-manufacturingIntelU.S.-governmentAI-technologydomestic-manufacturingsupply-chainTrump warns US could 'destroy China' over magnets with 200% tariff
Former U.S. President Donald Trump warned that the U.S. might impose steep tariffs—up to 200%—on China if Beijing restricts exports of rare-earth magnets, a critical component in various industries. Trump highlighted China’s near-monopoly on these magnets, which supply about 90% of the global market, and suggested that the U.S. holds stronger leverage through aerospace exports, citing Boeing’s aircraft sales to China as a key bargaining chip. He emphasized that tariffs would be a more powerful tool than magnets themselves and hinted at the potential to escalate trade pressure, though he claimed he would refrain from using the most severe measures. The comments came amid a fragile trade truce between the U.S. and China, agreed upon in June, which eased some export restrictions and reduced tariffs on both sides. Despite a recent rebound in China’s rare-earth magnet shipments to the U.S., supply chain vulnerabilities persist, as seen in production halts at companies like Ford and Tesla due to magnet shortages.
materialsrare-earth-magnetstrade-tariffsChina-US-tradesupply-chainaerospace-componentsrenewable-energy-materialsAnduril opens solid rocket motor factory amidst ongoing chemical chokepoint
Anduril has launched a high-volume solid rocket motor (SRM) factory in Mississippi, aiming to become the United States’ third major SRM supplier and break the longstanding duopoly held by Northrop Grumman and L3Harris’ Aerojet Rocketdyne. The factory is expected to produce 6,000 tactical motors annually by the end of 2026, supporting a range of applications from missile interceptors to deep-space probes. This expansion comes amid increased demand for weapons driven by geopolitical tensions such as the Russian invasion of Ukraine and conflicts in the South China Sea. The U.S. Department of Defense has supported new entrants like Anduril, Ursa Major, and X-Bow Systems with funding to move from prototype to commercialization. However, the SRM supply chain faces a critical bottleneck due to the reliance on ammonium perchlorate (AP), a key oxidizer produced at scale by only one qualified supplier, American Pacific (AMPAC) in Utah. Despite
energysolid-rocket-motorsdefense-manufacturingsupply-chainammonium-perchloratemissile-technologyaerospace-materialsApple announces $100B American Manufacturing program - The Robot Report
Apple has announced a $100 billion American Manufacturing Program (AMP), expanding its total U.S. investment to $600 billion over the next four years. The initiative aims to increase domestic production of critical components and advanced manufacturing for Apple products, while incentivizing global partners to manufacture more in the U.S. Apple plans to hire 20,000 workers primarily in research and development, silicon engineering, software development, and AI/machine learning. Initial AMP partners include Corning, Coherent, GlobalWafers America, Applied Materials, Texas Instruments, Samsung, GlobalFoundries, Amkor, and Broadcom. Key projects under AMP include a major expansion of Apple’s partnership with Corning to produce advanced smartphone glass in Harrodsburg, Kentucky, and the opening of an Apple-Corning Innovation Center there. Apple also renewed a multiyear agreement with Coherent to produce VCSEL lasers in Sherman, Texas, and committed to sourcing American-made rare earth magnets from MP Materials, which will also establish
materialsmanufacturingsemiconductorsiliconrare-earth-magnetsadvanced-glasssupply-chainWhy Xiaomi Succeeded At Making Electric Cars But Apple Failed - CleanTechnica
The article compares the contrasting outcomes of Apple’s and Xiaomi’s efforts in the electric vehicle (EV) market, highlighting why Xiaomi succeeded where Apple failed. Apple invested 10 years and $10 billion in its electric car project, Project Titan, but ultimately shut it down with minimal results. In contrast, Xiaomi, a Chinese smartphone maker, successfully developed a compelling electric car, exemplified by the SU7 model, which impressed industry leaders like Ford CEO Jim Farley and set performance records at the Nürburgring. The key to Xiaomi’s success lies in China’s dominance of the EV supply chain, enabling rapid and cost-effective access to components and manufacturing expertise. The article also discusses the role of government support in China’s EV industry, noting that Chinese manufacturers have benefited from substantial subsidies and control over critical resources like battery minerals. While critics often attribute China’s success to exploitative labor practices and authoritarian governance, the article argues that the U.S. has also historically subsidized industries and pioneered key technologies such
electric-vehicleselectric-carsbattery-technologyenergy-storagesupply-chainChinese-manufacturinggovernment-subsidiesUS' lithium battery recycling plant offers yield exceeding 97%
Princeton NuEnergy (PNE) has launched the United States’ first commercial-scale battery recycling facility in Chester, South Carolina, achieving a recycling yield exceeding 97%. This advanced plant produces battery-grade cathode active materials and critical battery minerals domestically, supporting a secure and circular U.S. battery supply chain. The facility is fully permitted, surpasses industry recovery norms, and plans to expand capacity from 15,000 tons per annum (tpa) in 2026 to potentially 50,000 tpa as demand grows. PNE’s technology, developed from Princeton University research, utilizes a patented low-temperature plasma-assisted separation process (LPAS) that recovers nearly all lithium-ion materials across battery chemistries, offering a 38% cost reduction and 69% lower environmental footprint compared to conventional methods. PNE is also advancing direct recycling technologies through a joint pilot facility in Texas and operates the largest Materials Testing Center in the U.S. northeast, facilitating third-party validation and accelerating
energybattery-recyclinglithium-batteriesmaterials-recoverycircular-economysupply-chainsustainable-energyOpinion: Why the EU needs to cut its reliance on Chinese drones
Dr. Robert Brüll, founder and CEO of FibreCoat, argues that Europe must reduce its heavy reliance on Chinese-made drones amid escalating geopolitical tensions and the increasing use of drones in modern warfare, particularly highlighted by the conflict in Ukraine. Chinese drones currently dominate the market due to China’s focused industrial policies and strong state-private partnerships. However, recent US tariffs and China’s tightened export controls on drone components have caused price surges and supply delays, exposing Europe’s vulnerability and underscoring the urgent need for strategic autonomy in drone technology. Brüll emphasizes that Europe possesses the necessary resources—world-class research institutions, a tradition of scientific inquiry, and growing political will—to build a sovereign drone ecosystem. To achieve this, he recommends prioritizing funding for dual-use research with both civilian and defense applications, streamlining bureaucratic hurdles for startups, and ensuring defense funds reach innovative companies. Additionally, he calls for the establishment of a unified EU drone platform to coordinate research, share best practices, and accelerate innovation
dronesroboticsdefense-technologyEuropean-Uniondrone-manufacturingstrategic-autonomysupply-chainJeh Aerospace nets $11M to scale the commercial aircraft supply chain in India
Jeh Aerospace, an Indian startup founded by former Tata Group executives Vishal Sanghavi and Venkatesh Mudragalla, has raised $11 million in Series A funding to address production bottlenecks in the global commercial aircraft supply chain. The company focuses on scaling the manufacturing of precision metallic components for aero engines and aerostructures, supplying U.S.-based Tier 1 suppliers who serve major aircraft manufacturers like Airbus and Boeing. Headquartered in Atlanta to better serve its U.S. customers, Jeh Aerospace operates a 60,000-square-foot precision manufacturing facility in Hyderabad, India, where it leverages software-defined manufacturing, robotics, and IoT to reduce product lead times from the industry standard of 15 weeks to just 15 days. The startup’s approach aims to bring predictability and dynamic scheduling to aerospace component production, helping alleviate the current supply chain constraints amid a surge in global air traffic demand and a record commercial aircraft backlog nearing 15,700 units. Jeh Aerospace deliberately targets
robotIoTaerospace-manufacturingprecision-machinerysupply-chainindustrial-automationaircraft-componentsChina owns the drone industry. Now America needs to usurp it
The article discusses the growing dominance of China, particularly companies like DJI and Autel Robotics, in the global drone industry, with DJI controlling over 90% of the US consumer drone market and more than 70% globally. This concentration has raised significant national security concerns in the United States, prompting the Trump administration to issue executive orders aimed at reducing reliance on Chinese-made drones. These orders restrict federal agencies from using foreign adversaries' drones, accelerate risk assessments, and prioritize domestically built platforms. The US government’s scrutiny of Chinese drone firms has been ongoing since 2017, including bans, warnings about data sharing, and placing DJI on the Department of Commerce’s Entity List, culminating in a 2024 law mandating a national security review and potential sales bans. In response to these challenges, US startups like Corvus Robotics and Zepher Flight Labs are innovating by designing and manufacturing drones entirely in-house, avoiding imports and aiming for technological breakthroughs such as full-stack autonomy and hydrogen propulsion. Cor
dronesroboticsautonomyhydrogen-propulsionUS-manufacturingsupply-chainnational-securityThis industrial AI startup is winning over customers by saying it won’t get acquired
Industrial AI startup CVector is gaining traction with manufacturers, utility providers, and other industrial customers by emphasizing its long-term commitment to staying independent and not being acquired. Founders Richard Zhang and Tyler Ruggles frequently face customer concerns about the startup’s longevity, especially given the competitive tech landscape where large companies often absorb promising startups. To address this, CVector assures clients it will remain operational and mission-focused, a stance that resonates strongly with critical infrastructure customers such as national gas utilities and chemical manufacturers. This commitment is further supported by their choice of investors like Schematic Ventures, who specialize in supply chain and manufacturing software and value long-term founder alignment over quick exits. CVector’s founders bring complementary expertise that builds customer trust: Zhang’s experience developing software for oil industry field workers and Ruggles’ background in experimental particle physics and high-reliability data systems. The company has creatively developed its AI software architecture—described as a “brain and nervous system for industrial assets”—by integrating diverse data sources
energyindustrial-AImanufacturingsoftware-infrastructureutilitiessupply-chainindustrial-operationsChina's rare earth dominance keeps the US in a strategic bind
The article highlights China’s strategic dominance in the rare earth supply chain, contrasting it with the United States’ focus on upstream mining and political maneuvering. While the US primarily extracts rare earth ores, China has developed a comprehensive, end-to-end supply chain encompassing efficient separation, purification, and downstream processing. This dominance did not arise overnight; it is the result of decades of technological innovation and strategic investment, particularly following breakthroughs in the 1970s that allowed China to move from exporting raw ores to producing high-purity rare earth elements at scale. A pivotal figure in this transformation was Xu Guangxian, who in 1972 introduced the “rare earth cascade extraction” method, significantly improving the efficiency and purity of rare earth separation. This innovation enabled China to industrialize rare earth refining without relying on expensive Western equipment, allowing it to surpass Japan and the US in practical refining capabilities. Subsequently, China aggressively lowered prices, outcompeting Western producers and becoming the primary global hub for rare earth processing.
materialsrare-earth-elementssupply-chainmining-technologyChina-dominanceindustrial-innovationresource-extractionApple aims to end rare earth reliance on China with $500M deal
Apple has committed $500 million in a multi-year deal with MP Materials, the only U.S.-based company that mines, processes, and manufactures rare earth materials entirely domestically. This partnership aims to reduce reliance on China for critical rare earth elements, especially neodymium magnets used in Apple devices. As part of the agreement, Apple will purchase American-made magnets from MP Materials’ expanded Independence facility in Texas, which will feature new manufacturing lines tailored for Apple products and is expected to begin global supply by 2027. The expansion will create advanced manufacturing and R&D jobs, alongside training programs to build U.S. expertise in rare earth magnet production. Additionally, Apple and MP Materials will establish a state-of-the-art rare earth recycling plant at the Mountain Pass facility in California to recover materials from electronic waste and industrial scrap, further integrating recycled rare earths into Apple’s supply chain. This initiative builds on Apple’s prior use of recycled rare earth elements since 2019 and supports its broader commitment to invest
materialsrare-earth-elementsneodymium-magnetsrecycling-technologysupply-chainadvanced-manufacturingsustainable-materialsApple commits $500M to U.S.-based rare earth recycling firm MP Materials
Apple has committed $500 million to MP Materials, the only fully integrated rare earth mining company operating in the United States, to bolster the domestic rare earth supply chain. This investment includes Apple's commitment to purchasing American-made rare earth magnets produced at MP Materials’ Fort Worth, Texas facility. The factory will focus on manufacturing neodymium magnets tailored specifically for Apple products, which will be distributed both nationally and globally to meet rising demand. Additionally, Apple and MP Materials will collaborate to establish a rare earth recycling facility in Mountain Pass, California. This plant will process recycled rare earth materials sourced from used electronics and industrial scrap for reuse in Apple devices. The partnership also aims to develop new magnet materials and processing technologies to improve magnet performance. This initiative aligns with Apple’s broader pledge to invest over $500 billion in the U.S. over the next four years and builds on its history of using recycled rare earth elements in its products since 2019.
materialsrare-earth-elementsrecyclingneodymium-magnetssupply-chainApplesustainable-manufacturingInteract Analysis slashes its mobile robot outlook amid tariff uncertainty - The Robot Report
Interact Analysis has significantly downgraded its mobile robot market outlook, citing a combination of geopolitical, economic, and industry-specific challenges. In its May 2025 report, the firm cut the 2025 market forecast by $800 million and lowered the projected compound annual growth rate (CAGR) for 2025–2030 from 26% to 21%, with the 2030 revenue forecast now at $15.6 billion. Central to this revision are the global tariffs introduced by the U.S. administration, which have disrupted supply chains and created considerable uncertainty in capital investments. This uncertainty, reflected in the Global Economic Policy Uncertainty Index reaching an unprecedented high of 430 in January 2025, has led many companies to delay large-scale automation projects in warehouses. Additional factors contributing to the forecast reduction include sluggish growth in warehouse construction due to elevated costs, industrial overcapacity, and ongoing policy uncertainty. Although there are tentative signs of recovery in regions like the U.S. and Japan,
robotmobile-robotswarehouse-automationmarket-forecasttariffs-impactsupply-chainautomation-investmentGlobal Coalition Calls for No Further Weakening of EU Batteries Due Diligence Rules - CleanTechnica
A global coalition of over 30 civil society groups, labor organizations, investors, and businesses has urged the European Parliament to maintain strong due diligence requirements in the EU Batteries Regulation. They warn that any weakening of these rules would undermine responsible and resilient battery supply chains, threaten the competitive advantage of European companies, and hinder efforts to achieve climate neutrality by 2050. The coalition emphasizes that as the world transitions to renewable energy and electric vehicles, robust due diligence in battery sourcing is essential for sustainability. The coalition’s letter to the European Parliament’s environment committee calls on Members of the European Parliament (MEPs) to uphold the current due diligence provisions as proposed by the European Commission and to reject any amendments that would dilute these requirements. They argue that weakening the rules now would place businesses already preparing to comply at an economic disadvantage. The article highlights the critical role of the EU Batteries Regulation in ensuring sustainable supply chains for batteries, which are central to the clean energy transition.
energybatterieselectric-vehiclesEU-regulationsrenewable-energysupply-chainsustainabilityLucid sales inch forward as EV maker pushes to ramp Gravity production
Lucid Motors reported a record delivery of 3,309 vehicles in the second quarter, marking a 6% increase from the previous quarter, alongside producing 3,863 vehicles—nearly 1,000 more than the prior period. Despite this progress in a challenging EV market, the company still faces a significant shortfall in meeting its 2024 production target of 20,000 vehicles, having produced only 6,075 in the first half of the year. To close this gap, Lucid aims to ramp up production of its new all-electric Gravity SUV, which began production in December 2024 but initially was mostly sold to employees, family, and friends. The customer base is gradually shifting toward general consumers, though production has been slower than expected due to tariff pressures and a focus on quality. CEO Marc Winterhoff emphasized that supply chain bottlenecks experienced earlier in the year are being resolved and stressed the importance of prioritizing quality over speed. While Lucid has not disclosed
energyelectric-vehiclesEV-productionautomotive-industrysupply-chainLucid-Motorselectric-SUVHow Minor Metals Could Cause Major Electrification Bottlenecks - CleanTechnica
The article from CleanTechnica highlights a critical but often overlooked challenge in the global electrification transition: the supply constraints of minor or by-product metals such as indium, gallium, germanium, tellurium, selenium, and certain rare earth elements. Unlike primary metals like lithium and cobalt, whose production can be scaled more directly in response to demand, these by-product metals are produced only incidentally during the mining and refining of major metals like copper, zinc, nickel, and aluminum. This dependency means their supply is inherently tied to the extraction rates and market dynamics of unrelated primary metals, leading to unpredictable availability and price volatility that complicates strategic planning for industries reliant on these materials. Economically, the recovery of by-product metals is marginal and highly sensitive to market prices. For example, zinc refiners will only recover indium if its market price justifies the cost; otherwise, it remains in waste streams, causing intermittent shortages. This contrasts with primary metals, where steady demand typically supports sustained
energyelectrificationminor-metalssupply-chainrare-earth-elementsminingmaterialsUS to get rare earths upfront as Trump unveils 55% China tariff plan
U.S. President Donald Trump announced a tentative trade framework with China that includes upfront deliveries of critical rare earth minerals and industrial magnets to the U.S. supply chain, alongside a total tariff rate of 55 percent on Chinese imports. This deal also involves the U.S. honoring prior commitments related to Chinese students studying in American institutions, marking a reversal from recent stricter policies. Trump touted the agreement as a "great WIN" for both countries, emphasizing closer trade collaboration with Chinese President Xi Jinping. However, officials clarified that the 55 percent tariff figure consolidates existing duties rather than representing a new increase from the previous 30 percent rate. The announcement follows quiet negotiations in London aimed at reviving talks after months of trade tensions marked by escalating tariffs and retaliations. While the deal offers temporary clarity on rare earth supplies—vital for manufacturing electric vehicles and defense equipment—it also underscores the volatility of Trump’s trade strategy, which has fluctuated between tariff hikes and reversals. Despite ongoing legal challenges,
rare-earth-mineralsrare-earth-magnetsUS-China-tradetariffssupply-chaincritical-materialsindustrial-magnetsAuto Industry Crash on Horizon from Lack of Rare Earth Minerals & Magnets? - CleanTechnica
The article from CleanTechnica highlights a looming crisis in the auto industry due to China's tightening control over rare earth minerals and magnets, essential components for both electric and gas-powered vehicles. China currently dominates over 90% of the global rare earth supply chain and has recently imposed export restrictions amid escalating trade tensions with the West. These restrictions have led to significant disruptions, with several European automotive suppliers halting production lines because export licenses for these critical materials are scarce—only about 25% of requests have been approved. Consequently, some Chinese magnet manufacturers have paused production, potentially exacerbating future shortages. This supply chain bottleneck threatens not only the automotive sector but also other industries reliant on rare earth elements, such as robotics and military defense systems. The electric vehicle industry is particularly vulnerable since rare earth metals are vital for electric motors and catalytic converters. If the situation persists, the auto industry in the US and Europe could face temporary shutdowns, causing widespread industrial and economic impacts. The article underscores the urgency of resolving these supply chain issues to avoid a severe disruption in vehicle manufacturing and related sectors.
rare-earth-mineralselectric-vehiclesautomotive-industrysupply-chainmagnetsenergy-storagematerials-shortageWho and How Can Help Indonesia Clean Up Its Minerals Act - CleanTechnica
energymineralssustainabilitysupply-chainclean-technologyIndonesiaelectric-vehiclesChina’s 2,200-pound lifting monster drone completes maiden flight
robotdronelogisticsunmanned-aerial-vehicleaerial-transportcargo-dronesupply-chainDHL buying 1,000+ Stretch robots from Boston Dynamics
robotlogisticsautomationBoston-DynamicsStretchsupply-chaindigitalizationEU Battery Due Diligence Rules: Are Carmakers Ready?
energybatteriessustainabilityelectric-vehiclessupply-chainEU-regulationsclimate-changeRivian Aims To Cement Future EV Sales With New Park For Suppliers
energyelectric-vehiclesEV-manufacturingsupply-chaininnovation-hubRiviansupplier-parkRivian’s reportedly sitting on a stockpile of tariff-free batteries
energybatteriesRivianelectric-vehiclestariffslithium-iron-phosphatesupply-chainLocus Robotics surpasses 5B picks with its warehouse automation
Locus-Roboticswarehouse-automationmobile-robotslogisticssupply-chaintechnology-innovationrobotics-industryGet in gear for warehouse automation at the Robotics Summit & Expo
warehouse-automationroboticssupply-chainRobotics-Summiteconomic-challengeslabor-shortagesorder-fulfillment