Articles tagged with "materials"
New tech 3D-prints durable zirconia dental crowns in just hours
Researchers at the University of Texas at Dallas have developed a groundbreaking 3D-printing technology that enables the production of permanent zirconia dental crowns in just a few hours, potentially allowing patients to receive same-day restorations. Zirconia is considered the gold standard for durable dental work, but traditional manufacturing methods, such as milling, limit design complexity and risk micro-cracking. Existing 3D-printed crowns use ceramic resins that lack zirconia’s strength. The key innovation lies in drastically reducing the debinding process—from 20-100 hours to under 30 minutes—by using porous graphite felt, enhanced heat transfer, and a vacuum system that safely removes gas during resin burnout, preventing cracks and fractures. This advancement not only accelerates the production timeline but also offers stronger, more customizable dental restorations compared to resin alternatives and milled zirconia. The technology promises to lower waste and costs while improving patient experience by enabling dentists to provide permanent crowns, bridges, and veneers chair-side in a
materials3D-printingzirconiadental-technologymanufacturing-innovationrapid-prototypingdental-restorationsScientists grow 3D human brains for personalized medicine study
MIT scientists have developed a novel 3D human brain tissue model called Multicellular Integrated Brains (miBrains), which replicates the brain’s full cellular complexity for personalized medicine research. Smaller than a dime, each miBrain integrates the six major brain cell types—including neurons, glial cells, and vascular structures—into a living model that self-organizes into functional units such as blood vessels and a working blood-brain barrier. Derived from patient-specific stem cells, miBrains enable researchers to create personalized brain models reflecting individual genetic backgrounds, offering a more accurate and scalable alternative to traditional cell cultures and animal models. The development of miBrains involved engineering a hydrogel-based “neuromatrix” that mimics the brain’s natural environment and supports cell growth and function. This modular platform allows precise control over cellular composition and genetic editing, facilitating detailed studies of neurological diseases and drug responses. In initial experiments, the researchers used miBrains to investigate the APOE4 gene variant, a major genetic risk factor
materials3D-bioprintingtissue-engineeringpersonalized-medicinebrain-modelshydrogelbiomedical-researchBaker’s yeast may provide a greener way to recover rare earth elements
Researchers at Osaka Metropolitan University have developed a novel method using sulfated baker’s yeast (S-yeast) to recover rare earth elements and other metals such as copper, zinc, cadmium, and lead from waste solutions. This modified yeast adsorbs copper 2.3 times more effectively than previously studied phosphate-modified yeast and allows for metal desorption and reuse through hydrochloric acid treatment, enabling a recyclable recovery cycle. This approach offers a potentially scalable, environmentally friendly alternative to traditional, energy-intensive metal extraction and recycling methods. The innovation addresses critical challenges in rare earth element supply, which is currently dominated by China and vulnerable to geopolitical tensions. Efficient recovery technologies like S-yeast could reduce dependency on overseas sources, stabilize supply chains, and support the growing demand for electronics and green technologies. The research, published in Environmental Research, represents a promising step toward sustainable, cost-effective recycling of rare earth metals from electronic and industrial waste, potentially transforming e-waste into a renewable resource while mitigating environmental
materialsrare-earth-elementssustainable-recyclingmetal-recoverygreen-technologyelectronic-wastesupply-chain-sustainabilityNew twist on classic material could advance quantum computing
Researchers at Penn State University have developed a novel approach to enhance the electro-optic properties of barium titanate, a classic material known since 1941 for its strong ability to convert electrical signals into optical signals. By reshaping barium titanate into ultrathin strained thin films, the team achieved over a tenfold improvement in the conversion efficiency of electrons to photons at room temperature compared to previous results at cryogenic temperatures. This breakthrough addresses a long-standing challenge, as barium titanate had not been widely commercialized due to fabrication difficulties and stability issues, with lithium niobate dominating the electro-optic device market instead. The improved material has significant implications for quantum computing and data center energy efficiency. Quantum technologies often require cryogenic conditions, but transmitting quantum information over long distances needs room-temperature optical links, which this advancement could enable. Additionally, data centers, which consume vast amounts of energy primarily for cooling, could benefit from integrated photonic technologies that use photons rather than electrons to transmit data
materialselectro-optic-materialsbarium-titanatequantum-computingenergy-efficiencydata-centersphotonicsPlastic threat runs skin-deep as ocean alters particle behavior
A recent study by Texas A&M University researchers reveals that nanoplastics—tiny plastic fragments resulting from larger plastic waste—can penetrate the skin’s protective barrier more effectively after acquiring environmental coatings from seawater. Dr. Wei Xu and his team demonstrated that when nanoplastics interact with substances in the ocean, such as proteins and chemicals, they develop surface coatings that help them evade the skin’s immune defenses and cellular disposal mechanisms. This “camouflage” allows the particles to accumulate inside skin cells, potentially increasing their ability to infiltrate the body and carry harmful substances with them. To simulate real-world conditions, the researchers immersed lab-created nanoplastic beads in seawater from Corpus Christi, Texas, before exposing them to cultured skin cells. They found that these environmentally coated particles were significantly better at avoiding immune attacks compared to untreated nanoplastics. The study highlights the complexity of nanoplastic behavior in natural environments, emphasizing that changing environmental factors—such as algal blooms, toxins, or flooding—could alter particle
materialsnanoplasticsenvironmental-coatingsskin-penetrationpollutiontoxicologybiomedical-researchNew breakthrough tech helps extract gold by recycling toxic cyanide
Scientists at Australia’s CSIRO have developed a new Sustainable Gold Cyanidation Technology that improves gold recovery by recycling toxic cyanide used in mining. This process, recently completed in a month-long lab-scale pilot, aims to reduce environmental and health risks associated with cyanide spills, which have historically caused significant ecological damage, such as the 2000 Aural Gold Mine disaster in Romania. Unlike current industry practices that destroy residual cyanide, this technology recovers cyanide and other toxic compounds, as well as some base metals and valuables typically lost in tailings, potentially lowering costs and hazards related to cyanide transport and storage. The researchers are now seeking industry partners to advance to larger-scale field demonstrations. This innovation builds on CSIRO’s previous work, including the ‘Going for Gold’ cyanide-free extraction process using thiosulphate, which has been commercially adopted by Clean Mining. The new cyanidation technology promises greater economic and environmental benefits beyond existing cyanide recovery methods, with the potential
materialsgold-extractioncyanide-recyclingsustainable-miningenvironmental-technologytoxic-waste-managementprecious-metals-recoveryUS firm debuts missile that cruises at 35,000 feet with 575-mile range
Kratos Defense & Security Solutions has introduced the Ragnarök Low-Cost Cruise Missile (LCCM), a new precision strike weapon designed to offer long-range capabilities at a significantly reduced cost. The missile features a 575-mile (500-nautical-mile) range, can cruise at altitudes up to 35,000 feet at speeds exceeding Mach 0.7, and carries an 80-pound payload optimized for precision strikes against high-value or time-sensitive targets. With an estimated unit cost of around $150,000 in bulk production, Ragnarök is positioned as a cost-effective alternative to traditional cruise missiles like the Tomahawk, which costs about $1.5 million per round. The missile’s design emphasizes manufacturability, modularity, and tactical flexibility. It incorporates a carbon-composite fuselage for weight reduction, a wing-folding mechanism for compact storage, and compatibility with various launch platforms, including manned and unmanned aircraft such as the XQ-58 Valkyrie
materialsaerospace-engineeringunmanned-systemsdefense-technologycomposite-materialspropulsion-systemsmissile-technologyDuke engineers break size barrier to print recyclable electronics
Duke University engineers have developed a novel printing technique called high precision capillary printing that enables the creation of fully functional, recyclable carbon-based electronics at sub-micrometer scales. This breakthrough overcomes a previous size limitation of 10 micrometers, allowing the printing of thin-film transistors (TFTs) with features separated by tiny gaps that enhance electrical performance. The team used inks derived from nanocellulose, graphene, and carbon nanotubes, which can be printed on various substrates including glass, silicon, and flexible materials like paper. These advances could enable environmentally friendly manufacturing of electronic displays, reducing energy consumption and greenhouse gas emissions compared to traditional methods. While the printed transistors are not intended to replace high-performance silicon chips, they show promise for applications in display technologies, particularly OLEDs, which demand higher current and multiple transistors per pixel. The technology could significantly reduce the environmental footprint of the $150 billion display industry and help revitalize U.S. manufacturing in a market currently dominated
materialsrecyclable-electronicsprinted-electronicscarbon-based-transistorsnanocellulosegraphenecarbon-nanotubesHow industrial biocatalysts are driving cost-competitive, low-energy PET recycling
The article discusses advances in enzymatic recycling of polyethylene terephthalate (PET), highlighting how engineered biocatalysts are enabling cost-competitive and energy-efficient recycling processes that can rival virgin PET production. Traditional mechanical and chemical recycling methods face challenges such as polymer degradation, inability to process colored or multi-layer plastics, and high energy consumption. Enzymatic recycling uses specialized enzymes to break down PET directly into its monomers—terephthalic acid and ethylene glycol—allowing for a closed-loop system that produces virgin-grade PET. Notably, a process developed by the US Department of Energy’s National Renewable Energy Laboratory (NREL) in partnership with the University of Portsmouth achieves recycled PET at $1.51/kg, undercutting the typical virgin PET cost of about $1.87/kg, while reducing energy and chemical use by over 99%. A critical hurdle for enzymatic recycling is the heterogeneous nature of real-world PET waste, which includes colored bottles, mixed polymers, labels,
energymaterialsenzymatic-recyclingPET-recyclingsustainable-materialsbiocatalystspolymer-recycling7 of the world’s most futuristic bridges that redefine engineering
The article highlights seven of the world’s most futuristic bridges that exemplify the fusion of advanced engineering and artistic design, transforming bridges from mere functional structures into iconic symbols of innovation. It begins by outlining the main types of modern bridges—suspension, cable-stayed, arch, beam, truss, cantilever, and movable—each with distinct structural principles and examples like the Golden Gate Bridge, Øresund Bridge, and Sydney Harbor Bridge. This foundational knowledge sets the stage for appreciating the featured bridges’ engineering marvels. Among the highlighted bridges, the Millau Viaduct in France stands out as a multi-span cable-stayed bridge towering 343 meters above the Tarn Valley, surpassing the Eiffel Tower in height. Designed by Norman Foster and Michel Virlogeux, it incorporates aerodynamic features inspired by aircraft to resist high winds and was constructed using innovative hydraulic techniques over three years at a cost of €394 million. Another example, the Henderson Waves Bridge in Singapore, showcases steel pedestrian bridge design
materialsengineeringbridge-designsuspension-bridgescable-stayed-bridgesarch-bridgesstructural-materialsPhotos: 112-mph wind resistant tent boasts fast setup, rugged upgrades
The German company Heimplanet has introduced the Mavericks Blue Ice tent, touted as its strongest and most rugged model to date. Designed for extreme conditions, the tent withstands winds up to 112 mph (180 km/h) and incorporates over a decade of testing and customer feedback. While retaining its signature “Inflatable Diamond Grid” geodesic air frame, the Blue Ice version upgrades the fabric with a 5,000-mm silicone-polyurethane coating for enhanced tear resistance and weatherproofing. Additional improvements include a redesigned roof for better rainwater drainage and snow shedding, reinforced seams for superior waterproofing, and an enhanced ventilation system to reduce condensation and increase comfort during harsh weather. The tent also features faster setup capabilities through dual two-way floor pumps, enabling two people to inflate it simultaneously and cut setup time from 10 to 5 minutes. The complete package includes a range of accessories such as extra-large stakes, a removable groundsheet, guy lines, a repair kit, and a duffel
materialsoutdoor-geardurable-fabricweatherproofinginflatable-frameexpedition-equipmentcamping-technologyFluorinated polymers clean up stubborn heart drugs from water
Researchers at Seoul National University of Science and Technology have developed fluorinated covalent organic polymers (FCOPs) that effectively remove persistent beta-blocker drugs, such as atenolol (ATL) and metoprolol (MTL), from water. These heart medications, designed to resist breakdown in the human body, often pass through conventional wastewater treatment plants and contaminate aquatic ecosystems, where even trace amounts can harm algae and fish. The newly synthesized FCOPs demonstrated rapid and high adsorption capacities, removing over 67% of these drugs within the first minute of exposure. The study revealed a unique sigmoidal adsorption pattern, indicating that at higher concentrations, multilayer adsorption occurs, significantly enhancing pollutant uptake. This exceptional performance is attributed to three synergistic mechanisms: strong intermolecular interactions due to abundant fluorine atoms, electrostatic attraction between positively charged beta-blockers and the negatively charged FCOP surface, and the hydrophobic nature of FCOPs that promotes molecule aggregation. These findings highlight FC
materialsfluorinated-polymerswater-purificationcovalent-organic-polymersenvironmental-technologypharmaceutical-removaladsorption-technologyScientists 'draw' crystals with gold and laser for better solar panels
Researchers at Michigan State University have developed a groundbreaking technique to precisely control the growth of crystals by using a single laser pulse targeted at gold nanoparticles. This method enables crystals to form at exact locations and times, overcoming the traditional unpredictability of crystal nucleation and growth. The team focused on lead halide perovskites—materials integral to solar cells, LEDs, and medical imaging—and discovered that laser-induced heating of gold nanoparticles initiates crystallization. Their use of high-speed microscopy allowed real-time observation and steering of crystal formation. This innovative approach effectively allows scientists to "draw" crystals with laser precision, potentially revolutionizing the fabrication of high-quality materials for advanced technologies such as clean energy and quantum devices. The technique not only advances material design but also sheds new light on the fundamental chemistry of crystal formation. Future research aims to employ multiple lasers of different colors to create complex crystal patterns and synthesize novel materials unattainable by conventional methods, with plans to integrate these crystals into practical devices. The study was
materialscrystalslaser-technologygold-nanoparticlessolar-panelsperovskitesclean-energyWorld’s first tunable nonlinear photonic chip targets quantum use
Researchers from NTT Research, Cornell University, and Stanford University have developed the world’s first programmable nonlinear photonic waveguide, a breakthrough device capable of switching between multiple optical functions on a single chip. This innovation challenges the traditional “one device, one function” limitation in photonics, where devices are fixed to a single task during fabrication. By using a silicon nitride core and projecting structured light patterns onto the chip, the device dynamically creates programmable regions of optical nonlinearity, enabling rapid reconfiguration of its optical functions. Demonstrated capabilities include arbitrary pulse shaping, tunable second-harmonic generation, holographic generation of spatio-spectrally structured light, and real-time inverse design of nonlinear-optical functions. The technology promises significant impacts across optical and quantum computing, communications, and tunable light sources by reducing costs, improving manufacturing yields, and enabling more compact, power-efficient optical systems. This flexibility is particularly valuable for quantum computing, where programmable quantum light sources and frequency converters can enhance
materialsphotonicsquantum-computingoptical-devicessilicon-nitridenonlinear-opticsprogrammable-chipMini 3D printer could enable on-site tissue repair inside human body
Researchers at the University of Stuttgart, led by Andrea Toulouse, have developed a miniaturized 3D printer capable of creating living tissue directly inside the human body. This innovative device uses a glass optical fiber thinner than a pencil lead, equipped with a tiny 3D-printed lens no larger than a grain of salt, to focus laser light and cure bio-inks layer by layer with micrometer precision. This approach aims to overcome the limitations of traditional bioprinting, which requires implanting pre-grown tissues and relies on large, less precise printers unsuitable for in-body use. The project, supported by a $2 million grant from the Carl Zeiss Foundation, combines photonics, biotechnology, and precision engineering to enable endoscopic 3D printing of complex tissue structures at the cellular scale. Collaborating with experts in biomaterials, the team is also developing biodegradable bio-inks compatible with living cells to ensure safe integration into the body. By integrating their research into the Bionic Intelligence Tüb
materials3D-printingbio-inksmicro-opticsregenerative-medicinetissue-engineeringphotonicsEurope’s e-waste could yield over 1 million tons of critical materials
A recent report by the EU-funded FutuRaM consortium reveals that Europe’s electronic waste (e-waste) contains an untapped "urban mine" of over 1 million tons of critical raw materials (CRMs) annually. In 2022, Europe generated 10.7 million tonnes of e-waste, but nearly half (46%) was lost through non-compliant disposal methods such as landfills and incineration, resulting in significant material losses. From the e-waste that was properly treated, about 400,000 tonnes of CRMs—including copper, aluminum, silicon, tungsten, and palladium—were recovered. The report projects that by 2050, e-waste volume could rise to between 12.5 and 19 million tonnes annually, with CRMs increasing to 1.2 to 1.9 million tonnes, and recovery potentially exceeding 1.5 million tonnes per year. The findings underscore Europe’s heavy reliance on imports for over 90
energymaterialse-wasterecyclingcritical-raw-materialscircular-economysustainabilityChinese tanks could soon strike like fighter jets to kill beyond sight
China’s People’s Liberation Army (PLA) is revolutionizing its armored warfare by equipping its new-generation main battle tanks, notably the Type 100, with advanced sensors, artificial intelligence, and networked warfare capabilities. This transformation enables tanks to engage targets beyond visual range, a capability traditionally reserved for air and naval forces. The Type 100 tank integrates optical, infrared, radar sensors, and electronic warfare tools, allowing it to perceive the battlefield with full-circle awareness and coordinate long-range strikes in real time. This marks a significant shift from conventional close-range tank battles to a more sophisticated, information-driven combat approach. The PLA’s recent exercises demonstrated the integration of these tanks with other military branches, including helicopters, rocket launchers, electronic warfare units, and reconnaissance drones, forming a highly coordinated joint force. Military analysts highlight that China’s breakthroughs in miniaturizing radar and communication systems have overcome the challenges of fitting advanced beyond-visual-range capabilities into the limited space and power of ground vehicles. This development
robotIoTenergymaterialsartificial-intelligencesensorsnetworked-warfareWorld's most powerful X-ray laser spots warm ice under pressure
Researchers using the world’s most powerful X-ray laser at the European XFEL, along with DESY’s PETRA III photon source, have discovered a new metastable phase of ice called ice XXI. This form of ice emerges when water is rapidly compressed to extreme pressures—up to two gigapascals—while maintained at room temperature. Unlike previously known ice phases, ice XXI has a unique tetragonal crystal structure with large repeating units and forms through rapid compression that prevents water from crystallizing into the expected ice VI phase. The discovery challenges existing models of ice formation and suggests that additional high-temperature metastable ice phases may exist. The experiments employed a diamond anvil cell to simulate the extreme pressures found inside icy moons and exoplanets, such as Titan and Ganymede, where ice VI is believed to be stable. By compressing water extremely quickly within milliseconds, the researchers captured the crystallization process using ultrafast X-ray pulses from the European XFEL, effectively filming atomic-scale transitions in
energymaterialshigh-pressure-physicsice-phasesmetastable-materialsX-ray-laserEuropean-XFELThis ultra-rare 223-mph speeding hypercar is 887 hp manual masterpiece
The Capricorn 01 Zagato is a new ultra-rare hypercar born from the collaboration between Italian design house Zagato and German engineering firm Capricorn Group. Marking Zagato’s first hypercar design, it combines their signature aesthetic with Capricorn’s extensive motorsport engineering experience, including work for Formula 1, Le Mans, and high-performance road cars like Bugatti and Porsche. The car is designed to be road-legal and driver-focused, featuring a rear-wheel-drive layout paired with a five-speed manual transmission for an engaging driving experience. Powered by a supercharged 5.2-liter V8 engine derived from a Ford unit, the Capricorn 01 produces 887 horsepower and 737 lb-ft of torque, with a redline of 9,000 rpm. Its lightweight carbon-fiber structure, inspired by LMP1 endurance race cars, keeps the weight under 2,645 pounds. Performance highlights include a 0-62 mph time under 3 seconds and a top speed of
materialscarbon-fiberautomotive-engineeringhigh-performance-enginessupercharged-V8carbon-ceramic-brakesaerodynamicsRecycling breaks new ground as PET plastics shattered by pure force
Researchers at Georgia Tech have developed an innovative mechanochemical recycling method to efficiently break down polyethylene terephthalate (PET) plastics without the use of heat or solvents. PET, widely used in bottles, packaging, and fibers, is difficult to recycle due to its strong molecular bonds, leading to significant plastic waste accumulation. The team, led by Kinga Gołąbek and Professor Carsten Sievers, utilized metal balls to apply mechanical impacts to solid PET pieces, generating enough energy to trigger chemical reactions with sodium hydroxide (NaOH) at room temperature. This approach enables the decomposition of PET into its original molecular components in a controlled and energy-efficient manner, potentially transforming plastic recycling into a more sustainable process. Through controlled single-impact experiments and computer simulations, the researchers mapped how collision energy disperses through PET, causing structural and chemical changes in localized zones. These impacts created micro-craters where PET chains stretched and cracked, facilitating reactions with NaOH, and even mechanical force alone was sufficient to break some molecular
materialsrecyclingPET-plasticsmechanochemical-recyclingsustainable-materialsplastic-waste-managementchemical-engineering2D flash-silicon chip achieves record speed, 94% memory yield
Researchers at Fudan University have developed the world’s first full-featured 2D flash memory chip integrated with traditional silicon CMOS technology, achieving a record operation speed and a 94.3% memory cell yield. This hybrid chip supports eight-bit instruction operations and 32-bit high-speed parallel random access, surpassing existing flash memory speeds. The innovation represents a significant breakthrough in combining ultrathin 2D semiconductor materials—just a few atoms thick—with mature silicon platforms, addressing key limitations in speed and power consumption that have hindered AI and data-intensive computing systems. The team overcame major challenges in integrating fragile 2D materials onto the uneven surfaces of conventional silicon wafers by employing flexible 2D materials and a modular, atomic-scale bonding approach. This method enables stable, high-density interconnections between the two technologies, facilitating efficient communication and paving the way for industrial-scale production. The chip has completed its tape-out phase, and plans are underway to establish a pilot production line to scale manufacturing.
materialssemiconductorflash-memory2D-materialssilicon-chipCMOS-technologydata-storageUK scientists' artificial leaf turns CO2, sunlight into useful chemicals
Researchers at the University of Cambridge have developed a novel hybrid device, described as a “semi-artificial leaf,” that mimics natural photosynthesis to convert sunlight, water, and carbon dioxide into useful chemicals, specifically formate. This innovation combines light-harvesting organic polymers with bacterial enzymes, avoiding toxic semiconductors used in earlier prototypes. The device operates without external power or additional chemicals, demonstrating improved stability and efficiency, running continuously for over 24 hours—more than twice the duration of previous models. This breakthrough offers a promising pathway toward the “de-fossilisation” of the chemical industry, which currently relies heavily on fossil fuels and accounts for about 6% of global carbon emissions. By using organic semiconductors as the light-harvesting component—a first in biohybrid devices—the researchers achieved near-perfect electron efficiency in fuel production and successfully integrated the system into a domino chemical reaction to produce pharmaceutical compounds with high yield and purity. The team aims to further enhance the device’s lifespan
energymaterialsartificial-leaforganic-semiconductorssustainable-chemistrycarbon-dioxide-conversionphotocatalysisJapan achieves near-frictionless levitation on macroscopic rotor
A research team at the Okinawa Institute of Science and Technology (OIST) has developed a groundbreaking graphite-only levitating rotor that eliminates eddy-current damping, a major source of energy loss in macroscopic levitating systems. By using a one-centimeter graphite disk with rare-earth magnets and leveraging axial symmetry, the rotor spins freely without resistance from eddy currents, which typically arise when conductive materials move through changing magnetic fields. This innovation preserves strong levitation strength while removing friction-like damping, overcoming limitations of previous designs that mixed graphite with other materials and weakened levitation. The key to this advancement lies in the rotor’s rotational symmetry, which keeps it within a constant magnetic flux during rotation, preventing eddy currents from forming. This contrasts with earlier plate designs that experienced damping due to fluctuating magnetic flux when moving vertically. The team confirmed their findings through simulations, mathematical proofs, and experiments, showing that performance now hinges on maintaining perfect axial symmetry and minimizing air friction by operating in near-vacuum conditions
materialslevitation-technologygraphite-rotorquantum-researchmagnetic-levitationeddy-current-dampingprecision-sensingBacteria in Norway's spruce tree needles found hiding gold: Study
A recent study has revealed that Norway spruce trees near gold deposits, such as those around the Kittilä gold mine in Northern Finland, contain microscopic gold nanoparticles within their needles. This gold accumulation is facilitated by symbiotic bacteria, known as endophytes, living inside the tree tissues. These microbes convert soluble gold absorbed from the soil into solid nanosized particles through a process called biomineralization, likely as a means to reduce the metal’s toxicity. DNA sequencing identified specific bacterial groups, including P3OB-42, Cutibacterium, and Corynebacterium, associated with gold-containing needles, suggesting these bacteria play a key role in transforming gold inside the trees. Although the gold nanoparticles are too small for commercial extraction, the discovery holds significant potential for environmentally friendly mineral exploration. By screening for microbial fingerprints in plants, geologists could more efficiently locate underground gold deposits without extensive drilling, reducing environmental impact. Furthermore, the biomineralization process may extend to other minerals and plant species
materialsbiomineralizationgold-nanoparticlesbacteriaNorway-sprucemineral-explorationenvironmental-technologyNew 3,632°F-resistant alloy could slash fuel use in planes, turbine
Researchers at the Karlsruhe Institute of Technology (KIT) in Germany have developed a novel chromium-molybdenum-silicon alloy with a melting temperature of about 2,000°C (3,632°F), offering unprecedented high-temperature stability and ductility at room temperature. Unlike traditional refractory metals that are brittle and oxidize rapidly at elevated temperatures, this new alloy oxidizes slowly even in critical temperature ranges, potentially enabling components to operate safely at temperatures well above the current limit of 1,100°C (2,012°F) set by nickel-based superalloys commonly used in aircraft engines and gas turbines. This breakthrough could significantly improve fuel efficiency in aviation and power generation, as increasing turbine operating temperatures by just 100°C (180°F) can reduce fuel consumption by approximately 5%. Given that long-haul flights will continue to rely on jet fuel for the foreseeable future, the alloy’s ability to withstand higher temperatures could help reduce fuel use and CO2 emissions, supporting environmental goals. While
materialshigh-temperature-alloysrefractory-metalsaircraft-enginesfuel-efficiencygas-turbineschromium-molybdenum-silicon-alloyPlastic bottles upcycled into high-performance supercapacitors
Researchers have developed an innovative method to upcycle poly(ethylene terephthalate) (PET) from single-use plastic bottles into components for high-performance supercapacitors, devices that rapidly store and release energy. By converting PET into porous carbon electrodes through heating with calcium hydroxide and creating perforated PET film separators, the team produced an all-plastic supercapacitor that outperformed similar devices using traditional glass fiber separators. This approach not only offers efficient and recyclable energy storage solutions but also addresses the global plastic pollution crisis by diverting billions of discarded bottles from landfills and oceans. The PET-based supercapacitor demonstrated comparable capacitance retention (79%) to conventional models (78%) while being cheaper to produce and fully recyclable. Lead researcher Yun Hang Hu emphasized the potential for these PET-derived supercapacitors to find applications across transportation, electronics, and industrial sectors, contributing to circular energy storage technologies. With further optimization, these devices could transition from laboratory prototypes to market-ready products within five to ten years,
energymaterialsrecyclingsupercapacitorssustainable-energy-storageplastic-upcyclingPET-recyclingIntel unveils new processor powered by its 18A semiconductor tech
Intel has unveiled its next-generation Intel Core Ultra processor, codenamed Panther Lake, marking a significant hardware upgrade powered by the company’s new 18A semiconductor process. This chip, the first built using the 18A technology, is expected to ship later in 2025 and is manufactured at Intel’s Fab 52 facility in Chandler, Arizona, which began operations in 2024. Intel CEO Lip-Bu Tan emphasized that this advancement signals a new era in computing, driven by breakthroughs in semiconductor technology, manufacturing, and packaging, aligning with his vision to revitalize Intel’s engineering culture and innovation. In addition to Panther Lake, Intel previewed its Xeon 6+ server processor, codenamed Clearwater Forest, also based on the 18A process, with a planned launch in the first half of 2026. This announcement represents Intel’s largest manufacturing milestone in years and highlights the strategic importance of domestic chip production. Intel’s press release underscored that the 18A
materialssemiconductor-technologyIntel-processors18A-processchip-manufacturingadvanced-packagingcomputing-innovationEngineered biodegradable plastics disappear in the deep ocean
Researchers from Japan have developed a novel biodegradable plastic, called LAHB (lactate-based hybrid polymer), that can degrade in the deep ocean—addressing a major environmental challenge where conventional biodegradable plastics like polylactide (PLA) fail. While PLA is widely used and compostable at high industrial temperatures, it does not break down in marine environments because marine bacteria lack the enzymes to recognize and degrade its molecular structure. In contrast, LAHB combines lactic acid from PLA with 3-hydroxybutyrate (3HB) from polyhydroxybutyrate (PHB), a naturally occurring polyester that marine microbes can digest. This hybrid polymer maintains material strength while being susceptible to microbial degradation in deep-sea conditions. The breakthrough stems from engineering Escherichia coli bacteria to biosynthesize LAHB by inserting genes for a lactate-polymerizing enzyme, enabling the production of a plastic that balances durability with biodegradability. Marine bacteria have evolved depolymerase enzymes that
materialsbiodegradable-plasticsocean-pollutionpolymersmarine-microbesplastic-degradationsustainable-materialsNovoloop’s upcycled plastic takes a step closer to production
Novoloop, a plastic recycling startup based in Menlo Park, has secured a commercial-scale production deal with Huide Science and Technology to supply a chemical building block—polyol—used to make thermoplastic polyurethane (TPU). Novoloop’s polyol is produced from post-consumer polyethylene waste, such as plastic bags, which are notoriously difficult to recycle. TPU is a versatile plastic used in products ranging from running shoes to medical devices. This agreement marks a significant milestone for Novoloop as it navigates the challenging “valley of death” phase common to hardware-dependent climate tech startups, where technology validation has occurred but revenue generation remains limited. Currently, Novoloop operates a demonstration plant in India capable of producing tens of tons of polyol annually, sufficient for major pilot projects including an upcoming footwear collaboration. The company previously supplied Swiss shoe manufacturer On with its Lifecycled TPU material. CEO Miranda Wang emphasized that achieving economies of scale through deals like the one with Huide is critical
materialsplastic-recyclingthermoplastic-polyurethaneupcycled-materialssustainable-materialschemical-building-blocksclimate-techMIT doubles optical atomic clock precision with quantum trick
MIT physicists have developed a new quantum technique called global phase spectroscopy that doubles the precision of optical atomic clocks by overcoming quantum noise, a fundamental barrier in measuring atomic oscillations. Optical atomic clocks, which use atoms like ytterbium ticking up to 100 trillion times per second, are more precise than traditional cesium-based clocks but have been limited by quantum noise obscuring their natural rhythm. The new method leverages a subtle laser-induced "global phase" in entangled ytterbium atoms, amplifying this signal through quantum entanglement to detect twice as many atomic "ticks" per second and significantly improve clock stability. This advancement builds on prior MIT research involving entanglement and time-reversal techniques that enhanced microwave clock precision but had not been successfully applied to the much faster optical clocks. By amplifying the global phase signal left by laser interactions with entangled atoms, the researchers can more effectively detect and correct laser drift, a major source of instability. This breakthrough paves the way for smaller
materialsquantum-technologyatomic-clocksprecision-measurementoptical-clocksquantum-noise-reductiontimekeeping-technologyChina's bamboo plastic with mechanical strength biodegrades in 50 days
Researchers at China’s Northeast Forestry University have developed a novel bamboo-based bioplastic that combines exceptional mechanical strength with rapid biodegradability. This new material, produced through a non-toxic, alcohol solvent-based process that dissolves and reorganizes bamboo cellulose at the molecular level, exhibits tensile strength of 110 MPa and a flexural modulus of 6.41 GPa, outperforming many commercial plastics such as polylactic acid and high-impact polystyrene. It also offers superior thermal stability above 180 °C and can be processed using conventional industrial techniques like injection molding and machining. Unlike traditional bamboo composite plastics, which often have inferior mechanical properties and incomplete biodegradability due to their fiber-resin composition, this bamboo molecular plastic fully biodegrades in soil within 50 days and supports closed-loop recycling with 90% retention of strength. Published in Nature Communications, the research highlights the material’s potential as a sustainable, high-performance alternative to oil-based plastics, addressing both environmental concerns and industrial application demands
materialsbiodegradable-plasticsbamboo-plasticsustainable-materialsbioplasticsmechanical-strengththermal-stabilityMIT's high strength aluminum alloy can withstand high temperature
Researchers at MIT have developed a novel printable aluminum alloy that is reportedly five times stronger than traditionally manufactured aluminum and can withstand high temperatures. Using a machine learning (ML)-based approach combined with simulations, the team evaluated only 40 possible material compositions—significantly fewer than the over one million combinations typically required—to identify an optimal mix of aluminum and other elements. This alloy exhibits a high volume fraction of small precipitates, which contribute to its enhanced strength, surpassing previous benchmarks including the wrought Al 7075 alloy. The new alloy, produced via 3D printing rather than conventional casting, benefits from rapid solidification that prevents precipitate growth, resulting in superior mechanical properties. After aging at 400 °C for eight hours, the alloy achieves a tensile strength of 395 MPa at room temperature, about 50% stronger than the best-known printable aluminum alloys. The researchers envision applications in lightweight, temperature-resistant components such as jet engine fan blades—traditionally made from heavier and more expensive
materialsaluminum-alloy3D-printinghigh-strength-materialsmachine-learningadditive-manufacturinglightweight-materialsGerman students grow igloos from mushrooms for sustainable shelter
A team of architecture students at Frankfurt University of Applied Sciences (Frankfurt UAS) in Germany has developed MyGlu, a sustainable, mushroom-based igloo designed for hot, dry climates. The dome-shaped prototype is constructed entirely from mycelium—the root-like structure of fungi—grown on wood waste. This lightweight, modular, and fully biodegradable structure offers natural insulation, water resistance, and sound-dampening properties, making it suitable for climate-affected regions, humanitarian crises, or areas with material shortages. The design draws inspiration from traditional Arctic igloos but is specifically tailored to provide cooling and shelter in arid environments. The project, led by Florian Mähl, PhD, aims to establish mycelium-based construction as a key research focus at Frankfurt UAS, with plans to improve production processes and expand applied studies. MyGlu demonstrated promising thermal and acoustic performance during testing, showing potential as a low-cost, climate-neutral housing solution. Recognized with the university’s Sustain Award in
materialssustainable-materialsmyceliumgreen-buildinginsulationbiodegradable-materialssustainable-architecture7 sci-fi space suits mixing futuristic style with functional design
The article highlights seven sci-fi space suits from films and series that blend futuristic aesthetics with functional design, illustrating how costume designers and filmmakers envision the future of astronaut gear. These suits are not merely theatrical props but often incorporate realistic elements inspired by current or emerging space technologies. For example, the suits in Sunshine (2007) feature gold-plated helmets modeled after NASA’s anti-radiation visors, combining visual appeal with scientific accuracy. Similarly, The Wandering Earth (2019) showcases a highly detailed and realistic approach, with modular life-support systems, exoskeletal plating, and color-coded suits designed for different roles, reflecting a deep commitment to functional realism. Other notable designs include Prometheus (2012), which uses spherical transparent helmets with built-in lighting and internal displays, and Netflix’s Lost in Space reboot (2018–2021), where sculpted armor, LED illumination, and fiber-optic panels create a suit that feels like a plausible near-future NASA design. The article also
robotmaterialsenergywearable-technologyspace-suitsfuturistic-designaerospace-engineeringUS creates super metal foam that survives 1.3 million stress cycles
Researchers at North Carolina State University have developed a novel Composite Metal Foam (CMF) that combines lightness with exceptional strength and thermal resistance, making it highly suitable for demanding applications such as automotive engines, jet parts, and nuclear reactor components. CMF is composed of hollow metal spheres (e.g., stainless steel or nickel) embedded within a solid metal matrix, resulting in a material that absorbs crushing forces effectively while providing superior insulation against extreme heat compared to conventional metals. In rigorous testing, the steel-based CMF demonstrated outstanding fatigue resistance, enduring over 1.3 million compression-compression stress cycles at temperatures up to 752°F (400°C) and more than 1.2 million cycles at 1,112°F (600°C) without failure. These results are particularly notable given that the fatigue life of solid stainless steel typically decreases significantly at elevated temperatures. The research highlights CMF’s potential to maintain structural integrity under prolonged high-stress and high-temperature conditions, which is critical for safety-sensitive
materialsmetal-foamcomposite-metal-foamfatigue-resistancehigh-temperature-materialsnuclear-reactor-materialslightweight-strong-materialsMeet the AI tool that thinks like a mechancial engineer
The article introduces the bananaz Design Agent, a pioneering AI tool specifically engineered for mechanical engineers. Unlike generic AI chatbots, this agent comprehends mechanical logic, CAD files, and engineering standards through advanced computer vision and specialized algorithms. It analyzes complex design elements such as 3D geometries, assembly hierarchies, material specifications, tolerance callouts, and company best practices, effectively synthesizing this data to provide a deep understanding of engineering intent. This enables engineers to interact with their designs conversationally, as if consulting a virtual expert with decades of experience, available around the clock. The Design Agent maintains full contextual awareness across entire projects, understanding how individual design decisions impact assemblies, manufacturability, and performance, while leveraging past work and collective company knowledge. It dramatically accelerates tasks that traditionally require hours, such as design-for-manufacturing (DFM) checks, tolerance analysis, and compliance with company standards. Additionally, it can identify opportunities to replace custom parts with standard shelf components,
robotAImechanical-engineeringCADmanufacturingdesign-automationmaterialsTrump’s DOE proposes cutting billions in grants for GM, Ford, and lots of startups
The Department of Energy (DOE) under the Trump administration is proposing to cut billions of dollars in federal funding, including more than $500 million in grants awarded to over a dozen startups, as well as significant grants to major automakers such as Ford, General Motors, Stellantis, Daimler Trucks North America, Harley-Davidson, Mercedes-Benz Vans, and Volvo Technology of America. These grants were awarded under the Bipartisan Infrastructure Law and include contracts aimed at advancing clean energy technologies and domestic manufacturing. The proposed cuts come shortly after the administration announced plans to slash over $7.5 billion in contracts the previous week. Among the notable grants at risk are a $189 million award to Brimstone, a materials startup developing low-carbon Portland cement and alumina production, and a substantial grant to Anovion, which aims to produce synthetic graphite domestically for lithium-ion batteries, a market currently dominated by China. Other affected startups include Li Industries, which received $55.2 million to recycle lithium iron
energymaterialsstartupselectric-vehicleslithium-ion-batteriescement-productioncarbon-reductionStartup Battlefield company ÄIO invented a method to make edible fat from ag waste like sawdust
ÄIO, a startup from Estonia named after the Estonian god of dreams, has developed an innovative process to convert agricultural waste such as sawdust into edible fats suitable for the food and cosmetic industries. This technology offers a sustainable alternative to palm oil, whose production has led to significant environmental damage, including deforestation of rainforests. The company’s founders, including former Tallinn University of Technology professor Lahtvee and scientist Bonturi, engineered a microbe capable of fermenting sugars derived from agricultural waste to produce fats with a profile similar to chicken fat. The process can also be adjusted to create liquid oils, potentially replacing oils like canola or rapeseed. Since its commercial launch in 2022, ÄIO has raised approximately $7 million, won the 2024 Baltic Sustainability Award, and attracted interest from over 100 companies worldwide. The startup is now focused on scaling production with plans to build a commercial facility by 2027 and licensing its technology to food and cosmetic manufacturers.
materialssustainable-materialsbiotechnologymetabolic-engineeringalternative-fatsprecision-fermentationagricultural-waste-valorizationOne startup’s paper-thin stainless steel could change how bridges are built
The article discusses a startup, Allium, that has developed a novel stainless steel-clad rebar designed to significantly improve the durability of concrete bridges by preventing corrosion. Traditional steel rebar embedded in concrete is prone to rust, especially in bridges exposed to water and salt, leading to premature structural failure. While stainless steel rebar resists corrosion, its high cost limits its use to only the most critical bridges. Allium’s innovation involves covering conventional rebar with a thin layer (about 0.2 mm) of stainless steel, which can extend a bridge’s lifespan from 30 to 100 years. This approach aims to offer corrosion resistance comparable to full stainless steel rebar but at a cost similar to or potentially lower than epoxy-coated rebar, the current mid-tier solution. Allium’s stainless-clad rebar has already been used in several bridge deck replacements in the U.S., including projects in Massachusetts, California, and Florida. Unlike epoxy-coated rebar, which requires careful handling,
materialsstainless-steelcorrosion-resistancebridge-constructioninfrastructurerebarconcrete-reinforcementScientists discover clues of ancient moon formation in Apollo 17 samples
Scientists from Brown University have discovered a new type of sulfur isotope in previously unopened Apollo 17 lunar samples, providing fresh insights into the moon’s early formation. These samples, collected in 1972 from the Taurus Littrow region and stored under NASA’s Apollo Next Generation Sample Analysis (ANGSA) program, were analyzed using advanced secondary ion mass spectrometry techniques unavailable at the time of collection. The team found sulfur compounds highly depleted in sulfur-33 (33S), an isotope ratio not observed on Earth, challenging prior assumptions that the lunar mantle’s sulfur isotopic composition mirrored Earth’s. The unexpected sulfur isotope ratios suggest that the moon’s surface retains chemical signatures from its ancient past, potentially linked to the giant impact hypothesis. This theory posits that the moon formed after a Mars-sized body, Theia, collided with the early Earth. The anomalous sulfur isotopes may represent remnants of Theia’s material, offering a unique “fingerprint” of that formative event. These findings open new avenues for
materialslunar-samplessulfur-isotopesApollo-17moon-formationisotope-analysisplanetary-scienceNew sun-powered film purifies highly contaminated water in minutes
Researchers at Sun Yat-sen University in China have developed a novel self-floating photocatalytic film powered by sunlight that can purify highly contaminated water by killing over 99.995% of bacteria within minutes. This film uses a specially engineered conjugated polymer photocatalyst called Cz-AQ, which generates long-lived oxygen-centered organic radicals (OCORs) when exposed to sunlight and water. These radicals not only eliminate bacteria such as E. coli and Staphylococcus aureus but also break down pollutants and inhibit bacterial regrowth for at least five days. The film demonstrated the ability to disinfect 10 liters of contaminated water within 40 minutes under low natural sunlight, outperforming conventional photocatalysts that are ineffective in such conditions. The technology addresses critical limitations of existing water purification methods, such as chlorination—which can produce harmful byproducts—and UV treatment, which requires high energy input. Unlike traditional photocatalysts that rely on short-lived reactive oxygen species, the Cz-AQ-based film maintains
energymaterialsphotocatalysiswater-purificationsustainable-technologysolar-energyantibacterial-filmArtist imagines fungi-made organ to extract microplastics from humans
Designer Odette Dierkx has conceptualized a futuristic fungi-based prosthetic called the "79th Organ," intended to filter and break down microplastics inside the human body. Drawing on research that certain mushrooms, such as Pleurotus ostreatus (oyster mushroom), can digest plastics, this living organ uses fungal mycelium to enzymatically degrade microplastics through bioremediation. The organ would extract microplastics from the bloodstream, breaking them into harmless components, effectively acting as a detox system for pollutants the body cannot naturally process. Dierkx envisions this innovation as a necessary adaptation by 2110, reflecting the growing severity of plastic pollution and its infiltration into human health. The 79th Organ is designed with a domed capsule shape featuring internal gills and attaches to the lower abdomen via suction. It includes a magnifying glass to observe microplastic processing and a contamination dial to alert users to pollution levels. Dierkx has imagined multiple versions tailored to
materialsbioremediationfungimicroplasticsenvironmental-healthprosthetic-organsustainable-materialsMicroplastics linked to gut changes, raise depression and cancer risk
A recent study led by Austria’s Center for Biomarker Research in Medicine (CBmed) has demonstrated that microplastics—plastic particles smaller than 5mm—can alter the human gut microbiome in ways linked to serious health conditions such as depression and colorectal cancer. Using ex vivo gut microbiome cultures derived from stool samples of five healthy volunteers, researchers exposed these cultures to five common types of microplastics at concentrations ranging from typical human exposure to higher doses. While total bacterial counts remained stable, the microplastics caused a drop in pH, indicating altered bacterial metabolism, and induced shifts in the composition of key bacterial families within the gut, particularly those in the Bacillota phylum, which plays a crucial role in digestion and gut health. These bacterial changes corresponded with altered levels of metabolic compounds like valeric acid and lactic acid, suggesting that microplastics may interfere chemically or physically with bacterial processes, possibly by providing new niches through biofilm formation. The observed microbiome alterations
materialsmicroplasticsgut-microbiomehuman-healthenvironmental-impactplastic-pollutionmicrobiologyThe Mystery of How Quasicrystals Form
Quasicrystals, first discovered in 1982 by Dan Shechtman, are exotic materials whose atoms form intricate, nonrepeating patterns such as pentagons and decagons, defying traditional crystallographic rules and intuition. These patterns exhibit “forbidden” symmetries, like fivefold rotational symmetry, which cannot tile space periodically. The concept of such quasiperiodic patterns was mathematically anticipated by Roger Penrose in the 1970s through his Penrose tilings, which cover a plane without gaps or overlaps but never repeat exactly. Shechtman’s discovery of quasicrystals in metal alloys challenged long-held assumptions in materials science and earned him the 2011 Nobel Prize in Chemistry. Recent research, particularly from the University of Michigan, has shed light on the formation and stability of quasicrystals. One study demonstrated that some quasicrystals are thermodynamically stable, meaning their atomic arrangements represent a minimum energy state rather than transient or metast
materialsquasicrystalsatomic-structurethermodynamic-stabilitymaterial-sciencecrystal-engineeringnonrepeating-patternsStartups and the U.S. government: It’s getting complicated
The article discusses the increasingly complex relationship between startups and the U.S. government, particularly as more startups engage with government contracts and regulatory approvals in sectors like AI, automation, space, robotics, and climate technology. This shift reflects a broader change in the startup ecosystem over the past decade, moving beyond consumer internet companies to deep tech and defense-related ventures that depend heavily on government involvement. While government partnerships can provide crucial funding and revenue, they also introduce risks, such as operational disruptions during government shutdowns, which can stall startup progress. Additionally, the article highlights the U.S. government's expanding role in the tech industry through financial interventions and equity stakes. Under the Biden Administration, the Department of Energy’s Loan Programs Office renegotiated deals granting the government ownership interests in companies like Canadian miner Lithium Americas and a Lithium Americas-GM joint venture, acquired via no-cost warrants. This approach follows similar recent federal loans and equity acquisitions with companies such as Intel and MP Materials, indicating a strategic government effort to influence critical
robotenergymaterialslithium-miningdefense-technologygovernment-contractsdeep-tech-startupsPhotos: World's first hollow concrete guitar is surprisingly playable
Rob Scallon and Mike from Modustrial Maker have successfully created the world’s first semi-hollow body concrete guitar, modeled after a Gibson ES335. Unlike earlier concrete guitars that were heavy and solid, this instrument features 3/8-inch thick walls and weighs under 20 pounds, making it surprisingly playable. The build showcased exceptional precision, achieving perfect intonation without any post-build adjustments. The guitar’s body was engineered to prevent cracking by using a self-leveling concrete mix with plasticizers, reinforced with glass fiber scrim, PVA fibers, and embedded wood components. CNC-machined and 3D-printed molds ensured accurate neck alignment, while careful wet sanding preserved the integrity of the thin concrete walls. The construction process was challenging due to the quick curing time of concrete and the material’s properties, requiring meticulous machining and finishing. The project cost about $400, including hardware, electronics, and a Schecter neck. The finished guitar functions well as a musical instrument, with no fret
materialsconcreteguitar3D-printingfabricationengineeringcomposite-materialsGM’s Artemis rover packs EV battery power for 19K miles on the Moon
General Motors (GM) has partnered with Lunar Outpost to develop the Lunar Terrain Vehicle (LTV) for NASA’s Artemis program, marking GM’s return to the Moon after 50 years. Unlike the Apollo-era rover, which had limited range and disposable batteries, the Artemis rover features rechargeable lithium-ion batteries using the same chemistry as GM’s Earth-based electric trucks. The battery pack is integrated into the vehicle’s frame to improve stability in lunar gravity and is designed for a 10-year lifespan, capable of delivering up to 19,000 miles of service. The LTV is built to endure the Moon’s extreme temperature swings, including two-week-long nights that plunge to -334 °F, with integrated heating elements, heavy insulation, and fault-tolerant systems to ensure continuous operation even if some battery cells fail. The LTV is designed as a reliable, long-term utility vehicle to support astronauts by hauling gear, scouting routes, and aiding in the establishment of a permanent human presence on the lunar
robotenergymaterialselectric-vehicleslunar-explorationbattery-technologyautonomous-systemsScientists develop ice that captures methane in just two minutes
Researchers at the National University of Singapore (NUS) have developed an innovative ice-like material, called amino-acid-modified ice, that can capture methane gas 30 times faster and with 30 times greater storage capacity than conventional ice-based methods. This material forms a solid methane hydrate under near-freezing conditions in just over two minutes, compared to hours required by traditional techniques. The breakthrough leverages naturally occurring amino acids, which alter the ice’s surface properties to create tiny liquid layers that facilitate rapid methane hydrate crystal growth, resulting in a porous, sponge-like structure ideal for gas capture. This new method offers a safer, greener, and more efficient alternative to current natural gas storage techniques, which are typically energy-intensive and costly, such as high-pressure containment or liquefied natural gas at −162°C. The amino-acid-modified ice is reusable, biodegradable, and avoids chemical surfactants, making it environmentally friendly. It also allows on-demand methane release through gentle heating, after which the
energymaterialsmethane-storagegas-hydratebiodegradable-icenatural-gas-storageamino-acid-modified-iceThe Effect Of Tariffs On The Auto Industry — It's Not Just EV Manufacturers That Are Hurting - CleanTechnica
The article discusses the widespread negative impact of tariffs imposed by the Trump administration on the global auto industry, affecting not only electric vehicle (EV) manufacturers but the entire automotive supply chain. Tariffs ranging from 7.5% to 25% on automobiles and auto parts have significantly increased production costs, leading to higher vehicle prices for consumers. The complex network of suppliers, many of which are small to midsize companies with slim profit margins, is particularly vulnerable. These suppliers face pressure to adapt by diversifying production, which introduces inefficiencies and longer lead times. Additionally, the shift toward electric vehicles adds uncertainty, as many combustion engine parts may become obsolete, while the administration’s policies favoring internal combustion engines further cloud the industry's future. Internationally, the tariffs are straining relationships with key automotive trading partners such as Japan, Germany, South Korea, China, and Canada. These countries have large automotive parts sectors employing hundreds of thousands of workers, and the tariffs are driving up costs and threatening jobs.
energyelectric-vehiclesautomotive-industrytariffssupply-chainmanufacturingmaterialsConcrete battery turns walls into power banks with 10x energy boost
MIT researchers have developed a groundbreaking electron-conducting carbon concrete (ec3) that can store and release electricity, effectively turning building materials like walls, sidewalks, and bridges into large-scale energy storage systems. This new concrete battery offers a tenfold increase in energy density compared to earlier versions, reducing the volume needed to power a household from 45 cubic meters to about 5 cubic meters—roughly the size of a basement wall. The ec3 material integrates cement, water, ultra-fine carbon black, and electrolytes to form a conductive nanonetwork, enabling efficient energy storage and flow. Key innovations include mixing electrolytes directly into the concrete before casting, which creates thicker, more powerful electrodes, and the use of organic electrolytes that allow a cubic meter of ec3 to store over 2 kilowatt-hours—enough to power a refrigerator for a day. The material’s design was inspired by ancient Roman concrete techniques combined with modern nanoscience, and it has demonstrated multifunctional uses
energymaterialsconcrete-batteryenergy-storagenanomaterialsrenewable-energymultifunctional-concreteWorld’s most sensitive dark matter detector cuts radon by billionfold
The XENON Collaboration, operating one of the world’s most sensitive dark matter detectors at Italy’s Gran Sasso Laboratory, has achieved a major breakthrough by drastically reducing background radioactivity caused by radon gas inside their detector. Using an advanced cryogenic distillation system, the team lowered radon concentrations to about 430 atoms per metric ton of liquid xenon—approximately a billion times less than natural radiation levels found in the human body. This reduction minimizes false signals that could mimic dark matter interactions, pushing the experiment into a sensitivity regime limited only by neutrino background, which cannot be shielded against. The detector contains 8.5 metric tons of liquid xenon cooled to minus 95 degrees Celsius and is located deep underground to shield it from cosmic radiation. Radon, a decay product of ancient elements, has been a persistent source of interference due to its radioactive decay producing light flashes in the detector. The new purification technology represents a significant step toward directly detecting dark matter, which is believed to
materialsdark-matter-detectionradon-reductionliquid-xenoncryogenic-distillationparticle-physicsradiation-shieldingNew kirigami parachute design stabilizes instantly in free fall
Engineers at Polytechnique Montréal have developed a novel parachute design inspired by kirigami, the Japanese art of folding and cutting. This parachute is created by laser-cutting a plastic sheet with a closed-loop kirigami pattern, which transforms the sheet into an inverted bell shape during free fall when weighted at its center. Unlike conventional parachutes, it stabilizes instantly, follows a straight ballistic descent without pitching, and uses a single suspension line, reducing tangling and enabling rapid deployment. The design’s seamless construction and predictable, pin-straight descent were confirmed through simulations, wind tunnel tests, laboratory experiments, and outdoor drone drops. The kirigami parachute’s unique structure allows air to pass through small slits formed by the cuts, preventing turbulent airflow that typically destabilizes traditional canopies. This results in smooth, steady descents that remain consistent across different sizes, making the design scalable for various payloads. The researchers see immediate applications in humanitarian aid deliveries to remote areas,
materialskirigamiparachute-designmechanical-engineeringaerospace-technologyhumanitarian-aidspace-explorationSoil fungus discovered to grow hydrogels for tissue regeneration
Researchers at the University of Utah have discovered that a common soil fungus, Marquandomyces marquandii, can grow hydrogels with significant potential for biomedical applications such as tissue regeneration, cell scaffolding, and flexible medical devices. Unlike many fungi that lose water easily, M. marquandii produces thick, multilayered hydrogels capable of absorbing up to 83% water and recovering 93% of their shape and strength after repeated stress. These hydrogels mimic the softness of human tissue and exhibit unique porosity across layers, making them promising for biocompatible and adaptable medical materials. The discovery was serendipitous, initially arising from research on a fungus thought to contaminate fuel. The fungus’s mycelium, primarily composed of chitin (similar to seashells and insect exoskeletons), forms strong, flexible structures that distribute stress effectively. The research team, including mechanical engineering Ph.D. candidate Atul Agrawal and my
materialshydrogelstissue-regenerationbiomedical-materialsmyceliumbiocompatible-materialsfungal-biomaterialsUS Navy's new system reduces timeline for military quantum discoveries
The US Naval Research Laboratory (NRL) has introduced a new "cluster system" designed to accelerate research into advanced quantum materials by enabling the growth and analysis of materials at the atomic level within a single, contamination-free setup. This integrated system allows researchers to grow materials one atomic layer at a time and immediately study their structure and electronic properties without transferring samples between different facilities, thus improving efficiency and reducing contamination risks. The system incorporates a robotic transfer arm and multiple chambers connected by an ultra-high vacuum interface, facilitating techniques like molecular beam epitaxy, scanning tunneling microscopy, and angle-resolved photoemission spectroscopy to visualize atoms and map electronic band structures. The focus of this research is on quantum materials with unique properties governed by quantum mechanics, such as superconductors and topological insulators, which have promising applications in military and defense technologies including memory storage, sensors, and energy-efficient electronics. By enabling streamlined material growth and characterization, the cluster system is expected to significantly shorten the timeline from fundamental scientific discovery to
materialsquantum-materialsmolecular-beam-epitaxyrobotic-armelectronicssuperconductorstopological-insulatorsScientists use light to clean wastewater with ceramic foam formula
Researchers at Fraunhofer IKTS in Dresden have developed innovative UV-activated ceramic foam materials designed to purify industrial process water and wastewater by breaking down persistent pollutants such as pharmaceuticals, pesticides, industrial chemicals, microplastics, dyes, and PFAS. These multifunctional foam ceramics use photocatalytic oxidation, where UV light exposure generates reactive radicals on the foam’s functionalized surfaces that decompose organic impurities without producing harmful by-products or requiring additional oxidizing agents like ozone. The foam’s highly porous structure (up to 90% open porosity) provides extensive surface area for catalyst coatings and excellent light penetration, enabling efficient pollutant degradation even with thin catalyst layers that are stabilized to prevent washout. Fraunhofer IKTS is actively developing complete wastewater treatment systems incorporating these ceramic foams, optimized reactor designs, and energy-efficient UV LEDs tailored to client needs across industries including pharmaceuticals, semiconductors, paper, dairy, and textiles. By enabling on-site treatment, the technology prevents harmful substances from
materialsenergywastewater-treatmentphotocatalysisceramic-foamUV-lightenvironmental-technologyOpenAI ropes in Samsung, SK Hynix to source memory chips for Stargate
OpenAI has entered into agreements with South Korean memory chip giants Samsung Electronics and SK Hynix to supply DRAM wafers for its Stargate AI infrastructure project and to build AI data centers in South Korea. The deals, formalized through letters of intent following a high-profile meeting involving OpenAI CEO Sam Altman and South Korean leadership, will see Samsung and SK Hynix scale production to deliver up to 900,000 high-bandwidth memory DRAM chips monthly—more than doubling the current industry capacity for such chips. This move is part of OpenAI’s broader strategy to rapidly expand its compute capacity for AI development. These agreements come amid a flurry of recent investments and partnerships aimed at boosting OpenAI’s compute power. Notably, Nvidia committed to providing OpenAI access to over 10 gigawatts of AI training compute, while OpenAI also partnered with SoftBank, Oracle, and SK Telecom to increase its total compute capacity to 7 gigawatts and develop AI data centers
materialsmemory-chipsDRAMAI-infrastructuredata-centersSamsungSK-HynixChina: World's largest centrifuge achieves 300 times Earth’s gravity
China has launched CHIEF1300, the world’s largest centrifuge by capacity, capable of generating up to 300 times Earth’s gravity (300G) on loads up to 22 tons. Located in Hangzhou at Zhejiang University’s Centrifugal Hypergravity and Interdisciplinary Experiment Facility (CHIEF), this advanced research hub aims to simulate extreme environmental conditions such as earthquakes, tsunamis, deep-sea pressures, and geological processes. The facility includes multiple centrifuges and experimental setups, with plans to expand capacity further. By creating hypergravity fields far exceeding typical human experiences (e.g., roller coasters at 2G, astronaut launches at 5G), CHIEF enables accelerated and scaled-down modeling of natural phenomena, compressing timescales—such as simulating a century-long contaminant spread in just a few days. The CHIEF1300 centrifuge operates in a specially designed underground chamber with features like vacuum and cooling systems to ensure stable, safe operation while minimizing
materialscentrifugehypergravityadvanced-material-designgeological-researchdeep-ocean-simulationexperimental-facilityFlash heating extracts rare earths from e-waste with 90% yield
Researchers at Rice University, led by James Tour and Shichen Xu, have developed an ultrafast flash Joule heating (FJH) method combined with chlorine gas to recover rare earth elements (REEs) from discarded magnets with over 90% yield and purity. This innovative technique rapidly heats materials to thousands of degrees within milliseconds, causing non-REE metals like iron and cobalt to chlorinate and vaporize first, leaving behind solid REE oxides. Unlike traditional recycling methods, which are energy-intensive and produce toxic waste, this process requires no water or acids, significantly reducing environmental impact. Life cycle assessments and techno-economic analyses demonstrate that this method cuts energy use by 87%, greenhouse gas emissions by 84%, and operating costs by 54% compared to conventional hydrometallurgical recycling. The rapid and clean recovery process enables the potential deployment of localized recycling units near e-waste collection points, minimizing shipping costs and environmental footprint. Rice University has licensed the technology to Flash Metals USA
energymaterialsrare-earth-elementsrecyclingflash-Joule-heatingsustainable-processingelectronic-wasteChina bets on car-style rocket production to surpass SpaceX’s pace
China is revolutionizing its aerospace manufacturing by adopting a car-style mass production approach, known as the “final assembly pull” system, to compete with the US and SpaceX’s rapid launch pace. Inspired by lean manufacturing principles pioneered by Toyota, this system shifts from the traditional “push” production—where components are made based on forecasted demand—to a “pull” approach where parts are produced and assembled only as needed. This reduces waste, inventory bottlenecks, and delays, enabling faster and more cost-effective production of rockets and satellites while maintaining quality. The transformation involves a coordinated national strategy integrating state-owned enterprises, research institutes, and private suppliers, supported by AI, robotics, and a collaborative digital platform that provides real-time supply chain visibility. This modular and flexible manufacturing model allows China to dynamically reconfigure workflows and streamline production. With plans to deploy satellite mega-constellations such as Guowang, Qianfan, and Hongtu-3, China aims to significantly boost its orbital launch
materialsmanufacturingaerospacelean-manufacturingsatellite-productionrocket-productionindustrial-automationMicroplastics Could Be Weakening Your Bones, Research Suggests
Recent research published in Osteoporosis International suggests that microplastics may contribute to the rising global incidence of osteoporosis by disrupting bone health. The study reviewed 62 scientific articles involving laboratory and animal experiments, finding that microplastics interfere with bone marrow stem cells responsible for maintaining and repairing bone tissue. Specifically, microplastics stimulate osteoclast formation—cells that break down bone—while reducing cell viability, inducing premature aging, altering gene expression, and triggering inflammation. This imbalance accelerates bone degradation, weakening bone structure and increasing fracture risk. Animal studies further indicated that microplastic accumulation lowers white blood cell counts, signaling impaired bone marrow function, and leads to deterioration of bone microstructure and abnormal cell formations. These effects were severe enough to interrupt skeletal growth in animals. The research team, led by Rodrigo Bueno de Oliveira at the State University of Campinas in Brazil, is now conducting further studies on rodents to better establish the link between microplastic exposure and bone deterioration. They aim to clarify microplastics as a
materialsmicroplasticsbone-healthosteoporosisnanoplasticscellular-agingbone-marrow-cellsIn a first, scientists observe short-range order in semiconductors
Scientists from Lawrence Berkeley National Laboratory and George Washington University have, for the first time, directly observed short-range atomic order (SRO) in semiconductors, revealing hidden patterns in the arrangement of atoms like germanium, tin, and silicon inside microchips. This breakthrough was achieved by combining advanced 4D scanning transmission electron microscopy (4D-STEM) enhanced with energy filtering to improve contrast, and machine learning techniques including neural networks and large-scale atomic simulations. These methods allowed the team to detect and identify recurring atomic motifs that were previously undetectable due to weak signals and the complexity of atomic arrangements. The discovery of SRO is significant because it directly influences the band gap of semiconductors, a critical property that governs their electronic behavior. Understanding and controlling these atomic-scale patterns could enable the design of materials with tailored electronic properties, potentially revolutionizing technologies such as quantum computing, neuromorphic devices, and advanced optical sensors. While this research opens new avenues for atomic-scale material engineering, challenges
materialssemiconductorsatomic-ordermicroscopyAImachine-learningelectronic-propertiesNew device gives LIGO 10x boost to spot distant gravitational waves
Researchers have developed a new device called FROSTI (FROnt Surface Type Irradiator) that significantly enhances the sensitivity of LIGO, the Laser Interferometer Gravitational-Wave Observatory, by correcting laser-induced distortions on its mirrors. Gravitational waves, which are faint ripples in spacetime caused by cosmic events like black hole mergers, require extremely sensitive detection methods. Increasing laser power improves detection range but causes slight heating and warping of LIGO’s mirrors, which diminishes signal clarity. FROSTI addresses this by projecting controlled heat patterns onto the mirror surfaces to counteract these distortions without adding noise, enabling LIGO to operate effectively at much higher laser powers. This innovation allows gravitational-wave observatories to detect signals from much farther away, potentially increasing the observable volume of the universe by about ten times. This boost could enable astronomers to observe millions of black hole and neutron star mergers and other cosmic phenomena currently beyond detection. The FROSTI system
materialslaser-technologygravitational-wavesopticsthermal-controlscientific-instrumentsLIGOKorean researchers create bone-healing gun, offers faster treatment
Korean researchers at Sungkyunkwan University have developed a handheld “bone-healing gun,” a 3D-printing device that extrudes biodegradable polymer scaffolds directly onto fractured bones to accelerate healing. Unlike traditional metal grafts and titanium implants, which are costly and difficult to customize, this device uses a biocompatible filament made from a blend of polycaprolactone and hydroxyapatite. This material melts at a safe 60 °C, allowing it to bond securely to bone tissue without damaging surrounding areas, while providing strength comparable to natural bone and gradually degrading as new bone grows. Early animal trials on rabbits with femur fractures showed that the bone-healing gun significantly sped up recovery compared to standard bone cement. However, the slow degradation rate of the scaffold material limited full fracture restoration, indicating the need for further improvements before human trials. The researchers aim to enhance the material’s biodegradation speed and incorporate antibiotics to release infection-fighting drugs during healing. Additional challenges include ensuring
materialsbiodegradable-polymers3D-printingbone-healingbiomedical-engineeringmedical-devicespolymer-scaffoldsUS scientists' light-emitting material could revolutionize photonics
Researchers at UCLA’s California NanoSystems Institute have developed a novel light-emitting material by combining molybdenum disulfide (MoS₂), a two-dimensional semiconductor, with Nafion, a flexible polymer commonly used in fuel cells. This hybrid material overcomes the traditional limitations of MoS₂, which is typically fragile and emits weak light, by leveraging Nafion’s flexibility and chemical stability to reinforce the semiconductor and heal surface defects that usually reduce light output. The resulting membranes are stretchable, durable, and produce significantly brighter and more stable light emission than MoS₂ alone. This breakthrough holds significant promise for photonics, the field of technology that uses light (photons) instead of electricity (electrons) for computing and communication. The new material’s durability, flexibility, and efficiency could enable the development of stretchable displays, flexible lasers, and chip-integrated light sources. In the longer term, it may revolutionize photonic computing by enabling faster, more energy-efficient light-based circuits
materialsphotonicsmolybdenum-disulfide2D-materialsNafionlight-emitting-materialsflexible-electronicsPhotos: New airless steel wheel can transform mining trucks' operations
Global Air Cylinder Wheels (GACW), based in Phoenix, Arizona, is preparing to commercialize an innovative airless steel wheel designed to replace traditional rubber tires on heavy mining vehicles such as haul trucks, excavators, and bulldozers. Developed over nearly a decade, the patented Air Suspension Wheel (ASW) features a mechanical steel construction with in-wheel pneumatic suspension using nitrogen-filled air cylinders. This design aims to significantly extend durability—lasting the typical 10 to 15-year lifespan of mining vehicles—while eliminating common issues with rubber tires, including frequent wear, explosions, and overheating. The ASW also incorporates replaceable treads, enhancing maintainability and reducing downtime compared to the hours-long process required for traditional tire replacement. The ASW addresses both economic and environmental challenges faced by the mining industry. Rubber tires in harsh mining conditions often need replacement every six to nine months, costing up to $7 million per truck over its lifetime and contributing to substantial operational expenses. GACW estimates that
materialsmining-technologysteel-wheelsairless-tiressustainable-materialsheavy-machinerytire-innovationLQMs vs. LLMs: when AI stops talking and starts calculating
The article discusses the emerging role of Large Quantitative Models (LQMs) as a new class of AI systems that differ fundamentally from Large Language Models (LLMs). Unlike LLMs, which are trained on internet text to generate language-based outputs, LQMs are purpose-built to work with numerical, scientific, and physical data, enabling them to simulate complex real-world systems in fields like chemistry, biology, and physics. Fernando Dominguez, Head of Strategic Partnerships at SandboxAQ—a company at the forefront of AI and quantum technology integration—explains that LQMs can generate novel data not available in existing datasets, such as simulating trillions of molecular interactions. This capability allows LQMs to accelerate drug discovery, financial modeling, and navigation, offering a more quantitative and practical approach to AI-driven innovation. A key example highlighted is SandboxAQ’s collaboration with UCSF’s Institute for Neurodegenerative Diseases, where LQMs enabled the simulation of over 5 million molecular compounds in
materialsAIquantum-computingdrug-discoverysimulationpharmaceuticalscybersecurityAtom-thin magnetic crystal makes memory chips 10x more efficient
Researchers at Chalmers University of Technology in Sweden have developed an atomically thin, two-dimensional magnetic material that significantly improves the energy efficiency of memory chips, reducing power consumption by a factor of ten. This novel material uniquely combines two opposing magnetic states—ferromagnetism and antiferromagnetism—within a single crystal structure, a feat previously only achievable by stacking multiple layers of different materials. The coexistence of these magnetic orders in one ultra-thin layer allows for rapid and easy switching of electron spin directions without requiring external magnetic fields, which are typically energy-intensive. The material, composed of a magnetic alloy of cobalt, iron, germanium, and tellurium, leverages van der Waals forces for stacking, enhancing stability and simplifying manufacturing by avoiding interface issues common in multilayer systems. This breakthrough addresses the growing global challenge of energy consumption by digital memory, projected to reach nearly 30% of global energy use in coming decades. The discovery promises to enable ultra-efficient memory chips for
materialsenergy-efficient-memory2D-magnetic-materialsmagnetismmemory-chipsenergy-consumption-reductionquantum-device-physicsThe Trump administration is going after semiconductor imports
The Trump administration is reportedly considering a new policy aimed at boosting U.S. semiconductor production by enforcing a 1:1 manufacturing ratio. Under this approach, domestic semiconductor companies would be required to produce as many chips in the U.S. as their customers import from overseas manufacturers. Companies failing to meet this ratio could face tariffs, although the timeline for achieving this target remains unclear. This move is part of President Donald Trump’s broader efforts, initiated in August, to impose tariffs on the semiconductor industry and encourage reshoring of chip manufacturing. While the ratio-based policy could eventually increase domestic chip production, it poses significant challenges in the short term. Semiconductor manufacturing plants are complex and costly to build, with long lead times before becoming operational. For example, Intel’s Ohio plant, initially expected to open in 2025, has been delayed until 2030. Meanwhile, Taiwan Semiconductor Manufacturing Company (TSMC) has announced plans to support chip production infrastructure in the U.S., but details remain sparse. The proposed
materialssemiconductor-manufacturingchip-productiontariffssupply-chaintechnology-policyUS-manufacturingThe Trump admin is going after semiconductor imports
The Trump administration is reportedly considering a new policy aimed at boosting U.S. semiconductor production by enforcing a 1:1 manufacturing ratio. Under this approach, U.S. semiconductor companies would be required to produce domestically the same number of chips as their customers import from overseas. Companies failing to meet this ratio could face tariffs, although the timeline for achieving this target remains unclear. This move follows President Trump's discussions since August about imposing tariffs on the semiconductor industry to encourage reshoring of chip manufacturing. While the ratio-based policy could eventually increase domestic semiconductor output, it poses risks to the U.S. chip industry in the short term, as manufacturing capacity is currently insufficient to meet demand. Building new semiconductor fabrication plants is a complex and lengthy process, exemplified by Intel’s Ohio plant, which has been delayed multiple times and now aims to open in 2030. Meanwhile, Taiwan Semiconductor Manufacturing Company (TSMC) has announced plans to support U.S. chip production infrastructure, though details are sparse. Overall,
materialssemiconductorchip-manufacturingtariffssupply-chainUS-manufacturingtechnology-policyWorld War II weapons dump site turns into surprising refuge for sea creatures
A recent study has revealed that World War II weapons dumped in the Baltic Sea, particularly V-1 flying bomb warheads, have unexpectedly become thriving habitats for marine life. Using an underwater submersible, researchers discovered dense communities of crabs, worms, anemones, starfish, and fish living on these war relics, with about 43,000 organisms per square meter on the warheads compared to only 8,200 per square meter in the surrounding seabed. Despite the presence of toxic explosives like TNT and RDX, marine species appear to tolerate these compounds, likely because they colonize the metal casings rather than the explosive material itself. The hard surfaces provided by the warheads offer rare attachment points in the Baltic Sea, where natural hard substrates are scarce due to historical removal of stones and boulders. The site’s relative isolation from human activity, caused by chemical contamination, has created a protective environment for these benthic communities, effectively turning a toxic weapons dump into a
materialsmarine-biologyenvironmental-sciencetoxicologyunderwater-ecologyhabitat-restorationmetal-substrates9 strongest materials that help push the limits of engineering
The article highlights nine of the strongest materials that have significantly advanced engineering and industrial applications due to their exceptional hardness, strength, and durability. It explains key measures of material strength, including tensile strength, compressive strength, yield strength, and impact strength, emphasizing that hardness alone does not equate to toughness. These materials range from natural elements to engineered alloys, each playing a crucial role in various demanding environments. Among the materials discussed, boron stands out with a Mohs hardness of 9.5, notable for its brittleness but valuable in glassmaking, nuclear applications, and ceramics. Tungsten carbide, with a hardness between 9.0 and 9.5, is a man-made compound essential for cutting tools, mining equipment, and wear-resistant coatings, prized for its toughness and near-diamond hardness. Chromium, the hardest pure metal at 8.5 on the Mohs scale, is primarily used to enhance corrosion resistance in stainless steel and for decorative chrome plating. Tungsten itself
materialsengineeringhardnesstungsten-carbideboronalloysindustrial-applicationsCat qubits stay stable for over an hour in quantum computing record
French quantum computing startup Alice & Bob has set a new record in qubit stability by demonstrating that their Galvanic Cat qubits can resist bit-flip errors for over an hour, a significant improvement from the previous record of 430 seconds (about seven minutes) achieved in 2024. Bit-flip errors are one of the main challenges in quantum computing, and extending the bit-flip lifetime to this extent marks a crucial step toward practical fault-tolerant quantum machines. The breakthrough was realized through a combination of software optimizations, experimental techniques, and advanced engineering on their latest qubit design, which also powers their 12-qubit Helium 2 chip. This advancement not only surpasses typical cosmic ray impact timescales, suggesting enhanced qubit robustness, but also enables more efficient error-correcting codes that could reduce the hardware requirements for large-scale quantum computers by up to 200 times. Alice & Bob reported bit-flip times between 33 and 60 minutes at a
materialsquantum-computingqubitscat-qubitsfault-tolerant-computingquantum-error-correctionsuperconducting-qubitsArgonne studies 3D-printed steels for next-gen nuclear reactors
Researchers at the US Department of Energy’s Argonne National Laboratory have conducted studies on 3D-printed stainless steels to support the development of next-generation nuclear reactor components. Using laser powder bed fusion (LPBF), an additive manufacturing technique, they produced samples of two key alloys: 316H, a conventional stainless steel used in reactors, and Alloy 709 (A709), a newer alloy designed for advanced nuclear applications. The LPBF process creates unique microstructural features due to rapid heating and cooling, including numerous dislocations that can both strengthen the steel and increase its susceptibility to fracture. Heat treatments are applied to relieve stress by allowing atomic rearrangement, but some dislocations may be retained to enhance performance. The studies revealed significant differences between 3D-printed and conventionally wrought steels, particularly in how the printed materials respond to heat treatments. For 316H, experiments using advanced microscopy and in situ X-ray diffraction showed that nano oxides—common defects in 3D-printed
materials3D-printingadditive-manufacturingstainless-steelnuclear-reactorsheat-treatmentlaser-powder-bed-fusionBite-resistant wetsuit could help surfers survive shark encounters
An Australian study led by Flinders University researchers has demonstrated that bite-resistant wetsuit materials can significantly reduce the severity of shark bite injuries, particularly from white and tiger sharks—two species responsible for many unprovoked and fatal attacks. The research tested four advanced materials—Aqua Armour, Shark Stop, ActionTX-S, and Brewster—made from ultra-high molecular weight polyethylene, a strong yet flexible fiber. These materials were evaluated using foam-padded “bite packages” exposed to real shark bites in South Australia and Queensland. The results showed that all tested materials effectively prevented shark teeth from puncturing through the fabric, reducing substantial and critical damage compared to standard neoprene wetsuits. While these bite-resistant wetsuits do not eliminate all risks, such as internal injuries, they can reduce blood loss and trauma from severe lacerations and punctures, potentially saving lives. This innovation addresses the limitations of existing protective gear like chainmail suits, which are heavy and inflexible for typical water sports. The study
materialsbite-resistant-wetsuitultra-high-molecular-weight-polyethyleneshark-protectionflexible-protective-gearmarine-safetywetsuit-technologyRoom-temperature method makes alloys without high furnace heat
Scientists at Lawrence Berkeley National Laboratory have developed a novel room-temperature method to create high-entropy alloys (HEAs) without the need for traditional high-heat furnaces. Unlike conventional alloy production, which requires heating metals to extreme temperatures to achieve atomic disorder, the team used liquid gallium at mild temperatures (25–80°C) to rapidly form HEAs. By dissolving metal salts in water and reacting them with molten gallium, metals shed chlorine atoms and merge into stable, durable HEAs almost instantly. This breakthrough was inspired by real-time atomic-scale observations using liquid-cell transmission electron microscopy, which revealed unexpected bonding behaviors and rapid transitions from amorphous liquid metal to crystalline structures. The new process allows for scalable production of HEAs with customizable strength and crystal structures, holding significant promise for various industrial applications. Potential uses include efficient catalysts for batteries and fuel cells, aerospace components requiring high strength and resilience, and mineral recovery from wastewater in mining and geothermal operations. The team is also collaborating with UC Berkeley
materialshigh-entropy-alloysliquid-galliumroom-temperature-synthesismetal-alloysbattery-materialscatalysis-materialsRetro sci-fi synth blends ferrofluid movement to every musical note
Swedish designer Love Hultén has created the Extraterrestrial Guitar Thing, a unique, custom-built synthesizer that merges retro sci-fi aesthetics with innovative musical technology. This one-of-a-kind instrument features a bright yellow, angular chassis reminiscent of 1970s sci-fi props, emphasizing its identity as both a musical device and a visual art piece. Instead of traditional strings or keys, it uses knobs, switches, and a touch-sensitive neck with metallic points to trigger notes, allowing for both monophonic and polyphonic play. A steel rod controller adds expressive pitch and modulation control, enhancing performance versatility. A standout feature is the integrated ferrofluid display housed in a circular window on the body, which dynamically reacts to audio signals by forming shifting, organic patterns that visually represent the music in real time. Powered by a modified Arturia Microfreak synthesizer engine, the instrument is fully self-contained with built-in speakers and battery power, enabling portability and immediate playability. Commissioned for a private
materialsferrofluidsynthesizerelectronic-engineeringretro-futuristic-designkinetic-displaysound-visualizationHelium-3 mining on Moon: A new frontier for science and geopolitics
The article discusses the emerging interest in mining helium-3 from the Moon, highlighting its scientific, technological, and geopolitical significance. Helium-3, a rare, non-radioactive isotope embedded in the lunar regolith by billions of years of solar wind, holds promise for multiple advanced applications. It is crucial for cooling quantum computers to near absolute zero, enhancing medical imaging and security scanners, and potentially serving as a clean fusion fuel that produces minimal radioactive waste. These diverse uses make helium-3 a highly strategic resource, sparking a competitive race among nations, notably the United States, China, and Russia, with the European Union, India, and others also entering the fray. The Moon’s helium-3 reserves are estimated to be vast—possibly around a million metric tons—though dispersed at very low concentrations, requiring processing of large amounts of lunar soil. Earth’s supply is limited and insufficient to meet the anticipated demand from scaling quantum technologies and other uses. While helium-3 fusion remains theoretical and
energymaterialslunar-mininghelium-3fusion-fuelquantum-computingspace-explorationFrom trash to tech: Plastic bags now help monitor drinking water safety
Researchers in Indonesia, led by Dr. Indriana Kartini from Universitas Gadjah Mada, have developed an innovative method to upcycle discarded polyethylene plastic bags into carbon quantum dots (CQDs)—tiny, glowing nanomaterials capable of detecting toxic metals in drinking water. This breakthrough addresses two major global challenges simultaneously: plastic pollution and water safety. Unlike traditional recycling, their process uses modified pyrolysis and hydrothermal treatment with a small amount of hydrogen peroxide to convert plastic waste into CQDs within 10 hours. These CQDs exhibit strong fluorescence, stability under various conditions, and a high sensitivity for detecting iron ions (Fe³⁺) in water, with a detection limit as low as 9.50 micromoles and excellent measurement accuracy (R² = 0.9983). The plastic-derived CQDs’ ability to selectively bind iron ions makes them promising, affordable, and portable sensors for monitoring water quality, especially in areas lacking advanced laboratory facilities. This innovation exemplifies a circular
materialsnanomaterialsplastic-wastecarbon-quantum-dotswater-safetypollution-detectionsustainability14-ingredient meal cooked by lasers sets new record in 3D-printed food
A research team led by Jonathan David Blutinger, PhD, has achieved a significant breakthrough in 3D-printed food by creating a 14-ingredient, three-course meal using multi-wavelength laser cooking. This novel technique employs multiple laser wavelengths to precisely control the texture of printed foods during the printing process, addressing one of the biggest challenges in 3D food printing—replicating the texture of traditionally cooked meals. Unlike conventional ovens or stovetops that apply heat unevenly, lasers deliver targeted energy bursts at shallow depths, enabling fine-tuning of elasticity, firmness, and chewiness across different layers of the food. The team tested blue, near-infrared, and mid-infrared lasers on Graham cracker dough and found that laser cooking could achieve peak elasticity at mid-strain levels, surpassing the texture quality of oven-baked samples. By modulating laser exposure frequency, they engineered the internal structure of the dough with precision. This advancement allowed them to produce the most complex
materials3D-printinglaser-cookingfood-technologymulti-wavelength-lasertexture-engineeringadditive-manufacturingEngineering the impossible: Conquering the frontier of power tool design
The article highlights the groundbreaking engineering achievements of Nemo Power Tools, a company that revolutionized power tool design by creating professional-grade tools capable of operating underwater at depths up to 50 meters (164 feet). Initiated by a 2010 military request, mechanical engineer Nimo Rotem developed a patented pressurization technology that actively balances internal air pressure with external water pressure, enabling tools to function reliably where traditional waterproofing fails. These tools feature robust die-cast aluminum bodies, rotating seals inspired by boat drive shafts, and dual 18-volt lithium-ion batteries designed to withstand the mechanical stresses and thermal challenges of underwater use. Nemo Power Tools’ rigorous testing protocols ensure 100% sealing integrity and durability, earning trust across military, marine construction, and commercial sectors. Their product line now includes underwater drills, rotary hammers, angle grinders, reciprocating saws, impact drivers, hull cleaners, and high-lumen floodlights. The tools’ reliability was publicly demonstrated on Discovery Channel’s Gold Rush
energymaterialsengineeringunderwater-technologypower-toolslithium-ion-batteriespressure-resistant-designUS chases tough material for detonation engines that eat shockwaves
The US National Science Foundation (NSF) has awarded a $2 million grant to a Lehigh University-led team to develop resilient materials for rotating detonation engines (RDEs), a new propulsion technology that promises higher power, improved fuel efficiency, and lower emissions compared to conventional rocket and jet engines. RDEs generate thrust by sustaining a supersonic detonation wave inside a ring-shaped chamber, releasing significantly more energy than traditional combustion methods. This could enable more compact, efficient engines capable of delivering satellites to precise orbits at lower cost and fuel consumption. A major challenge preventing RDEs from advancing beyond laboratory prototypes is the extreme temperatures and pressures generated by the detonation wave, which rapidly degrade existing engine materials. Current metal components fail after only a few engine cycles under these punishing conditions. The Lehigh-led team, collaborating with Carnegie Mellon University, University of California Irvine, the Air Force Research Laboratory, and industry partners, aims to overcome this by developing high-performance copper-based alloys.
materialsrotating-detonation-enginepropulsionaerospace-engineeringadvanced-alloysshockwave-technologyenergy-efficiency3D printable bio-glass scaffold shows promise as bone replacement
Researchers in China have developed a novel 3D printable bio-active glass scaffold that shows promise as a bone replacement material. Unlike traditional glass, which is brittle and difficult to shape safely for medical use, this new bio-glass combines silica particles with calcium and phosphate ions to form a printable gel. This gel can be hardened at a relatively low temperature (1,300°F), avoiding the toxic plasticizers and extreme heat (above 2,000°F) typically required in glass 3D printing. In animal tests involving rabbit skull repair, the bio-glass scaffold supported sustained bone cell growth over eight weeks, outperforming plain silica glass and nearly matching a leading commercial dental bone substitute in durability. The key innovation lies in the “green” inorganic 3D printing strategy, which uses self-healing colloidal gels made from silica-based nanospheres that attract each other electrostatically. This method eliminates the need for organic additives, reduces costs, preserves bioactivity, and enhances printability and shape
materials3D-printingbio-glassbone-replacementbiomedical-engineeringnanomaterialsadditive-manufacturingNew 2D magnetic transistor delivers 10x stronger current switching
MIT engineers have developed a novel magnetic transistor using a two-dimensional magnetic semiconductor, chromium sulfur bromide, which enables current switching that is ten times stronger than existing magnetic transistor designs. This device operates with significantly lower energy compared to traditional silicon transistors, overcoming silicon’s voltage limitations that hinder further efficiency improvements. The magnetic semiconductor’s stable structure allows precise switching between two magnetic states, altering its electronic behavior and enabling low-energy operation. The team’s innovative fabrication method, which avoids solvents or glue by directly transferring the thin magnetic film onto a silicon substrate with tape, results in a clean interface that enhances device performance. Beyond stronger and more energy-efficient switching, the new transistor uniquely integrates logic and memory functions, allowing it to store information directly rather than relying on separate magnetic memory cells. This built-in memory capability, combined with faster and more reliable readouts due to the stronger signal, represents a significant advancement for spintronic devices. The researchers demonstrated control of the magnetic state both via external magnetic fields and electrical currents,
materialsspintronicsmagnetic-transistor2D-materialssemiconductor-physicslow-energy-electronicsmemory-devicesWater’s premelting state observed, blurring ice and liquid behavior
A research team from Tokyo University of Science has directly observed a novel “premelting” phase of water confined within nanoscale pores, using advanced nuclear magnetic resonance (NMR) spectroscopy. In this state, water molecules are simultaneously frozen in place yet rotate like a liquid, blurring the traditional distinction between solid and liquid phases. By studying heavy water (D₂O) inside 1.6-nanometer-wide channels of hexagonal rod-like crystals, the researchers identified a three-layered molecular structure where incompletely hydrogen-bonded water begins melting before the fully frozen ice structure melts, confirming the coexistence of solid-like and liquid-like behaviors during the premelting phase. This discovery provides new insights into the structural and dynamic properties of confined water, which behaves differently from bulk ice and liquid water. The premelting state features water molecules locked in solid positions but rotating at speeds comparable to liquid water, highlighting unique molecular mobility under confinement. Beyond advancing fundamental understanding, these findings have potential applications in developing novel
materialsnanomaterialswater-premeltinghydrogen-bondingconfined-waternanofluidicsphase-transitionSwiss startup turns NASA-inspired Mars tech into jet crack detector
Mondaic, a Swiss startup spun off from ETH Zurich, has adapted wave physics software originally developed to study Mars’s interior for use in monitoring infrastructure safety on Earth. Founded in 2018 by Christian Boehm and colleagues, the company repurposed modeling tools from NASA’s InSight Mars mission to non-invasively detect hidden structural flaws such as cracks, voids, and water infiltration in bridges, pipelines, and aircraft parts. Their technology works by sending waves through solid objects and comparing the wave behavior to a precise digital twin model, enabling identification and localization of damage without drilling or cutting. Transitioning from a research tool to a practical product required making the software stable, user-friendly, and fully automated. Leveraging cloud computing, Mondaic’s platform now performs complex wave analyses rapidly and is accessible to infrastructure teams without specialized wave physics knowledge. The system is currently employed in collaboration with the Swiss Federal Roads Office to inspect bridges, detecting early signs of damage to enable timely maintenance. Beyond
materialsinfrastructure-monitoringwave-physicsdigital-twinnon-destructive-testingcloud-computingstructural-health-monitoringFerrari gets full Mansory makeover in eye-catching purple Equestre
Luxury car tuner Mansory has unveiled the Ferrari 12Cilindri Equestre, a fully transformed version of the Ferrari 12 Cilindri available in both coupe and spider variants. Debuting at the Monaco Yacht Show 2025, the Equestre features extensive use of dyed-through forged carbon fiber for nearly all visible body parts, including the front apron, hood, wheel arches, side sills, and rear apron. This not only enhances the car’s lightweight structure but also gives it a distinctive and aggressive appearance highlighted by a painted Italian flag stripe running across the body. Aerodynamic improvements include larger front air intakes, side flaps to boost downforce, and extended fenders, while the original Gran Turismo roofline is retained without a spoiler. Inside, Mansory offers bespoke customization with a launch model showcasing a grey Alcantara interior accented by purple highlights, carbon fiber trims, and LED lighting featuring the Mansory logo. The steering wheel combines carbon fiber and leather with integrated shift
materialscarbon-fiberforged-aluminumlightweight-wheelsautomotive-materialssports-car-materialscarbon-fiber-componentsDiamonds reveal first natural evidence of deep mantle metal alloys
Two diamonds from the Voorspoed mine in South Africa have provided the first direct natural evidence of nickel-iron metallic alloys and nickel-rich carbonates existing deep within Earth’s mantle, at depths between 280 and 470 kilometers. Researchers from Hebrew University of Jerusalem analyzed tiny nano- and micro-inclusions trapped inside these diamonds, which act as “time capsules” preserving chemical reactions and mantle conditions that would otherwise be lost. This discovery confirms long-standing geological models predicting the formation of nickel-rich metal alloys at these depths and reveals a rare coexistence of nickel-iron alloy and nickel-rich carbonate minerals, which typically would react and not coexist. The study explains this coexistence through a metasomatic redox-freezing reaction, where an oxidized, carbon-rich melt infiltrates a reduced, metal-bearing mantle rock, producing nickel-rich carbonates and oxidizing the surrounding mantle. This process also supports the theory that natural diamonds can form from reactions between carbonate fluids and reduced metals deep in the mantle, particularly as
materialsearth-sciencegeologydiamond-inclusionsmantle-chemistrynickel-iron-alloysmineralogyEngineers grow edible plastic from useless junk using yeast-like fungus
Biophelion, a German biotech startup spun off from the Leibniz Institute for Natural Product Research and Infection Biology, has developed an innovative biotechnological process that uses a black yeast-like fungus to convert carbon-rich industrial waste into valuable, recyclable materials. This fungus, notable for thriving in extreme and toxic environments, metabolizes waste streams from industries such as bioethanol production, sugar processing, and paper manufacturing, transforming embedded carbon into useful compounds rather than allowing it to escape as CO2. The startup’s approach aims to decarbonize the chemical industry—a significant global CO2 emitter—by producing bio-based polyester for packaging, the edible polymer pullulan used in food, and a novel biodegradable surfactant still under research. Biophelion is exploring novel applications for these materials, including using pullulan as a sustainable 3D printing material to potentially replace petroleum-based plastics in additive manufacturing. Long-term visions include producing 3D-printed bioreactors from pullulan that could
materialssustainable-materialsbioplasticsfungal-bioprocessingindustrial-waste-recyclingbiodegradable-polymerscircular-economyAussie engineers turn cardboard waste into strong building material
Australian engineers at the Royal Melbourne Institute of Technology (RMIT) have developed a sustainable building material called cardboard-confined rammed earth, which combines cardboard, water, and soil to create strong walls suitable for low-rise buildings. This innovation addresses two major issues: reducing cardboard waste—over 2.2 million tons of which end up in Australian landfills annually—and cutting carbon emissions associated with cement and concrete production, which contribute about 8% of global emissions. The new material has roughly one-quarter of concrete’s carbon footprint and costs less than one-third as much, eliminating the need for cement by using compacted soil confined within cardboard tubes. Inspired by traditional rammed earth construction and designs like Shigeru Ban’s Cardboard Cathedral, the RMIT team has created a formula to determine the material’s strength based on cardboard tube thickness. The material can be produced on-site by compacting soil and water inside cardboard formwork, reducing transportation costs and logistical complexity by relying mostly on locally sourced materials.
materialssustainable-building-materialscardboard-waste-recyclingrammed-earth-constructioncarbon-footprint-reductiongreen-constructioneco-friendly-materialsNovel polymer material can bring quantum devices out of cryogenic labs
Researchers from Georgia Institute of Technology and the University of Alabama have developed a novel conjugated polymer capable of sustaining quantum states at room temperature, potentially revolutionizing quantum device technology by eliminating the need for ultra-cold environments. Unlike traditional quantum materials that rely on rigid crystals like diamond or silicon carbide and require cryogenic cooling, this new polymer uses a carefully designed molecular chain composed of alternating donor and acceptor units—specifically dithienosilole and thiadiazoloquinoxaline. Incorporating a silicon atom into the donor unit induces a twist in the polymer chain, preventing tight stacking that would otherwise disrupt quantum coherence. Additionally, long hydrocarbon side chains improve solubility and maintain electronic coherence, enabling stable electron spin behavior essential for quantum applications. The team confirmed their design through theoretical modeling and experimental techniques. Simulations showed that as the polymer chain lengthened, it achieved a high-spin ground state with two unpaired electrons aligned, analogous to states used in solid-state qubits. Magnetometry and
materialspolymerquantum-devicesroom-temperature-quantum-coherenceconjugated-polymerquantum-statesquantum-materials4th-century pinhole idea inspires lens-free infrared imaging system
Researchers in China have developed a novel lens-free imaging system inspired by the ancient 4th-century pinhole camera concept, enabling sharp mid-infrared imaging without distortion over long distances and in low light. Instead of a physical pinhole, the team created an “optical pinhole” inside a nonlinear crystal using laser light, which converts incoming mid-infrared images into visible ones detectable by standard silicon cameras. This approach overcomes common issues in mid-infrared imaging, such as noise, expense, cooling requirements, and lens-induced distortion or limited depth of field. The system achieves a wide field of view and a large depth of field (over 35 centimeters) with high sensitivity, producing clear images at a mid-infrared wavelength of 3.07 micrometers. Using ultrashort synchronized laser pulses, the researchers also demonstrated 3D time-of-flight imaging with micron-level precision and effective denoising at extremely low photon counts. The method’s simplicity, reliance on standard
materialsinfrared-imagingnonlinear-crystallens-free-imagingmid-infrared-technologylaser-imagingoptical-pinholeFungi-based insulation boards tested in Germany absorb CO2, block mold
Researchers at Hof University of Applied Sciences in Germany have developed innovative insulation boards made from fungal mycelium, offering a sustainable and compostable alternative to conventional synthetic materials. The project, called Mycobuild, aims to scale production from lab to industrial levels by 2026. These fungi-based boards are grown on substrates made from locally sourced plant residues like dry straw, where fungal networks bind the material into solid panels. Unlike traditional insulation, these boards absorb CO2, resist mold formation, and require less energy to produce, making them environmentally friendly and carbon-storing. One of the main challenges addressed by the team involves controlling fungal growth to prevent contamination and mold, achieved through sterile conditions and careful substrate nutrient balance. To enhance durability and moisture resistance—key factors for commercial viability—the boards are coated with a mineral top layer developed in collaboration with a building materials firm. This coating not only protects against moisture and mold but also increases the material’s strength. The researchers are working toward fully waterproof insulation panels.
materialsinsulationfungi-based-materialssustainable-buildingcarbon-capturebio-based-insulationgreen-constructionSea Lion Prototype ranks among the fastest amphibious cars of its era
The Sea Lion Prototype, designed by Marc Witt and SeaRoader Aquatic, is a rare and innovative amphibious car that debuted in 2012 as one of the fastest dual-mode vehicles of its era. Powered by a Mazda 13B rotary engine paired with a supercharger and Holley carburetor, the 1.3-liter motor uniquely drives both the rear wheels on land and a jet pump in water, eliminating the need for separate propulsion systems. Its lightweight 5052 aluminum alloy body features a monocoque structure for rigidity and corrosion resistance, balancing aerodynamic and hydrodynamic efficiency. A standout feature of the Sea Lion is its shape-shifting suspension, which hydraulically retracts the front wheels and extends side pods to serve as flotation devices and cargo carriers, enhancing stability and speed across land and water. The water propulsion relies on a Berkeley 12 JC jet pump that provides thrust without exposed propellers, improving safety and reducing drag. The cockpit combines conventional driving controls with a joystick
materialsenergyrotary-enginealuminum-alloyjet-propulsionamphibious-vehiclelightweight-materialsMeet the latest VC judges joining Startup Battlefield 200 at TechCrunch Disrupt 2025
The Startup Battlefield 200 pitch competition at TechCrunch Disrupt 2025, scheduled for October 27–29 in San Francisco, will feature 20 founders competing for a $100,000 equity-free prize and the Disrupt Cup. A panel of experienced judges, including investors and industry leaders, will evaluate the startups. TechCrunch recently announced the third group of five judges joining the roster, with more to be revealed soon. Early registration offers significant savings before rates increase after September 26. The newly announced judges bring diverse expertise across venture capital, technology, and startup growth. Jon Chu of Khosla Ventures has a strong background in machine learning and enterprise software, having held key roles at Palantir, Docker, Opendoor, and Facebook. Eryk Dobrushkin from Index Ventures focuses on AI, infrastructure, and robotics, with prior experience at Databricks and Boston Consulting Group. Cathy Friedman of GV brings nearly four decades of experience in finance, technology, and healthcare investing
robotIoTenergymaterialsstartupventure-capitaltechnology-innovationMagnet-controlled soft metamaterial resists acid and holds shape
Researchers at Rice University have developed a novel soft metamaterial that can rapidly change size and shape under remote magnetic control, combining exceptional flexibility with high strength and stability. Unlike traditional materials, this metamaterial’s properties arise from its engineered geometry rather than its chemical composition. It features “programmed multistability” enabled by trapezoidal supports and reinforced beams that lock the structure into new shapes even after external forces are removed. The material withstands compressive loads over ten times its weight and remains functional under extreme temperatures and corrosive conditions, such as those found in the human stomach. Constructed using 3D-printed molds, the metamaterial’s microarchitecture allows it to switch between open and closed states with magnetic triggers, retaining its shape afterward, effectively giving it a form of memory. Larger structures made by linking unit cells can perform complex motions like peristaltic waves, enabling controlled movement or fluid delivery. This soft, adaptable design aims to reduce risks associated with rigid implantable devices, such
materialssoft-metamaterials3D-printingmedical-devicesremote-controlprogrammable-materialsmicroarchitectureFirst quantum squeezing achieved with nanoscale particle motion
Researchers at the University of Tokyo have achieved a groundbreaking feat by demonstrating quantum squeezing of the motion of a levitated nanoscale particle. Quantum squeezing reduces the uncertainty in a particle’s position or velocity below the standard quantum limit set by zero-point fluctuations, a fundamental aspect of quantum mechanics. By levitating a glass nanoparticle in a vacuum and cooling it near its ground state, the team managed to measure a velocity distribution narrower than the quantum uncertainty limit, marking the first such observation for nanoscale particle motion. This experiment bridges the gap between microscopic quantum phenomena and larger-scale objects, offering a new platform to explore quantum mechanics at mesoscopic scales. The achievement required overcoming significant challenges, including stabilizing the levitated particle and minimizing environmental noise. The sensitivity of the nanoscale particle to external fluctuations, while initially a hurdle, now provides a powerful system for studying the boundary between classical and quantum physics. Beyond fundamental science, this advance holds promise for practical applications such as ultra-precise quantum sensors that could enable GPS
materialsquantum-physicsnanoscale-particlesquantum-squeezingsensorsquantum-mechanicsnanotechnologyChina develops fabric that withstands 2,192°F heat with ease
A Chinese company, Safmax, has developed an advanced nano-membrane fabric capable of withstanding extreme temperatures up to 2,192°F (1,200°C) without deforming, shrinking, or melting. Presented at the Public Security Tech Expo in Lianyungang, this flame-retardant material is waterproof, windproof, and breathable, making it suitable for applications such as firefighting suits and fire blankets, particularly for isolating airflow during battery fires in new energy vehicles. The nano-membrane can be applied to ordinary fabrics with a thickness of just one percent of human hair, enhancing their protective properties without compromising comfort. Traditional flame-retardant fabrics typically involve inherent flame-resistant fibers like modacrylic or chemical treatments that disrupt combustion through charring, gas release, or insulation. Firefighters’ gear often uses multi-layered fabrics combining aramid fibers (e.g., Nomex), moisture barriers, and thermal insulation layers. Safmax’s innovation stands out by integrating these
materialsflame-retardant-fabricsnano-membraneheat-resistant-fabricfirefighting-gearadvanced-textilesfire-safety-materialsLeak-proof ceramic 3D printing paves way for next-gen reactors
Scientists at Oak Ridge National Laboratory (ORNL) have made a significant breakthrough in ceramic additive manufacturing by developing a method to produce leak-tight ceramic components using binder jet additive manufacturing (BJAM) combined with advanced post-processing. This innovation overcomes a major hurdle in scaling ceramic 3D printing for high-performance applications, enabling the creation of larger, complex, and gas-tight ceramic parts that were previously difficult to manufacture. The team demonstrated this by printing components filled with a silicon-carbide pre-ceramic polymer and heat-treating them to form amorphous silicon carbide, achieving the first known leak-tight joint fabricated via additive manufacturing. This advancement not only enhances the fabrication of intricate, resilient ceramic parts ideal for extreme environments—such as those found in pharmaceuticals, chemical processing, aerospace, and clean energy—but also offers economic benefits. BJAM is a cost-effective, faster method compared to other ceramic 3D printing techniques, and ORNL’s joining method allows industries to consider ceramics for broader high-performance
materialsceramic-3D-printingadditive-manufacturingleak-proof-ceramicshigh-performance-materialsbinder-jet-additive-manufacturingnext-generation-reactorsTerra Oleo’s oil-producing microbes could replace destructive palm oil plantations
Terra Oleo is a Singapore-based startup founded by Shen Ming Lee and Boon Uranukul that aims to develop sustainable alternatives to palm oil by using engineered microbes to convert agricultural waste into specialty oils. Lee, who grew up in a family deeply involved in the palm oil industry but felt conflicted about its environmental impact, teamed up with Uranukul, who had developed microbes capable of producing plastic precursors from waste during his doctoral research at MIT. Since 2022, Terra Oleo has been working stealthily to harness yeast species genetically optimized to produce high-value oils such as cocoa butter and specialty oleochemicals used in cosmetics and pharmaceuticals, bypassing the low-margin crude palm oil commodity stage. The startup has raised $3.1 million from investors including ADB Ventures and Better Bite Ventures, and is currently producing oils at a lab scale with plans to scale up to kilogram quantities. Terra Oleo’s microbial process offers significant cost advantages by producing target chemicals directly, eliminating expensive refining steps and potentially achieving
materialsbiotechnologysustainable-materialsbiofuelsmicrobial-engineeringagricultural-wastegreen-chemistryNew flash process cuts 96% of metals, keeps aluminum in red mud
Researchers at Rice University have developed a rapid and environmentally friendly method to treat bauxite residue, known as red mud, a toxic by-product of aluminum production. Their technique uses flash Joule heating (FJH), which applies a high-power electrical pulse for under one minute, combined with a small amount of chlorine gas to vaporize hazardous metals. This process removes 96% of iron and nearly all toxic metals while preserving almost all the aluminum content. Unlike traditional methods, it avoids the use of water, solvents, and corrosive chemicals, resulting in a safer, aluminum-rich residue that can be recycled back into aluminum production or converted into durable ceramic building materials. This breakthrough offers significant industrial and environmental benefits by reducing waste piles, lowering emissions, and decreasing the need for new bauxite mining. The cleaned red mud can be transformed into super-hard ceramics suitable for construction, turning a hazardous waste into a valuable resource. The Rice team is collaborating with industry partners through Flash Metals USA, a spinoff company
materialsaluminum-extractionred-mudflash-Joule-heatingwaste-managementsustainable-industryceramic-materialsNew AI-triggered airbag system could save lives in a plane crash
Engineers at BITS Pilani’s Dubai campus have developed Project REBIRTH, an AI-powered airplane crash survival system designed to protect passengers during unavoidable crashes. The system uses AI and sensors to detect imminent crashes below 3,000 feet, automatically deploying external airbags around the aircraft’s nose, belly, and tail within two seconds. These airbags, made from advanced materials like Kevlar and non-Newtonian fluids, absorb impact forces to reduce damage and increase passenger safety. Additionally, the system employs reverse thrust or gas thrusters to slow and stabilize the plane before impact. Post-crash, bright paint, infrared beacons, GPS, and flashing lights aid rescue teams in quickly locating the crash site. A 1:12 scale prototype combining sensors, microcontrollers, and CO2 canisters has been built, with computer simulations indicating a potential reduction in crash impact by over 60%. The team plans to collaborate with aircraft manufacturers for full-scale testing and aims to make the system compatible with both new
robotAIsensorssafety-systemsmaterialscrash-survivalsmart-airbagsUS lab solves 100-year-old physics puzzle with new AI framework
Scientists at Los Alamos National Laboratory and the University of New Mexico have developed an AI framework called Tensors for High-dimensional Object Representation (THOR) that solves a century-old physics challenge: efficiently computing the configurational integral. This integral is fundamental for understanding particle interactions within materials, crucial for predicting properties like strength and stability under extreme conditions. THOR uses tensor-network mathematics to drastically reduce the computation time from weeks on supercomputers to mere hours or seconds, while maintaining high accuracy. This advancement enables more precise modeling of metals and crystals, particularly under high pressure and during phase transitions. THOR tackles the "curse of dimensionality" by decomposing complex, high-dimensional data into smaller, linked components, akin to reorganizing billions of Lego bricks into manageable chains. When combined with a custom interpolation algorithm, this tensor-train technique achieves speeds up to 400 times faster than traditional molecular dynamics simulations. Real-world tests on copper, argon, and tin demonstrated THOR’s ability to accurately reproduce therm
materialsAItensor-networksmetallurgyphase-transitionshigh-pressure-physicscomputational-physicsDivergent raises $290M to expand production of specialized military parts
Divergent Technologies, an advanced manufacturing company specializing in military components, has raised $290 million in a funding round that values the company at $2.3 billion. The capital infusion, which includes $40 million in debt, will be used to expand Divergent’s manufacturing facilities in Los Angeles and to initiate construction of a new factory in Oklahoma next year. The company’s specialized 3D printers produce up to 600 parts, with metal missile airframes being a core product. Divergent’s clientele includes major defense contractors such as Lockheed Martin, RTX, and General Dynamics. This funding round highlights strong investor interest in startups that enhance domestic manufacturing capabilities amid increasing demand for advanced weapons systems, which is putting pressure on traditional supply chains. CEO Lukas Czinger emphasized the importance of missile parts production as a key business focus for Divergent.
materialsadvanced-manufacturing3D-printingmilitary-partsdefense-technologymetal-componentsproduction-expansion3D printed placenta models pave way for safer pregnancy drug testing
Researchers at the University of Technology Sydney (UTS) have achieved a world-first by 3D bioprinting miniature placentas, offering a novel and safer method to study early pregnancy complications. Traditional challenges in pregnancy research stem from the difficulty and risks of obtaining first-trimester placental tissue and the inadequacy of animal and cell models to replicate human placental function accurately. The UTS team combined trophoblast cells—unique to the placenta—with a synthetic gel, printing them in precise droplets to create organoids that closely mimic early human placental tissue. These bioprinted organoids developed differently from those grown in animal-derived gels, highlighting how the growth environment influences placental cell maturation. This advancement enables safer investigation into pregnancy disorders such as preeclampsia, a condition affecting 5–8% of pregnancies and linked to placental dysfunction. The researchers demonstrated the model’s utility by exposing the organoids to inflammatory molecules associated with preeclampsia and testing potential treatments,
materials3D-printingbioprintingorganoidsmedical-researchtissue-engineeringpregnancy-complicationsWorld-first quantum computer made with standard laptop chips launched
Quantum Motion, a UK-based startup, has launched the world’s first full-stack quantum computer built using standard silicon chip technology found in smartphones and laptops. Deployed at the UK National Quantum Computing Centre (NQCC), this quantum computer is the first to utilize the complementary metal-oxide-semiconductor (CMOS) fabrication process, the same transistor technology used in conventional computers. A key innovation is the integration of cryoelectronics that connect qubits with control circuits operating at very low temperatures, enabling significant scalability of quantum processors. The system combines Quantum Motion’s Quantum Processing Unit (QPU) with a user interface and control stack compatible with industry-standard frameworks like Qiskit and Cirq, making it a comprehensive quantum computing solution. It features a compact, data center–friendly design occupying just three 19-inch server racks, with modular auxiliary equipment allowing easy integration and future upgrades without increasing the physical footprint. The QPU’s tile-based architecture supports expansion to millions of qubits per chip, aiming
materialsquantum-computingsilicon-chipsCMOS-technologyscalable-technologycryoelectronicsdata-center-integrationNew 'DNA cassette tape' could solve global data storage crisis
Scientists from the Southern University of Science and Technology in China have developed an innovative “DNA cassette tape” to tackle the growing global data storage crisis. This technology leverages DNA’s exceptionally high data density to store vast amounts of information in a compact, durable format that can last thousands of years without electricity. The system encodes digital data into DNA sequences, which are then stored on a physical tape made from a polyester-nylon blend. Barcode patterns printed on the tape create millions of addressable sections, allowing rapid access to specific data segments. A protective crystalline layer preserves the DNA, preventing degradation over time. The researchers demonstrated the system’s ability to quickly store and retrieve digital images, completing complex data operations within 50 minutes. A single 328-foot DNA cassette tape could potentially hold over 3 billion songs, equivalent to 36 petabytes of data—comparable to the storage capacity of 36,000 traditional hard drives. This DNA-based storage offers a promising alternative to conventional hard drives and servers
materialsDNA-data-storagedata-storage-technologysustainable-storagehigh-density-storagesynthetic-materialslong-term-data-preservationEngineers use electric fields to form circuits beyond silicon limits
Researchers have developed a novel method to fabricate atomically thin logic circuits using two-dimensional (2D) semiconductors, addressing the limitations of traditional silicon-based transistor scaling. Conventional silicon fabrication struggles at nanoscale dimensions due to electrical interference, leakage, and complex manufacturing, prompting exploration of alternative materials like molybdenum disulfide (MoS₂) and tungsten diselenide (WSe₂). These 2D materials offer efficient charge transport and tunable transistor types but have been difficult to integrate into circuits at scale because existing methods rely on high temperatures, vacuum environments, or manual placement, which hinder consistent, large-scale production. The new approach combines solution-based electrochemical exfoliation to produce large, stable 2D nanosheets with electric-field-guided assembly to precisely position n-type MoS₂ and p-type WSe₂ between electrodes without lithography or high-temperature steps. Electrochemical exfoliation uses voltage to insert ions between crystal layers, gently separating them into micron-scale nanosheets suspended
materials2D-semiconductorselectric-field-assemblynanosheetstransistor-fabricationadvanced-materialssemiconductor-technologyCambridge study finds Britain's industry survived Rome's fall
A recent study by researchers from Cambridge and Nottingham universities has challenged the long-held belief that Britain’s industrial economy collapsed following the Roman withdrawal around 400 AD. By analyzing a 16-foot sediment core from Aldborough, a former Roman tribal town in Yorkshire known for metal production, the team established the first continuous timeline of metal production in Britain. Their findings reveal that iron and lead production did not decline immediately after the Romans left but instead experienced fluctuations, with production continuing steadily through the 5th and mid-6th centuries using the same ore sources and coal as during Roman times. The study further shows that metal production expanded during the Viking Age (8th to 10th centuries), indicating economic prosperity in the region, before dipping after the 11th century and rising again in the 12th and 13th centuries. The researchers noted a sudden crash in production around 550-600 AD, the cause of which remains unclear, though historical records suggest that epidemics such as bubonic plague
materialsmetal-productioniron-industryRoman-Britainarchaeological-studyCambridge-researchhistorical-metallurgyiPhone 17, iPhone Air, AirPods Pro 3, and everything else announced at Apple’s hardware event
At Apple’s recent hardware event, the company unveiled its new iPhone 17 lineup, including the iPhone 17, 17 Pro, and 17 Pro Max, featuring larger screens, improved camera systems, and design changes such as a rectangular rear camera bar and a switch from titanium to aluminum on the Pro model’s frame. The iPhone 17 offers a 6.3-inch 120 Hz display, a 48-megapixel ultrawide camera, and starts at $799 with 256GB storage, while the Pro and Pro Max models are priced at $1,099 and $1,199 respectively. Apple also introduced the iPhone Air, its thinnest phone ever at 5.6 mm thickness, replacing the Plus model with a 6.6-inch 120 Hz ProMotion display, a sleek design, and a $999 price point. This device positions Apple competitively against slimmer smartphones from Samsung and Huawei and may hint at a future foldable phone
materialssmartphonesAppledisplay-technologycamera-systemswearable-technologymobile-devicesMolecular coating unites photovoltaics, photodetection in one device
A research team from Korea University and Dongguk University has developed a novel molecular coating for organic solar cells that enables a single device to function simultaneously as a solar cell and a photodetector. This innovation overcomes the traditional conflict between the two technologies: solar cells require rapid charge movement for power generation, while photodetectors need to suppress charge movement to detect faint light signals. The breakthrough was achieved by applying a self-assembled monolayer of a simple molecule—benzene and phosphonic acid (BPA)—onto a transparent electrode (indium tin oxide, ITO). This molecular layer optimizes energy alignment at the interface, allowing efficient charge extraction for power generation and noise suppression for light detection. The BPA-coated device demonstrated a high indoor efficiency of 28.6% under typical indoor lighting conditions (1,000 lux LED at 2700K) and retained 87% of its performance after 1,000 hours of exposure. It offers a nearly ninefold improvement
energymaterialsphotovoltaicsorganic-solar-cellsphotodetectorsindoor-solar-powerIoT-devicesNew gel that stretches 4600%, heals itself can be used in robotics
Researchers in Taiwan have developed an innovative stretchable, self-healing gel that changes color under mechanical stress or temperature variations, potentially transforming wearable technology and soft robotics. This gel combines exceptional elasticity—able to stretch up to 4600% of its original length—with toughness and self-repair capabilities, addressing a common trade-off in soft materials that typically sacrifice either durability, healing, or sensing functions. The key to this breakthrough lies in the gel’s molecular design, which incorporates mechanically interlocked rotaxane molecules arranged in daisy chains, enabling spring-like expansion and contraction. These molecules are chemically bonded within a polyurethane gel reinforced by cellulose nanocrystals, which facilitate self-healing through reversible hydrogen bonds. A special fluorescent unit called DPAC is attached to the rotaxanes, shifting its glow from orange to blue when the gel is stretched or cooled, thus providing a visible indication of stress distribution and temperature changes. This dual-sensing capability allows the gel to act as both a structural material and a built
materialsself-healing-gelsoft-roboticswearable-technologystretchable-materialssmart-materialsmolecular-designChina's oyster-inspired 'bone glue' bonds fractures in minutes
Chinese researchers have developed a novel medical adhesive called “Bone-02,” inspired by the natural adhesive oysters use to attach to underwater surfaces. This bio-glue can bond fractured bones within 2–3 minutes, even in moist, blood-rich environments where traditional adhesives fail. Unlike conventional methods requiring metal plates and screws, Bone-02 can be injected directly into the fracture site, providing strong fixation with bonding strength exceeding 400 pounds and notable shear and compressive strengths. Additionally, the glue is biodegradable, eliminating the need for implant removal surgeries, and early tests indicate it reduces infection risks compared to metal hardware. The innovation promises to revolutionize orthopedic surgery by enabling faster, less invasive procedures with smaller incisions and potentially eliminating permanent implants. Its strong fixation improves bone alignment and healing, lowering complications and healthcare costs. If ongoing clinical trials confirm these benefits, Bone-02 could transform treatment for complex fractures, allowing bones to be effectively “glued” back together and heal naturally rather than being reconstructed with metal hardware
materialsbio-adhesivebone-repairmedical-innovationbiodegradable-gluebiomimicrysurgical-technologyCaltech chip creates ultra-efficient light spectrum across wide range
A Caltech research team led by Professor Alireza Marandi has developed a groundbreaking chip-based optical parametric oscillator (OPO) that generates stable, coherent laser light across an exceptionally broad spectrum, ranging from visible to mid-infrared wavelengths. Unlike traditional bulky and power-intensive OPO systems, this nanophotonic device operates at ultra-low energy levels (femtojoule range) and produces a frequency comb—a set of evenly spaced laser lines used for ultra-precise measurements—on a compact chip. This advancement addresses longstanding challenges of size, tunability, and energy consumption in frequency comb technology. The key innovation lies in the device’s dispersion engineering and resonator design, which enable it to maintain coherence while broadening the spectrum even at power levels well above the oscillation threshold. This new operational regime defies conventional understanding of OPO behavior and allows for unprecedented spectral broadening with high efficiency. The technology promises to accelerate applications in precision spectroscopy, atomic clocks, molecular sensing,
materialsnanophotonicsoptical-parametric-oscillatorfrequency-combchip-based-laserphotonicscoherent-lightHyundai, Steel, & The Concept THREE — Interview with the Designers - CleanTechnica
The article features an interview with Hyundai’s design team about the Concept THREE, an electric vehicle (EV) concept that embodies Hyundai’s new design language called “Art of Steel.” This design philosophy celebrates steel as a material, emphasizing its natural curves, bends, and highlights that emerge from its inherent properties. Hyundai’s unique position as a car manufacturer that produces its own steel inspired the designers to explore how steel’s qualities could be artistically expressed in automotive design. The team used paper sculptures and bent steel models to study form, tension, and flow, resulting in the Concept THREE’s layered planes and intersecting bends that create dynamic highlights and a sense of tension in the vehicle’s bodywork. The Concept THREE is a hatchback, a choice influenced by the European market where hatchbacks are popular. The design process involved collaboration between Hyundai’s Seoul and European design teams, focusing on aerodynamic efficiency and distinctive silhouettes. The “Aero Hatch” silhouette starts low at the front and rises toward the rear, balancing aerodynamic
materialssteelHyundaiconcept-vehicleautomotive-designArt-of-Steelelectric-vehicleNew chemistry shrinks microchips past the limits of human sight
Johns Hopkins researchers have developed a novel microchip manufacturing process that enables circuits to be carved with unprecedented precision at the 229-nanometer scale, producing features smaller than what the human eye can see. This advancement leverages new materials and laser techniques to create ultra-small, faster, and more cost-effective microchips suitable for widespread applications including smartphones and aerospace. The innovation addresses a key industry challenge: finding materials and processes that can endure the intense radiation needed to etch such tiny details economically and reliably in large-scale production. Central to this breakthrough is the use of metal-organic resists composed of metals like zinc combined with an organic compound called imidazole. These resists can withstand beyond extreme ultraviolet (B-EUV) radiation, which traditional materials cannot tolerate. The team employed a chemical liquid deposition (CLD) method to precisely engineer and test various metal-imidazole combinations, discovering that different metals perform optimally at different radiation wavelengths. Zinc, for example, is particularly effective for B
materialsmicrochipssemiconductor-manufacturingnanotechnologymetal-organic-compoundslithographychemical-depositionJeddah Tower: The skyscraper taller than three Eiffel Towers
The Jeddah Tower, set to be completed by 2028, aims to become the world’s tallest skyscraper, surpassing Dubai’s Burj Khalifa by approximately 180 meters. Standing over 1,000 meters (3,281 feet) tall—equivalent to stacking three Eiffel Towers plus a 40-story building—it will dominate the Saudi Arabian skyline along the Red Sea. The tower is the centerpiece of the $20 billion Jeddah Economic City project and symbolizes Saudi Arabia’s push toward modernization and economic transformation. Designed by Adrian Smith, who also designed the Burj Khalifa, the tower features a unique Y-shaped, three-petal footprint inspired by desert plant fronds, optimizing aerodynamic efficiency to withstand intense winds at unprecedented heights. Construction faced a significant halt but resumed in January 2025 under new management, with progress reaching the 70th floor by September 2025 and a pace that supports the 2028 completion goal. Engineering the Jeddah Tower involves groundbreaking
materialsconstructionskyscraperengineeringarchitecturestructural-designfoundation-technologyChina opens record-breaking world’s longest cable-stayed bridge
China has inaugurated the Changtai Yangtze River Bridge in Jiangsu province, marking it as the world’s longest cable-stayed bridge. Spanning 6.4 miles (10.3 kilometers) and connecting the cities of Changzhou and Taizhou, the bridge significantly reduces travel time from 80 to 20 minutes. Its main span measures 3,960 feet (1,208 meters), and the structure integrates an expressway, a local road, and an intercity railway on a single framework—a first for a Yangtze River crossing. Construction took about six years, with the bridge’s towers reaching 1,148 feet (350 meters), equivalent to a 120-story building. The Changtai Bridge set multiple world records, including the longest span cable-stayed bridge, the longest-span combined road-rail steel truss arch bridge, and the longest continuous steel truss girders. During construction, the project team achieved several engineering milestones such as the fastest sinking of large
materialsconstruction-technologysteel-structurescable-stayed-bridgeinfrastructure-engineeringindustrial-cranescivil-engineeringSticky hydrogel slows drug release 20x, extends treatment span
Researchers at Rice University have developed a novel peptide hydrogel platform called SABER (self-assembling boronate ester release) that significantly slows drug release, extending treatment duration by up to 20 times. SABER works by forming a three-dimensional net that temporarily traps drug molecules, allowing for gradual release. This system is versatile, effective for a range of drugs from small molecules to large biologics like insulin and antibodies. In mouse studies, a single SABER injection of a tuberculosis drug outperformed nearly daily oral doses over two weeks, and insulin delivered via SABER controlled blood sugar for six days compared to the usual four-hour effect of conventional insulin. The hydrogel is biocompatible, dissolving safely after injection without toxic byproducts. The SABER platform was developed through interdisciplinary collaboration, combining chemistry and biomedical engineering expertise. The concept originated from dynamic covalent bonds used in glucose sensors, adapted to create a "sticky" hydrogel that controls drug release timing and location. The research team is
materialshydrogeldrug-deliverypeptide-hydrogelbiomedical-engineeringcontrolled-releaseSABER-platformLiving cement stores energy and restores capacity when fed nutrients
Researchers at Aarhus University have developed a novel cement material embedded with the bacterium Shewanella oneidensis, transforming traditional concrete into a living supercapacitor capable of storing and releasing electrical energy. This bio-enhanced cement not only supports structural loads but also creates a network of charge carriers through microbial activity, outperforming conventional cement-based energy storage devices. Remarkably, even after the bacteria die, the material’s energy storage capacity can be restored by supplying nutrients via an integrated microfluidic system, recovering up to 80% of its original performance. The team demonstrated the material’s robustness by testing it under extreme temperatures and successfully powering an LED bulb with six connected blocks. This innovation suggests a future where building materials serve dual roles as both structural elements and active components in energy systems, potentially enabling walls, foundations, and bridges to store renewable energy locally. Such living cement could reduce reliance on scarce battery materials like lithium and cobalt, offering a scalable, sustainable alternative for energy storage integrated directly into infrastructure.
energymaterialssustainable-energy-storagebio-cementmicrobial-energy-storagerenewable-energy-integrationsmart-building-materialsSpaceX Targets an Orbital Starship Flight with a Next-Gen Vehicle in 2026
SpaceX is targeting an orbital flight of its next-generation Starship vehicle by 2026, marking a critical step in the spacecraft’s development. Orbital missions will provide essential data on Starship’s heat shield performance during atmospheric reentry and enable tests of in-orbit refueling, a capability vital for future Mars missions. The company recently completed the 10th full-scale test flight of the combined Super Heavy booster and Starship upper stage on August 26, launching from Starbase, Texas. The flight successfully demonstrated improved propulsion and propellant system reliability, overcoming issues from previous tests, and achieved a controlled splashdown in the Indian Ocean within three meters of the target. A key focus of the recent flight was testing metallic heat shield tiles as a potential alternative to the traditional ceramic tiles. SpaceX installed three metal tiles on the side of the vehicle to evaluate their durability and heat resistance. However, these metal tiles oxidized during reentry, turning a rusty orange color and proving less effective than ceramic
energymaterialsaerospaceSpaceXheat-shieldpropulsion-systemsspacecraftResearchers Create 3D-Printed Artificial Skin That Allows Blood Circulation
Swedish researchers have developed innovative 3D bioprinting techniques to create thick, vascularized artificial skin that could significantly improve treatment for severe burns and trauma. Traditional skin grafts transplant only the epidermis and fail to regenerate the dermis—the deeper skin layer containing blood vessels and nerves—resulting in scarring and loss of full skin function. The new methods aim to overcome this by producing skin that includes living cells and a network of blood vessels, essential for delivering oxygen and nutrients to sustain tissue viability. The team led by Johan Junker at Linköping University created a bio-ink called “μInk,” which embeds fibroblasts (cells that generate dermal components like collagen) within a gel matrix, allowing 3D printing of dense, cell-rich skin structures. In mouse transplantation experiments, these constructs supported cell growth, collagen secretion, and new blood vessel formation, indicating potential for long-term tissue integration. Complementing this, the researchers developed the REFRESH technology, which uses
materials3D-printingbioprintingartificial-skintissue-engineeringbiomedical-materialsregenerative-medicineHow DNA could solve the long-term data storage crisis
The article discusses the potential of DNA as a revolutionary medium for long-term digital data storage, addressing the growing crisis of preserving the vast amounts of information generated daily. Traditional storage technologies such as magnetic drives and optical discs face limitations in cost, durability, and energy consumption, while global data production continues to soar, reaching approximately 181 zettabytes by the end of the year. DNA, with its exceptional density and longevity, offers a promising alternative: a single gram can theoretically store a trillion gigabytes and preserve data for thousands of years. This concept, initially proposed by physicist Richard Feynman in 1959, was practically demonstrated in 2012 when researchers at Harvard encoded a book, images, and a computer program into synthetic DNA strands. DNA data storage works by translating digital information into sequences of the four nucleotide bases (A, T, C, G) using specialized algorithms that optimize for efficiency and error resistance. Synthetic DNA strands, about 200 bases long, act as molecular files that
materialsDNA-data-storagemolecular-storagedata-encodingdigital-storage-technologystorage-densitydata-preservationHelp, I have been charmed by the iPhone Air
The article discusses the author’s unexpected attraction to Apple’s newly introduced iPhone Air, a significant departure from previous iPhone models. Unlike prior years when the author resisted upgrading, the iPhone Air’s ultra-thin, sleek design—reminiscent of the MacBook Air—has sparked genuine desire. Despite initial concerns that its slimness (5.5 millimeters thick) might compromise durability or performance, Apple demonstrated enhanced durability with a screen three times more scratch-resistant and a back glass four times more crack-resistant than earlier models. The iPhone Air also surpasses expectations with its powerful A19 Pro chip, touted as the fastest CPU in any smartphone, delivering MacBook Pro-level computing power. However, the phone’s compact size necessitates trade-offs, particularly in battery life. Without an optional $99 slim battery pack, the iPhone Air offers up to 27 hours of video playback (22 hours of streaming), which is still competitive but less than larger models. The camera setup is
materialssmartphone-technologybattery-lifeprocessor-performancedevice-durabilityApple-iPhone-Airmobile-devicesiPhone Air is Apple’s thinnest device ever at 5.6mm with titanium
Apple has unveiled the iPhone Air, its thinnest smartphone ever, measuring just 5.6mm in thickness. This new model features a titanium frame wrapped in Ceramic Shield material, which Apple claims is three times more scratch-resistant than previous versions, combining a slim profile with enhanced durability. The device sports a 6.5-inch ProMotion display with up to 120Hz refresh rate, 3,000 nits peak brightness, always-on functionality, and an anti-reflective coating to reduce glare. Despite its ultra-thin design, the iPhone Air offers up to 40 hours of video playback, achieved through a reimagined internal layout and exclusive use of eSIMs to save space. Powered by Apple’s new A19 Pro chipset—the fastest smartphone processor on the market—the iPhone Air delivers pro-grade performance with a six-core CPU, upgraded GPU, and advanced connectivity options including Wi-Fi 7, Bluetooth 6, Thread, and improved 5G via the
materialsenergyIoTsmartphone-technologytitanium-framebattery-managementwireless-connectivityiPhone 17, iPhone Air, AirPods Pro 3, and everything else announced at Apple’s hardware event
At Apple’s recent hardware event, the company unveiled its new iPhone 17 lineup, including the standard iPhone 17, iPhone 17 Pro, and iPhone 17 Pro Max, alongside the introduction of the ultra-thin iPhone Air, which replaces the Plus model. The iPhone 17 features a slightly larger 6.3-inch screen with a 120 Hz refresh rate and a 48-megapixel ultrawide camera, starting at $799 with 256GB base storage. The Pro models received design updates such as a rectangular rear camera bar and a switch from titanium to aluminum bands. Apple also introduced “TechWoven” phone cases made from higher-quality woven materials. Notably, Apple did not announce a foldable phone, trailing competitors like Google. The new iPhone Air is Apple’s slimmest phone ever at 5.6 mm thickness, featuring a 6.6-inch 120Hz ProMotion display and priced at $999. This
materialssmartphonesAppleiPhone-17wearable-technologydisplay-technologymobile-devicesiPhone 17, the ‘thinnest iPhone ever,’ and everything else announced at Apple’s hardware event
At Apple’s recent hardware event, the company unveiled its iPhone 17 lineup, including the iPhone 17, 17 Pro, 17 Pro Max, and a new ultra-thin iPhone Air model that replaces the Plus variant. The iPhone 17 features a slightly larger 6.3-inch screen with a 120 Hz refresh rate, a 48-megapixel ultrawide camera, and new color options. The Pro models received design changes such as a rectangular rear camera bar and a switch from titanium to aluminum for the screen band. Pricing starts at $799 for the base iPhone 17 with 256GB storage, $1,099 for the Pro, and $1,199 for the Pro Max. Apple also introduced “TechWoven” phone cases made from high-quality woven materials. The iPhone Air stands out as Apple’s thinnest phone ever at 5.6 mm thick, featuring a 6.6-inch screen and priced at $
materialssmartphonesApple-Watchwearable-technologymobile-devicesdisplay-technologybattery-technologyApple iPhone 17 gets 120Hz Pro Motion, anti-reflective glass upgrade
Apple has announced the iPhone 17, featuring a larger 6.3-inch display with Pro Motion technology that supports a 120Hz refresh rate and peak brightness of 3000 nits. The screen includes a new anti-reflective coating and improved durability with Ceramic Shield 2, making it three times more scratch-resistant. The display can dynamically scale down to 1Hz when idle to conserve power. The device is powered by the new A19 chipset, which incorporates a 6-core CPU, 5-core GPU, a dedicated display engine, and an AI compute core for enhanced performance and efficiency. Significant camera upgrades include a 48-megapixel “dual fusion” rear system that combines main and telephoto functions, and a 12-megapixel front Center Stage camera with a sensor twice the size of its predecessor. Battery improvements allow for up to 8 hours of playback after just 10 minutes of charging. The iPhone 17 will be available in five colors:
materialssmartphone-technologydisplay-technologyceramic-shieldanti-reflective-glassenergy-efficiencyAI-chipsetApple debuts the $999 ultra-thin iPhone Air
Apple has introduced the iPhone Air, a new ultra-thin and lightweight model priced at $999, replacing the iPhone Plus in its 2025 lineup after the iPhone 16 Plus underperformed. The iPhone Air features a titanium frame and measures just 5.6 millimeters thick, making it thinner than current iPhones and competitors like Samsung’s Galaxy S25 Edge. It sports a large 6.6-inch 120Hz ProMotion display and is powered by the A19 Pro chip, matching the performance of the Pro and Pro Max models. The device is e-SIM-only, enhancing its sleek design and security. Despite concerns about battery life and camera capabilities, Apple unveiled a new 48-megapixel fusion camera system and assured all-day battery life. The iPhone Air benefits from iOS 26’s Adaptive Power Mode, which intelligently manages power usage, and comes with new accessories such as a slim MagSafe battery pack offering up to 40 hours of video playback
materialssmartphonebattery-lifetitanium-framee-SIMmobile-technologyAppleApple debuts the ultra-thin iPhone Air
Apple has introduced the iPhone Air, its thinnest and lightest iPhone model to date, replacing the Plus model in the 2025 lineup following the iPhone 16 Plus's underperformance. The iPhone Air emphasizes ultra-thin design and lightness, featuring a titanium frame that weighs around 145 grams and measures just over 5.5 millimeters thick—making it thinner than current iPhones and Samsung’s Galaxy S25 Edge. It sports a large 6.6-inch display with a 120Hz ProMotion refresh rate and is powered by the A19 Pro chip, offering enhanced performance compared to the base iPhone 17. Color options include space black, cloud white, light gold, and light blue. The iPhone Air draws inspiration from Apple’s MacBook Air strategy, which initially faced criticism for cost and performance but eventually became a top seller due to its portability and improved iterations. Similarly, the iPhone Air may set a new standard for future iPhones
materialssmartphone-designtitanium-framemobile-technologyApple-iPhonedevice-thinnessconsumer-electronicsPhysicists create world's first time crystal visible to human eye
Physicists at the University of Colorado Boulder have created the world’s first time crystal visible to the human eye, using liquid crystals—the same materials found in phone displays. Unlike ordinary crystals with repeating spatial patterns, time crystals exhibit a repeating structure in time, with components that move and transform in a continuous cycle. By shining specific light on liquid crystal samples contained between glass plates coated with dye molecules, the researchers induced stable, swirling patterns that repeat over time and can be seen under a microscope or even with the naked eye under special conditions. This breakthrough builds on the theoretical concept proposed by Nobel laureate Frank Wilczek in 2012 and subsequent experimental realizations that were not visible without specialized equipment. The liquid crystal time crystals form through the movement and interaction of molecular “kinks” that behave like particles, creating dynamic, stable patterns resistant to temperature changes. The team envisions practical applications such as advanced anti-counterfeiting measures—embedding “time watermarks” in currency that reveal unique moving patterns
materialstime-crystalliquid-crystalsoptical-devicesanti-counterfeitingquantum-physicsnanotechnologyNew scaffold drives 185% increase in bone repair effectiveness
Researchers at Penn State have developed a new biodegradable scaffold implant, CitraBoneQMg, that significantly enhances bone regrowth, showing a 185% increase in effectiveness compared to traditional bone implants in rat studies. The scaffold combines magnesium and glutamine with citric acid, which together stimulate intracellular energy metabolism in stem cells, promoting their differentiation into bone cells. This synergy between the molecules activates key cellular energy pathways (AMPK and mTORC1) simultaneously, unlike previous materials where these pathways acted inversely, resulting in faster and stronger bone regeneration. Beyond accelerating bone repair, CitraBoneQMg also demonstrated additional healing benefits such as nerve regeneration and anti-inflammatory effects at the injury site, which are crucial for long-term recovery. The scaffold delivers these molecules directly to the injury, ensuring high local concentrations that oral supplements cannot achieve. Furthermore, the implant possesses photoluminescent and photoacoustic properties, enabling non-invasive in vivo tracking via ultrasound. The research team, collaborating with orthopedic surgeons,
materialsbiomaterialsbone-repairbiodegradable-scaffoldmagnesium-implantstissue-engineeringregenerative-medicineHeathrow Terminal 4 evacuated after 'hazardous materials incident'
Heathrow Airport’s Terminal 4 was evacuated on the evening of September 8, 2025, following a possible hazardous materials incident that prompted a major emergency response. Firefighters and specialist crews from multiple stations, including Feltham, Heathrow, and Wembley, were dispatched after the London Fire Brigade received the call at 5:01 pm. As a precaution, Terminal 4’s check-in area was closed, and passengers were advised not to travel there, although all other terminals at Heathrow remained operational. Emergency services supported passengers on site, and National Rail services suspended stops at Terminal 4 due to the incident. Social media posts from evacuated passengers showed emergency blankets being distributed amid dropping temperatures, but there was limited official communication regarding the nature of the incident or the expected duration of the disruption. Unverified reports and online speculation suggested possible illnesses and theories ranging from a terrorist attack to pepper spray use, but authorities have not confirmed any such details. Despite the evacuation, Heathrow’s flight schedule for Terminal
materialshazardous-materialssafetyemergency-responseairport-securityincident-managementfire-brigadeiPhone 17, the ‘thinnest iPhone ever,’ and everything else we’re expecting out of Apple’s hardware event
Apple’s upcoming hardware event on September 9 is expected to unveil the iPhone 17 lineup, including the iPhone 17, 17 Pro, and 17 Pro Max, alongside updates for the Apple Watch and AirPods. The iPhone 17 is rumored to feature a larger 6.3-inch 120 Hz display, a 24-megapixel front camera, and new color options like purple and green. The Pro models may see a redesign with a rectangular rear camera bar and a centered Apple logo, while the iPhone 17 Pro might switch from a titanium to an aluminum frame to reduce weight and cost. The Pro Max is expected to have a thicker body to accommodate a larger battery. Pricing is anticipated around $800 for the base model, $1,100 for the Pro, and $1,250 for the Pro Max, with fewer storage options available. A notable highlight is the rumored introduction of the iPhone Air, potentially replacing the Plus model as Apple’s th
materialssmartphonesApplebattery-technologydevice-designdisplay-technologymobile-devicesCanada Must Treat Timber Like Cars, Not Cabins - CleanTechnica
The article from CleanTechnica argues that Canada faces a dual crisis: a severe housing shortage compounded by an aging construction workforce, alongside the urgent need to reduce greenhouse gas emissions from building materials. Traditional construction methods relying heavily on concrete and steel contribute significantly to embodied carbon emissions, which occur before buildings are even occupied. To address both housing affordability and climate goals, the article advocates for a shift toward mass timber construction combined with modular manufacturing. Mass timber, exemplified by Milwaukee’s Ascent tower—the world’s tallest mass timber building—offers a sustainable alternative that sequesters carbon, reduces construction time, and is scalable for urban housing needs. The author emphasizes that Canada should treat housing construction like advanced manufacturing, producing apartments and mid-rise condos in factories using standardized designs and mass timber panels or modules. This industrial approach can overcome labor shortages, accelerate delivery by 30-50%, and drastically cut embodied carbon emissions. Policy recommendations include government acting as an anchor customer through multi-year contracts, creating pattern books of pre
energymaterialsmass-timbermodular-constructionembodied-carbonsustainable-buildinggreen-constructionMass Timber As Lego: Flyvbjerg’s Modularity Meets Low-Carbon Construction - CleanTechnica
The article explores the potential of mass timber, particularly cross-laminated timber (CLT) and glulam beams, as a transformative material in low-carbon construction, framed through the project management insights of Professor Bent Flyvbjerg. Flyvbjerg, known for his research on why large projects often fail due to delays and cost overruns, advocates for modularity—using repeatable, scalable components akin to Lego bricks—to improve project reliability. Mass timber’s factory-made, standardized panels fit this modular approach, allowing for faster, more predictable assembly on site, which aligns with Flyvbjerg’s principles for successful megaprojects. This modularity not only reduces embodied carbon compared to concrete and steel but also supports scalable, efficient construction methods that can address housing shortages and climate goals. The article also highlights Flyvbjerg’s emphasis on reference class forecasting (RCF) to counteract optimism bias in project planning. By comparing new mass timber projects to a growing database of similar completed timber
energymaterialsmass-timbermodular-constructionlow-carbon-constructioncross-laminated-timbersustainable-building-materialsPhotos: A love for surfing drives design of new MINI 'The Skeg' concept
MINI’s new concept car, ‘The Skeg,’ developed in collaboration with lifestyle brand Deus ex Machina, uniquely blends electric vehicle technology with surf culture. This one-off John Cooper Works electric show car emphasizes minimalism, clean design, and acceleration, embodying a “quiet rebellion” that reflects both progressive electric mobility and the ethos of surfing. Its exterior features a vibrant yellow and silver finish, wide fenders, an illuminated grille, and lightweight semi-transparent fiberglass panels that reduce weight by 15%. A standout aerodynamic element is the Flex Tip Surf Spoiler, inspired by the concave underside of a surfboard, which dynamically responds to airflow to generate lift. Inside, ‘The Skeg’ pays homage to surf shops with custom fiberglass elements that play with light and a dashboard made using surfboard technology for durability and lightness. Practical features such as fiberglass trays for wetsuit storage and tactile analogue controls underscore the car’s functional design rooted in surf culture values. The racing bucket seats are upholstered in
energyelectric-vehiclesmaterialsfiberglassneopreneautomotive-designaerodynamicsReefs 'see' light without eyes, coral's secret unlocked in new study
A recent study from Osaka Metropolitan University has uncovered a novel light-sensing mechanism in reef-building corals, revealing that certain coral opsins use chloride ions from their environment instead of amino acids to switch light sensitivity between ultraviolet (UV) and visible light. This discovery challenges the conventional understanding of opsins—proteins responsible for vision in animals—where typically a negatively charged amino acid acts as a counterion. The coral opsins, specifically a newly identified group called ASO-II opsins found in Acropora tenuis, employ chloride ions to stabilize the Schiff base, enabling reversible switching of light sensitivity depending on environmental pH levels. This mechanism allows corals, despite lacking eyes, to adapt their light detection in response to changes in ocean acidity, which is influenced by their symbiotic algae’s photosynthesis. The study highlights the ecological significance of this adaptation, suggesting that corals’ ability to toggle between UV and visible light sensitivity helps maintain their symbiotic relationship with algae under varying pH conditions caused
materialsprotein-engineeringcoral-opsinslight-sensitivitychloride-ionsenvironmental-adaptationbiomaterialsDiamonds created using electron beams, overturning 'common wisdom'
Researchers at the University of Tokyo, led by Professor Eiichi Nakamura, have developed a novel method to create nanodiamonds by irradiating adamantane—a cage-shaped hydrocarbon molecule with a diamond-like carbon skeleton—with electron beams inside a transmission electron microscope (TEM). Contrary to the prevailing belief that electron beams destroy organic molecules, their technique uses controlled electron irradiation to break carbon–hydrogen bonds and form new carbon–carbon bonds, transforming adamantane into defect-free nanodiamonds approximately 10 nanometers in diameter. This process occurs at relatively low pressures and without the extreme heat or crushing pressures traditionally required for diamond synthesis, marking a significant breakthrough in both synthetic diamond production and electron microscopy. The discovery not only challenges the long-standing assumption that electron beams irreversibly damage organic molecules but also opens new possibilities for material science and technology. The unique diamond-like structure of adamantane is crucial for this transformation, as other hydrocarbons did not yield similar results. Potential applications include advancements in
materialsnanodiamondssynthetic-diamondselectron-beamnanotechnologyquantum-technologytransmission-electron-microscopyTuning the untunable: Dirac waves gain new control in terahertz devices
The article discusses a breakthrough in controlling Dirac plasmon polaritons (DPPs), exotic waves that combine light with electron motion in ultra-thin materials, specifically in the terahertz (THz) frequency range. THz waves, which lie between microwaves and infrared light, have long been difficult to harness due to rapid energy loss and poor controllability. The researchers addressed this by using topological insulator metamaterials made from epitaxial Bi2Se3, which conduct electricity only on their surfaces, allowing electrons to behave as massless particles. By designing laterally coupled nanostructures ("metaelements") and precisely adjusting their spacing, they successfully tuned the DPPs’ behavior, increasing the polariton wavevector by up to 20% and extending the attenuation length by over 50%, enabling tighter light confinement and longer propagation with less energy loss. This advancement paves the way for more efficient, tunable THz photonic devices with broad applications, including
materialsterahertz-devicesnanostructurestopological-insulatorsplasmon-polaritonsphotonicsquantum-devicesNon-magnetic material shows 'Anomalous Hall Effect' for the first time
Japanese physicists from the Tokyo Institute of Science and Technology have experimentally observed the Anomalous Hall Effect (AHE) in a nonmagnetic material—cadmium arsenide (Cd3As2)—for the first time, confirming longstanding theoretical predictions. Traditionally, AHE was believed to occur only in magnetic materials due to electron spin magnetization. However, the team demonstrated a large AHE signal in pure thin films of Cd3As2 by applying an in-plane magnetic field and carefully manipulating the electronic band structure to isolate the anomalous contribution from the ordinary Hall effect. This discovery overturns the assumption that AHE is exclusively spin-driven. The significance of this finding lies in the origin of the AHE in Cd3As2, which arises from orbital magnetization—the circular orbital motion of electrons—rather than spin magnetization typical of ferromagnets. This highlights the often-overlooked role of orbital effects in electron behavior and opens new avenues for both fundamental research and technological applications. Potential
materialsanomalous-hall-effectcadmium-arsenidedirac-semimetalsmolecular-beam-epitaxyelectronic-band-structurespintronicsFukushima football club unveils Japan's first circular timber stadium
Fukushima United FC, in collaboration with architecture startup VUILD, has unveiled plans for Japan’s first circular timber stadium in Fukushima Prefecture. The 5,000-seat venue is designed with sustainability and circular construction principles at its core, using laminated wood sourced locally from Fukushima forests. The stadium’s components are engineered for disassembly and reuse, promoting recycling of local resources. Its seating is distributed into four separate volumes with individual entrances, maintaining a human scale and fostering community accessibility. The design draws inspiration from Japan’s Shikinen Sengu tradition of ritual shrine rebuilding, emphasizing cycles of resources, community, and craftsmanship. This includes reforestation efforts, woodworking education, and participatory construction to regenerate local skills and materials. Structurally, the stadium features hyperbolic paraboloid timber shells forming the roof, allowing for cantilevered spans and referencing the steep thatched roofs of historic Ōuchi-juku. Passive energy strategies address Fukushima’s climate by optimizing shading, ventilation, insulation,
materialssustainable-architecturetimber-constructioncircular-economyenergy-efficiencypassive-energy-designrecyclingFukushima football club unveils Japan's first circular timber stadiumFFFFukushima
Fukushima United FC, in collaboration with architecture startup VUILD, has announced plans to build Japan’s first circular timber stadium in Fukushima Prefecture. The 5,000-seat venue will emphasize sustainability and circular construction by using locally sourced laminated wood designed for disassembly and reuse. The stadium’s seating is distributed across four volumes with separate entrances to maintain a human scale, and the timber framework reflects a circular model aimed at recycling local resources. The design draws inspiration from the Japanese Shikinen Sengu tradition of ritual rebuilding, applying this concept to cycles of resources, community, and craftsmanship through reforestation, woodworking education, and participatory construction. Structurally, the roof employs hyperbolic paraboloid shells made from small timber members, allowing cantilevered spans and referencing the steep thatched roofs of Fukushima’s historic Ōuchi-juku town. Passive energy strategies are integrated to adapt to the local climate, including shading, natural ventilation, insulation, and systems to collect rainwater and
materialssustainable-constructiontimber-architecturecircular-economyenergy-efficiencypassive-energy-designreforestationGold’s hidden side: Scientists discover needle-shaped quantum clusters
Scientists at the University of Tokyo have discovered a novel form of gold nanoclusters—needle-shaped structures they call "gold quantum needles"—by capturing gold clusters at their earliest growth stages. Unlike typical gold nanoclusters that form roughly spherical shapes, these quantum needles grow unevenly, elongating through repeating units of three and four gold atoms. This unique atomic arrangement leads to quantum behavior, where electrons occupy fixed energy states. The discovery was made possible by deliberately slowing the growth process and analyzing the clusters with single-crystal X-ray diffraction, revealing unprecedented insight into the initial formation of gold nanoclusters, a process previously considered a "black box." The gold quantum needles exhibit strong interactions with near-infrared light, suggesting potential applications in biomedical imaging and energy conversion technologies. By understanding the stepwise growth of these clusters, researchers hope to develop methods to precisely control the shape and properties of nanoclusters, moving beyond the current unpredictability of their synthesis. While practical production and modification of these quantum
materialsnanoclustersquantum-needlesgold-nanomaterialsquantum-behaviornanotechnologyenergy-conversionNine-metal MXene obliterates limits of 2D nanomaterial design
Scientists at Purdue University have achieved a breakthrough in two-dimensional (2D) nanomaterials by synthesizing MXenes—ultrathin sheets just a nanometer thick—that incorporate up to nine different transition metals. This represents a significant advance beyond previous MXene designs, which typically involved fewer metals. By creating nearly 40 layered materials with varying metal combinations, the researchers explored how entropy (the tendency toward atomic disorder) competes with enthalpy (the drive for ordered atomic arrangements) in these complex structures. They found that while MXenes with fewer metals tend to form ordered layers, those with higher metal diversity exhibit “high-entropy” phases characterized by atomic disorder, a transition that is crucial for designing materials stable under extreme conditions. The team first synthesized layered “parent” MAX phases before converting them into MXenes to study their surface and electronic properties, linking atomic order-disorder transitions to functional behavior. This insight expands the family of 2D materials and their potential applications in demanding environments such
materialsnanomaterialsMXene2D-materialshigh-entropy-materialsadvanced-materialsenergy-storage-materialsA timeline of the US semiconductor market in 2025
The U.S. semiconductor market in 2025 has experienced significant developments amid geopolitical tensions and industry shifts, largely driven by the strategic importance of AI chip technology. Nvidia reported a record quarter in August, with a notable 56% year-over-year revenue growth in its data center business, underscoring its strong market position despite broader industry turmoil. Meanwhile, Intel underwent major changes: the U.S. government took an equity stake in the company’s foundry program to maintain control, and Japanese conglomerate SoftBank also acquired a strategic stake. Intel further restructured by spinning out its telecom chip business and consolidating operations to improve efficiency, including halting projects in Germany and Poland and planning workforce reductions. Political dynamics have heavily influenced the semiconductor landscape. President Donald Trump announced potential tariffs on the industry, though none had been implemented by early September, and publicly criticized Intel CEO Lip-Bu Tan amid concerns over Tan’s ties to China. Tan met with Trump to discuss Intel’s role in revitalizing U.S
materialssemiconductorAI-chipsIntelNvidiachip-manufacturingtechnology-industryGerman scientists debunk 200-year-old theory on why ice is slippery
German scientists from Saarland University have overturned a 200-year-old theory explaining why ice is slippery, challenging the long-held belief that pressure and friction cause ice to melt and create a slippery surface. Led by Professor Martin Müser, the research team demonstrated through advanced computer simulations that molecular dipole interactions—not pressure or friction—are responsible for disrupting the ordered crystal lattice of ice at the contact surface, such as between ice and a shoe sole. These dipole-dipole interactions create a frustrated, unstable structure that leads to the formation of a thin liquid-like layer, making ice slippery. This new understanding revises the classical explanation dating back to James Thompson, who attributed slipperiness to pressure-induced melting. The findings also debunk the misconception that skiing below –40°C is impossible due to the absence of a lubricating liquid film; the team showed that dipole interactions persist even at extremely low temperatures, allowing a slippery layer to form. Overall, this research fundamentally changes how physicists explain phase changes at
materialsice-physicsmolecular-dipolesphase-changessurface-sciencecrystal-latticematerial-simulation3D-printed scaffolds guide stem cells to repair spinal cord injury
A research team at the University of Minnesota Twin Cities has developed a novel approach to spinal cord injury repair by combining 3D printing, stem cell biology, and regenerative medicine. They created a 3D-printed organoid scaffold containing microscopic channels filled with spinal neural progenitor cells (sNPCs) derived from human adult stem cells. These channels guide the growth of the stem cells, promoting the formation of new nerve fibers that can bypass damaged spinal cord areas. When implanted into rats with completely severed spinal cords, the scaffolds supported the development of neurons that extended nerve fibers in both directions, integrating with existing spinal tissue and leading to significant functional recovery. The study demonstrates that the scaffold not only enhances cell survival but also enables reconnection across severe spinal injuries, marking a promising advance in regenerative medicine for paralysis. The researchers plan to scale up and refine the technology for clinical trials, aiming to eventually restore mobility and independence in people with spinal cord injuries. This interdisciplinary project involved experts in neurosurgery
materials3D-printingregenerative-medicinestem-cellsspinal-cord-injurybiomedical-engineeringtissue-engineeringRing laser tracks Earth's axial wobble 100 times more accurately
Scientists at the Technical University of Munich (TUM) and the University of Bonn have developed a highly sensitive underground ring laser capable of tracking Earth's axial wobble with unprecedented precision—100 times more accurate than previous ring lasers or gyroscopes. Located at the Geodetic Observatory in Wettzell, Bavaria, this instrument recorded Earth's subtle rotational fluctuations, including precession and nutation, continuously over 250 days without relying on telescopes, satellites, or external reference signals. Unlike traditional methods such as Very Long Baseline Interferometry (VLBI), which require complex, multi-continental radio telescope networks and take days or weeks to process data, the ring laser provides near real-time measurements with updates every hour or less. Earth’s axis experiences constant motion due to gravitational forces from the Moon and Sun and its equatorial bulge, resulting in slow precession cycles (~26,000 years) and shorter nutation oscillations (notably an 18.6-year cycle, plus weekly and daily fluctuations
materialsring-laser-technologygeodetic-observatoryEarth-axial-wobbleprecision-measurementrotational-fluctuationslaser-instrumentationMass Timber & Fire Safety: What The Evidence Shows - CleanTechnica
The article from CleanTechnica examines the fire safety of mass timber, highlighting its growing use due to advantages like lighter weight, faster assembly, and carbon storage compared to concrete and steel. A key concern for stakeholders—developers, insurers, and regulators—is whether mass timber can withstand fire as effectively as traditional materials. The article explains that mass timber behaves differently in fire: thick timber members form a protective char layer that insulates the core, slowing heat spread and preserving structural integrity. Unlike steel, which loses strength rapidly at high temperatures, or concrete, which can spall and expose reinforcing steel, mass timber fails gradually and predictably, allowing designers to size components to maintain load-bearing capacity during fire exposure. Fire testing supports these findings, with mass timber assemblies routinely achieving 1-2 hour fire ratings and sometimes longer. Full-scale compartment burn tests in North America and Europe have shown that mass timber structures can survive intense fires without collapse, with fires often self-extinguishing after consuming room contents. The National
materialsmass-timberfire-safetycross-laminated-timbersustainable-building-materialscarbon-storageconstruction-materialsiPhone 17, the ‘thinnest iPhone ever,’ and everything else we’re expecting out of Apple’s hardware event
Apple’s upcoming hardware event on September 9 is expected to unveil the iPhone 17 lineup, alongside updates to the Apple Watch and AirPods. The iPhone 17 series, including the standard, Pro, and Pro Max models, is rumored to feature significant design and hardware changes. The iPhone 17 may have a larger 6.3-inch 120Hz display, a 24-megapixel front camera, and new color options like purple and green. The Pro models could see a redesigned rear camera layout with three lenses arranged in a rectangular bar, and a shift from titanium to aluminum for the Pro’s frame to reduce weight and cost. The Pro Max might have a slightly thicker body to house a larger battery. Pricing leaks suggest the iPhone 17 could start around $800, with the Pro and Pro Max priced at approximately $1,100 and $1,250 respectively, though storage options may be reduced compared to previous models. In addition to the main iPhone
materialsenergysmartphone-technologybattery-technologyaluminumdevice-designmobile-devicesWooden walls can withstand 100 kilonewtons of pressure, research finds
Swiss researchers at Empa, led by PhD student Nadja Manser, have demonstrated through large-scale experiments that timber frame walls containing window openings can withstand horizontal loads exceeding 100 kilonewtons. This finding challenges the longstanding engineering assumption that windowed timber walls provide little to no structural support and are treated as voids in design models. The research, conducted in collaboration with ETH Zurich and Bern University of Applied Sciences, involved testing full-scale two-story timber walls under controlled lateral pressure until failure, revealing that such walls contribute significant bracing capacity. This breakthrough addresses a critical gap in timber engineering regulations, which currently lack guidelines for horizontal load-bearing in walls with window openings. Manser is now developing a computational model to accurately capture the horizontal stiffness of these walls, enabling engineers to predict wall behavior under lateral loads without relying on overly conservative assumptions. The research suggests that in some buildings, the need for concrete cores to achieve stiffness might be reduced or eliminated, potentially leading to more efficient and sustainable timber construction
materialstimber-constructionstructural-engineeringload-bearing-wallsbuilding-materialstimber-frameconstruction-researchPlastic Recycling Not Requiring Sorting Could Be Coming - CleanTechnica
Northwestern University chemists have developed a novel plastic upcycling process using an inexpensive nickel-based catalyst that can selectively break down polyolefin plastics—primarily polyethylene and polypropylene, which constitute nearly two-thirds of global plastic use. This catalyst enables the recycling of large volumes of unsorted polyolefin waste, bypassing the traditionally labor-intensive sorting step. The catalyst converts low-value solid plastics into liquid oils and waxes, which can be upcycled into higher-value products like lubricants, fuels, and candles. Notably, it can also process plastics contaminated with polyvinyl chloride (PVC), a toxic polymer that typically hinders recycling efforts. Polyolefins are ubiquitous in everyday items such as condiment bottles, milk jugs, plastic wrap, and disposable utensils, and they are mostly single-use plastics with very low recycling rates globally—ranging from less than 1% to 10%. This low recycling rate is largely due to the chemical resilience of polyolefins, which consist of
materialsplastic-recyclingcatalystpolyolefinsupcyclingsustainabilitychemical-engineeringScientists map foams for maximum energy absorption and safety
Mechanical engineers at the University of Wisconsin–Madison have developed a novel design framework that significantly streamlines the creation of shock-absorbing foam materials used in protective gear and aerospace applications. Unlike traditional foam design, which focused mainly on maintaining a constant stress plateau and optimizing mechanical properties alone, this new approach simultaneously considers foam thickness, surface area, and mechanical behavior. The researchers found that foams exhibiting nonlinear stress-strain responses can outperform conventional “ideal absorber” foams, especially in compact designs, expanding the design possibilities for energy-absorbing materials. The framework generates a design map based on inputs such as foam thickness, area, and material properties, enabling engineers to customize foams for maximum energy absorption with minimal weight and volume. Demonstrated on vertically aligned carbon nanotube foams, the method allows rapid optimization without extensive trial and error. Freely available online, the framework has broad applicability across various material systems, including metamaterials and soft robotics, and could revolutionize the development of lighter, safer
materialsenergy-absorptionfoam-designshock-absorbing-materialsmetamaterialsprotective-gearlightweight-materialsFrom Reuse To Burial: Managing Mass Timber Beyond The Building Stage - CleanTechnica
The article from CleanTechnica discusses the critical importance of managing mass timber beyond its use in construction to ensure its role as a genuine climate solution. Mass timber, such as cross-laminated timber (CLT), is gaining traction for its ability to reduce embodied carbon by replacing high-emission materials like concrete and steel and by storing biogenic carbon absorbed during tree growth. However, the climate benefits hinge on effective end-of-life strategies that keep the carbon locked away rather than releasing it back into the atmosphere. Designing buildings for disassembly enables direct reuse of timber components, potentially extending carbon storage to a full century and avoiding emissions from new material production. When direct reuse is not feasible, cascading uses—downcycling timber into smaller components, furniture, or composite products—can prolong carbon storage and reduce demand for virgin materials, though less efficiently than reuse. Beyond reuse and cascading, transforming timber into stable forms like biochar offers long-term carbon sequestration. Biochar, produced by heating wood without oxygen, res
materialsmass-timbercarbon-footprintsustainable-constructioncross-laminated-timberclimate-solutioncarbon-storageHollow glass fiber transmits internet with 1,000x greater capacity
Researchers at the University of Southampton have developed a novel hollow glass fiber that transmits internet signals through air-filled channels rather than solid glass cores. This design significantly reduces signal loss, allowing light to travel more efficiently over longer distances—extending the range before losing half the signal from 15–20 kilometers in conventional fibers to about 33 kilometers. The hollow fibers can carry over 1,000 times the power of traditional fibers and support a broader spectrum of wavelengths, including single-photon pulses used in quantum communication, making the technology promising for both current internet infrastructure and emerging quantum networks. The fiber’s unique structure consists of five small cylinders with nested cylinders arranged precisely to confine specific light wavelengths within the hollow core, preventing signal leakage. Manufacturing challenges have been addressed by starting with a large glass preform containing the hollow channels, which is then stretched while pressurized to maintain the geometry. Commercial production is underway through Lumenisity, a Southampton spin-off acquired by Microsoft in 2022, highlighting
materialsoptical-fiberdata-transmissionenergy-efficiencyphotonicsquantum-communicationinternet-technologyIce shows hidden ability to produce electricity when stressed: Study
A recent study reveals that ordinary ice can generate electricity when mechanically stressed—bent, stretched, or twisted—through a phenomenon called flexoelectricity. Unlike piezoelectricity, which requires specific crystal symmetries and was previously thought absent in ice due to the cancellation of water molecule dipoles, flexoelectricity can occur in any material symmetry. The research, conducted by teams from Institut Catala de Nanociencia I Nanotecnologia (ICN2), Xi’an Jiaotong University, and Stony Brook University, demonstrated that bending an ice slab between electrodes produced measurable electric potential across a range of temperatures. This discovery helps explain natural electrical phenomena involving ice, such as lightning generated by charged ice particle collisions in thunderstorms. Furthermore, the study uncovered that at extremely low temperatures (below -171.4°F or -113°C), ice develops a thin ferroelectric surface layer capable of reversible electric polarization, akin to magnetic pole flipping. This indicates ice can produce electricity via two
materialsenergyflexoelectricityiceelectricity-generationnanophysicselectromechanical-propertiesStudents build aerospace 3D printer that fuses two metals at once
A team of Swiss bachelor students at ETH Zurich has developed an innovative 3D metal printer, named RAPTURE, that significantly advances aerospace manufacturing by enabling high-speed, multi-material printing. Unlike traditional 3D printers that operate in a stop-start manner, this prototype uses a rotating laser powder bed fusion (LPBF) system to continuously deposit and fuse metal powders. This design allows the simultaneous fusion of two different metals—such as a copper core with a nickel-alloy exterior—in a single seamless step, which is particularly suited for producing complex aerospace components like rocket nozzles and turbine parts with large diameters and thin walls. The rotating platform reduces production time by over two-thirds compared to conventional methods. The RAPTURE machine also incorporates a novel gas flow system that directs inert gas across the fusion zone to prevent oxidation and continuously removes by-products like soot and spatter, resulting in cleaner builds and higher part quality. This feature was found critical to the success of the printing process. Initially created to support
materials3D-printingaerospace-manufacturingmetal-fusionmulti-material-printinglaser-powder-bed-fusionpropulsion-componentsBuilding green lasers that last: A story of patents and persistence
The article "Building green lasers that last: A story of patents and persistence" explores the complex engineering challenges behind developing reliable green laser distance meters, despite their clear advantages over traditional red lasers. Green lasers offer significantly better visibility in bright outdoor conditions, making them highly desirable for construction, surveying, and industrial applications. However, the transition from red to green lasers is far from straightforward due to increased power consumption, heat generation, and the lower sensitivity of photodetectors to green light. These factors result in shorter battery life, thermal instability, reduced measurement range, and accuracy issues, especially under harsh outdoor lighting. Beyond the physical and optical challenges, manufacturing green laser modules at scale presents additional hurdles. Green laser components are more difficult and costly to produce consistently, with small variances causing significant performance differences between units. The article emphasizes that engineering a green laser distance meter involves balancing conflicting demands—boosting power to improve range and accuracy increases heat and safety risks, while reducing power compromises performance. Success requires a
materialsenergy-efficiencylaser-technologygreen-laserspower-consumptionheat-managementoptical-engineeringNew catalyst breaks down mixed plastics into fuels at low heat
Northwestern University chemists have developed an innovative nickel-based catalyst that efficiently converts mixed single-use polyolefin plastics—such as milk jugs, plastic wraps, and disposable utensils—into valuable oils, waxes, and lubricants at relatively low temperatures and pressures. This process bypasses the traditionally necessary and labor-intensive sorting step, addressing a major bottleneck in plastic recycling. Unlike existing methods that require high heat and expensive catalysts, this single-site nickel catalyst operates at temperatures 100 degrees lower and half the hydrogen pressure, using significantly less catalyst material while achieving tenfold greater activity. The catalyst selectively breaks down branched polyolefins, enabling a cleaner and more efficient chemical recycling that produces high-quality products suitable for upcycling. A notable and unexpected finding was the catalyst’s improved performance in the presence of polyvinyl chloride (PVC), a toxic polymer that typically inhibits recycling processes. Even with PVC constituting up to 25% of the plastic mix, the catalyst maintained and enhanced its activity,
materialscatalystplastic-recyclingnickel-catalystchemical-recyclingpolyolefinssustainable-materialsThe titans of tech: Top 10 most powerful supercomputers of 2025
As of June 2025, the global landscape of supercomputing is dominated by exascale machines primarily based in the United States, with significant new entries from Europe and continued presence from cloud and industrial sectors. Leading the pack is El Capitan at Lawrence Livermore National Laboratory, boasting 1.742 exaFLOPS on the LINPACK benchmark and demonstrating balanced performance across scientific workloads. Following closely is Frontier at Oak Ridge National Laboratory, the first-ever exascale supercomputer, now ranked second with 1.353 exaFLOPS, maintaining its role in advanced scientific research. Aurora at Argonne National Laboratory rounds out the top three, achieving just over 1 exaFLOPS and designed to integrate simulation with AI-driven science applications. Europe's fastest system, Germany’s JUPITER Booster, marks a significant milestone by entering the top tier with 793.4 petaFLOPS, powered by NVIDIA Grace-Hopper superchips and InfiniBand networking
energymaterialssupercomputersexascale-computinghigh-performance-computingAMD-EPYCAI-simulationWhy Canada Must Align Sequestered Carbon Accounting With Global Markets - CleanTechnica
The article discusses the critical need for Canada to align its accounting of sequestered carbon in mass timber construction with global market standards. It uses the example of Lytton, British Columbia, which suffered devastating heat in 2021, to highlight the urgency of climate-resilient building practices. The town’s rebuild is serving as a pilot project for integrating carbon sequestration into building design, particularly through the use of mass timber products like cross-laminated timber (CLT). These wood products lock away carbon absorbed during tree growth, effectively acting as carbon banks that can reduce a building’s overall carbon footprint if the wood is reused or disposed of in ways that prevent decay. Scientifically, mass timber has a significant advantage over conventional materials like concrete and steel in terms of embodied carbon emissions. While producing a cubic meter of CLT can store about one ton of CO₂ equivalent, concrete and steel production emit hundreds to over a thousand kilograms of CO₂ per cubic meter. Studies show timber buildings can reduce
energymaterialscarbon-sequestrationmass-timbercross-laminated-timbersustainable-constructionembodied-carbonSpaceX Starship survives harsh reentry with heat shield, flaps intact
SpaceX’s Starship completed its 10th test flight, successfully demonstrating key systems despite enduring intense reentry conditions. The spacecraft’s stainless steel body showed burn marks, dents, and scorched tiles after splashing down in the Indian Ocean, highlighting the extreme heat and friction it faced. Notably, the heat shield—comprising thousands of silica tiles—was tested with new metal tiles and intentional gaps, resulting in dramatic orange and red streaks from rusted tiles and white patches where insulation replaced lost tiles. Despite this damage, the heat shield held firm, providing valuable data for engineers to improve its resilience. The flight also tested Starship’s large flaps, which guide the vehicle during its belly flop descent. These flaps endured red-hot temperatures and partial ablative layer burn-off but successfully controlled the spacecraft’s descent and splashdown. Additionally, Starship’s payload bay was used for the first time to deploy eight dummy Starlink satellites, proving its capability to handle real missions. The six
materialsaerospace-engineeringheat-shield-technologystainless-steelthermal-protectionSpaceXspacecraft-durabilityNorth Korea shows new long-range nuke as Kim heads to meet Xi, Putin
North Korea publicly unveiled its new long-range nuclear missile, the Hwasong-20, as leader Kim Jong Un prepared to attend a military parade in China alongside Presidents Xi Jinping and Vladimir Putin. The missile features a newly developed solid-fuel engine generating a maximum thrust of 1,960 kilonewtons, intended for use in both the existing Hwasong-19 ICBM and the future Hwasong-20 system. This solid-fuel technology, developed using carbon-fiber composite materials, allows for quicker missile deployment compared to traditional liquid-fuel designs. Kim’s inspection of the missile research institute and a new automated missile production facility highlights North Korea’s efforts to modernize its defense industry and enhance its strategic missile capabilities. The announcement comes amid North Korea’s broader goal to strengthen its nuclear arsenal’s range, payload capacity, and survivability to evade U.S. and allied missile defenses. The Hwasong-18, unveiled last year, reportedly has a range exceeding 15,
energymaterialssolid-fuel-technologymissile-propulsioncarbon-fiber-compositesdefense-manufacturingautomated-productionThe engineered wood designed to beat steel and concrete
The article discusses the development of SUPERWOOD, an engineered timber created by Maryland-based InventWood to rival steel and concrete in construction. By restructuring cellulose fibers at the molecular level, SUPERWOOD becomes 12 times stronger and 10 times more durable than natural wood. This innovation builds on research from the University of Maryland, which highlighted the exceptional strength of cellulose nanocrystals in plants—stronger than carbon fiber but underutilized due to wood’s porous structure. Instead of inventing new synthetic materials, InventWood enhances wood’s natural properties, making it a sustainable, fire-resistant, and carbon-negative alternative for the construction industry, which currently contributes 37% of global greenhouse gas emissions. The manufacturing process of SUPERWOOD involves two key steps: a chemical treatment that modifies lignin and removes hemicellulose (the natural “glue” in wood), followed by hot-pressing to densify the wood by collapsing its cell walls. This densification increases the wood’s density up to four times
materialsengineered-woodsustainable-constructionsuperwoodcellulose-nanocrystalscarbon-negative-materialsgreen-building-materialsHungry Worms Could Help Solve Plastic Pollution
The article discusses the potential of wax moth larvae, known as wax worms, to help address plastic pollution by breaking down polyethylene, the most widely produced and environmentally persistent plastic. Discovered by European researchers in 2017, wax worms naturally consume polyethylene due to its chemical similarity to beeswax, their traditional food source. Studies led by Dr. Bryan Cassone at Brandon University revealed that around 2,000 wax worms can degrade an entire polyethylene bag in 24 hours, with their gut bacteria playing a crucial role in this process. The bacteria, including a resilient strain of Acinetobacter, metabolize polyethylene into glycol and convert it into lipids stored in the worms’ bodies. However, a diet solely consisting of polyethylene is not sustainable for wax worms, as they lose weight and die within days without additional nutrients. Researchers suggest that supplementing their diet with feeding stimulants could enhance their survival and plastic degradation efficiency. Moving forward, two main strategies are proposed: mass-producing wax worms with nutritional support to
materialsplastic-biodegradationpolyethylenewax-wormsgut-bacteriaenvironmental-sustainabilitybioremediationMass Timber’s Edge: Smaller Crews, Quicker Builds, New Floors Above - CleanTechnica
The article highlights the growing advantages of mass timber construction beyond its well-known environmental benefits, emphasizing its significant time and labor efficiencies. Mass timber projects consistently demonstrate faster build times and require smaller, more specialized crews compared to traditional concrete construction. For example, the nine-story Stadthaus building in London was erected by just four carpenters in 27 working days, whereas a comparable concrete frame would take five to six months with much larger crews. Similarly, Vancouver’s 18-story Brock Commons timber tower was completed in 66 days by nine installers, while a concrete equivalent would need six to eight months and 40 to 60 workers. Other projects like Minneapolis’s T3 office and Melbourne’s Forté building reinforce these findings, showing that mass timber can halve construction schedules and reduce onsite labor by 60 to 70 percent. This shift in construction methodology also changes workforce demands, concentrating labor into fewer, higher-skilled roles such as CNC operators, timber framers, and 3D modelers who work
materialsmass-timberconstruction-technologysustainable-buildingmodular-constructionCLTgreen-building-materialsBuilding The Workforce & Finance Tools For Mass Timber Growth - CleanTechnica
The article from CleanTechnica discusses the critical non-technical barriers to scaling mass timber construction in Canada, emphasizing workforce development and financial tools as key areas for growth. While mass timber’s engineering, fire safety, and carbon benefits are well established, challenges remain in economics, institutional support, and skilled labor availability. Unlike Europe, which has coordinated training programs producing skilled workers in digital modeling, CNC operation, and modular construction, Canada lacks a national strategy to develop the specialized workforce needed to support mass timber’s expansion. The article calls for collaboration among educational institutions and industry to train thousands of workers over the next decade. Financial volatility, particularly lumber price swings, presents another major hurdle. Unlike concrete and steel, mass timber lacks established futures markets or hedging mechanisms, making project costs unpredictable and deterring developers. The article stresses the need for financial instruments, long-term contracts, or vertical integration to stabilize input costs and enable reliable pricing. Insurance is also a concern, as Canadian insurers remain cautious due to limited data
materialsmass-timbercross-laminated-timbermodular-constructionsustainable-buildingconstruction-technologytimber-industryHandcrafted wooden Bentley made in 3,000 hours rolls like a real car
A handcrafted wooden replica of a Bentley Continental GT, inspired by the third-generation model (2017–2024), was meticulously built over 3,000 hours by an unknown Belgian maker, possibly linked to ND Woodworking Art. Constructed primarily from marine-grade teak and plywood, the sculpture weighs about 2,000 pounds and features thousands of wooden parts forming the body, chassis, and even the wheels and tires. While it lacks an engine, the car can roll and steer via a rack-and-pinion system, with steel axles and acrylic windows as the only non-wood components. The exterior captures key Bentley design elements such as the large grille, oval headlights, and three-dimensional emblems, while the interior includes opening doors, a dashboard, center console, and carved seats etched to mimic Bentley’s diamond upholstery pattern. Currently displayed at the Autosport Group showroom in Boca Raton, Florida, the wooden Bentley is listed for sale on eBay for $98,900, a price comparable
materialswoodworkinghandcraftedwooden-carsculptureteakplywoodMass Timber Nations: Case Studies & Canada’s Export Opportunities - CleanTechnica
The article "Mass Timber Nations: Case Studies & Canada’s Export Opportunities" from CleanTechnica highlights the growing global significance of mass timber as a sustainable construction material that locks carbon into buildings while reducing reliance on high-emission materials like concrete and steel. It emphasizes Canada’s potential to become a leader in this sector by learning from international examples and strategically positioning itself in increasingly competitive export markets. The article outlines how cross laminated timber (CLT), developed in the 1990s in Austria and Germany, revolutionized mass timber production through vertical integration with sawmills and a global export focus, setting quality and certification standards that established durable competitive advantages. The article also examines Finland and Sweden’s coordinated strategies, where government policies, corporate investments, and education dramatically increased wood use in mid-rise construction, supported by major forestry companies treating mass timber as a core business. Japan’s approach combines cultural wood-building traditions with modern adaptations, including government mandates for wood in public buildings and seismic engineering tailored to local species, illustrating how
materialsmass-timbercross-laminated-timbersustainable-constructioncarbon-reductionbuilding-materialsexport-opportunitiesETH Zurich researchers uncover the secret to lasting beer foam
Researchers at ETH Zurich, led by Professor Jan Vermant, have uncovered the complex physics behind the long-lasting foam on certain beers, particularly Belgian ales. Their seven-year study revealed that foam stability varies significantly among beer styles: Tripels exhibit the most durable foam, followed by Dubbels, while Singels have less stable heads. The team also found that some Swiss lagers can rival Belgian ales in foam longevity, though the underlying mechanisms differ. Contrary to previous beliefs that protein layers alone determine foam stability, the researchers showed that factors like surface viscoelasticity and the specific arrangement of proteins around bubbles play crucial roles, varying by beer type. In Belgian Singel beers, proteins behave like particles forming a stabilizing suspension, whereas in Dubbels, proteins create a net-like membrane that strengthens bubbles. For lagers, the elasticity and rigidity of the bubble film are key. Beyond brewing, these insights have broader applications, such as improving foam management in lubricants for electric vehicles and developing sustainable surf
materialssoft-materialsfoam-stabilitybeer-foamprotein-layerssurface-viscoelasticitysustainable-surfactantsSecret life of grains: Hidden swirling motion observed for first time
Scientists have, for the first time, directly observed hidden swirling motions—known as secondary flows—within flowing granular materials like sand and snow, using a novel X-ray imaging technique called X-ray rheography. These secondary flows involve grains moving sideways or in loops beneath the surface, rather than simply following the primary downhill path. Previously, such motions were only predicted by computer simulations or inferred indirectly from surface patterns, as traditional methods either disturbed the flow or altered grain behavior. The researchers overcame these challenges by designing a conveyor-belt experiment with glass beads and capturing rapid X-ray images that allowed them to track grain movements inside the pile in real time without interrupting the flow. This breakthrough provides the first direct experimental evidence of secondary flows in granular media, confirming that these swirling currents are a fundamental characteristic of materials like snowdrifts, sandpiles, and grain silos. The discovery has significant implications for understanding natural hazards such as landslides and avalanches, where ignoring secondary flows in models may lead to
materialsgranular-flowX-ray-imagingrheographylandslidesavalanchespowder-handlingConstruction materials could be greener, lighter with ceramic clay blend
Researchers from the University of São Paulo (USP) and the Federal University of Sao Carlos (UFSCar) have developed a novel approach to repurpose large amounts of sargassum algae, which have been increasingly accumulating on Caribbean and Atlantic coastlines, causing environmental and economic problems. Instead of discarding the seaweed in landfills, the team incorporated sargassum into ceramic clay mixtures at 20% and 40% concentrations. These mixtures were then sintered at various temperatures using both conventional and microwave ovens to produce lightweight ceramic clay aggregates. The study found that adding sargassum notably reduced the density of the materials, with microwave-sintered samples meeting strength requirements across all tested temperatures. A comprehensive life cycle assessment revealed that the algae-infused ceramics offer environmental benefits by reducing natural resource consumption and enhancing energy efficiency in construction materials. The researchers successfully incorporated up to 30% sargassum into panels, fully replacing limestone ash, while maintaining or improving durability and mechanical performance in
materialssustainable-constructionceramic-claysargassum-algaelightweight-aggregateslife-cycle-assessmenteco-friendly-materialsAdhesives, Dowels & Veneers: The Industrial Choices Shaping Mass Timber - CleanTechnica
The article from CleanTechnica explores the industrial choices shaping mass timber production, emphasizing how different manufacturing methods impact costs, carbon footprints, and building applications. Mass timber, including cross laminated timber (CLT) and laminated veneer lumber (LVL), is gaining attention for its climate benefits by sequestering carbon and replacing more carbon-intensive materials like steel and concrete. Two primary production methods dominate: traditional sawn lumber, which involves milling logs into boards that are dried and glued into layers, and veneer-based processes, where logs are rotary peeled into thin sheets for laminates. The sawn lumber approach leverages existing sawmill infrastructure but suffers from inefficiencies and waste, while veneer-based production achieves higher material utilization and uniform mechanical properties but requires large, capital-intensive facilities. The article also highlights emerging hybrid and experimental manufacturing techniques that blend veneer and sawn lumber or use oriented strand and parallel strand products, often incorporating robotics and automation to reduce labor and waste. A key industry debate centers on the use of adhesives
materialsmass-timbercross-laminated-timberlaminated-veneer-lumbersustainable-constructionwood-technologymodular-constructionNew carbon nanotube insulation can resist temperatures exceeding 4,700°F
Chinese researchers at Tsinghua University have developed a novel carbon nanotube-based insulation film capable of withstanding temperatures up to 4,712°F (2,600°C), significantly surpassing the limits of conventional insulators that typically fail above 2,732°F (1,500°C). This ultralight, porous, multilayered material is made by growing vertical carbon nanotube arrays and drawing them into thin sheets, which are then stacked or wound into layers. The structure effectively blocks all three modes of heat transfer—solid conduction, gas conduction, and radiative heat transfer—by exploiting the nanotubes’ nanoscale dimensions, pore size, and unique electronic properties that absorb and scatter infrared radiation. The new insulation exhibits an exceptionally low thermal conductivity of 0.004 W/mK at room temperature and 0.03 W/mK at 2,600°C, outperforming common high-temperature insulators like graphite felt, which has a thermal conductivity of 1.6 W/m
materialscarbon-nanotubeshigh-temperature-insulationthermal-conductivityaerospace-materialsenergy-applicationsnanotechnologyHyundai CRADLE Partners with UNCAGED Innovations to Develop Sustainable Leather Alternatives for Vehicles - CleanTechnica
Hyundai CRADLE, the global open innovation hub of Hyundai Motor Group, has partnered with UNCAGED Innovations to develop sustainable, animal-free leather alternatives for vehicle interiors. This collaboration aims to produce high-performance, bio-based leather that significantly reduces environmental impact compared to traditional animal leather. The grain-based biomaterial developed through this partnership cuts greenhouse gas emissions by 95%, water usage by 89%, and energy consumption by 71%, while maintaining the texture, durability, and luxurious quality required for automotive interiors. UNCAGED Innovations utilizes its proprietary BioFuze technology platform to create a leather alternative called ELEVATE, which mimics the molecular structure and performance of animal hides by using grain proteins fused with plant-based elements. This approach differs from carbohydrate-based competitors by replicating collagen’s scaffolding function, essential for leather’s qualities. Hyundai CRADLE values UNCAGED’s sustainable manufacturing process that minimizes chemical inputs and uses natural dyes, aligning with Hyundai Motor Group’s strategy to prioritize high bio-content and environmentally responsible
materialssustainable-materialsbiomaterialsautomotive-interiorsleather-alternativesHyundai-CRADLEUNCAGED-InnovationsSmart laser welding to eliminate filler wire in EV battery housings
Researchers at the Fraunhofer Institute for Material and Beam Technology IWS in Dresden have developed an advanced laser welding technology that eliminates the need for filler wire while producing crack-free, low-porosity, and high-strength joints. This process uses dynamic beam shaping and targeted laser beam oscillation to control the melt pool, reduce pores, and stabilize welds, enabling robust and efficient welding of challenging materials such as aluminum die castings and extruded profiles. The method also reduces energy consumption, material use, and post-processing compared to conventional arc welding. A key application demonstrated is in electric vehicle (EV) battery housings, where the technology successfully welded lightweight aluminum structures combining extrusion profiles and die-cast elements with walls up to five millimeters thick. This approach overcomes typical issues like porosity and hot cracking without filler material, and the resulting housings have been integrated and tested in real vehicles. The technology is also applied in aerospace for welding high-strength 2,000-series aluminum tanks and in heavy
energymaterialslaser-weldingelectric-vehiclesbattery-housingsaluminum-alloysmanufacturing-technologyMass Timber At Parity: Fixing Insurance & Code Bottlenecks - CleanTechnica
The article from CleanTechnica highlights that the main barriers to scaling mass timber construction in Canada have shifted from technical feasibility to insurance costs and inconsistent building code adoption. While engineers have demonstrated that cross-laminated timber (CLT) can produce tall, strong, and safe buildings, insurers currently charge significantly higher premiums—often four to ten times those of concrete—due to limited historical claims data and perceived risks such as fire and water damage during construction. This elevated insurance cost undermines the financial viability of mass timber projects despite their advantages in speed and carbon reduction. Additionally, uneven adoption of the 2020 National Building Code provisions across provinces and municipalities creates regulatory uncertainty and delays, particularly because many jurisdictions still require case-by-case alternative solutions reviews rather than allowing prescriptive, repeatable approvals. To overcome these bottlenecks, the article advocates for normalizing mass timber through data-driven risk assessment and regulatory harmonization. Establishing a national data trust to aggregate claims, fire test results, and performance monitoring would
energymaterialsmass-timbercross-laminated-timberbuilding-codesconstructionsustainable-materialsSweden's Kiruna Church makes 5 km journey to avoid mining subsidence
Sweden’s Kiruna Church, a 713-tonne wooden architectural treasure built in the early 1900s and once named the country’s most beautiful building, was relocated five kilometers to a new site in August 2025. This extraordinary engineering feat was undertaken to protect the church from subsidence caused by the expansion of the world’s largest iron ore mine beneath the town. The move, led by heavy-lift specialist Mammoet with support from Veidekke and timber experts, involved elevating the church onto steel beams and transporting it on self-propelled modular transporters with precise tilt controls to ensure structural integrity. The relocation took place over two days during optimal Arctic conditions, with thousands of residents and King Carl XVI Gustaf witnessing the event, which locals called “the great church walk.” The church’s move is part of Kiruna’s broader urban transformation, where entire neighborhoods and civic landmarks are being shifted to safer locations due to mining-induced ground instability. This process reflects a balance between
materialsminingengineeringstructural-preservationurban-transformationheavy-liftingconstruction-technologyStudy shows molecules can guide electrons, aiding safer medicines
Researchers at ETH Zurich have demonstrated that molecular chirality—the “handedness” of molecules—is not solely a static structural property but also an electronic phenomenon involving the dynamic behavior of electrons. Using ultrafast attosecond pulses of circularly polarized light, the team observed and manipulated how electrons are emitted differently from left- and right-handed mirror-image molecules, a process known as photoelectron circular dichroism (PECD). They were able to track electron ejection timing and even reverse the direction of electron emission by adjusting the light’s polarization and phase, marking the first experimental control over chirality-driven electron dynamics. This discovery has significant implications for fields such as drug design, molecular electronics, and sensing technologies, where chirality plays a crucial role. Since many drugs are effective only in one chiral form, understanding and controlling electron behavior at this fundamental level could lead to safer and more targeted medicines. The breakthrough was enabled by a novel “electron flash camera” capable of delivering circularly polarized attose
materialsmolecular-electronicschiralityphotoelectron-circular-dichroismattosecond-pulsesdrug-designelectron-dynamicsHonor’s slim Magic V5 foldable is fun to use, minus the huge camera bump
The Honor Magic V5 foldable phone competes in the race for the thinnest foldable device, boasting an 8.8mm thickness when folded. However, this slim profile is offset by a large, protruding camera bump that affects handling comfort and causes the phone to wobble when unfolded and placed on a flat surface. Despite this design drawback, the device features a sturdy build with IP58 and IP59 dust and water resistance ratings, a durable second-generation Honor Super Steel hinge, and a carbon fiber reinforced inner panel for enhanced durability. Powered by the Qualcomm Snapdragon 8 Elite processor, the Magic V5 offers a 6.43-inch front display and a 7.95-inch unfolded main screen, both with high resolutions and LTPO technology supporting dynamic refresh rates from 1Hz to 120Hz for smooth navigation. The phone’s screen is bright, reaching up to 5,000 nits, making it well-suited for reading and media consumption. It houses a
materialsenergysmartphonesfoldable-technologybattery-technologycarbon-fibercharging-technology‘Steel Dome’ air defense to counter drone swarms, missiles in Turkey
Turkey has launched its ambitious “Steel Dome” integrated air defense system, delivering 47 vehicles worth $460 million to the Turkish Armed Forces. Developed primarily by domestic defense firms including Aselsan, Roketsan, TÜBİTAK SAGE, and MKE, the system combines air defense, radar, and electronic warfare capabilities to create a multi-layered national shield against a wide range of aerial threats, from drone swarms to ballistic missiles. President Recep Tayyip Erdoğan described Steel Dome as Turkey’s “security umbrella” in the skies, emphasizing its role in enhancing national security and deterring adversaries. The Steel Dome operates as a “system of systems,” integrating real-time data from multiple sensors and sources, refined by artificial intelligence, to provide commanders with a unified Recognized Air Picture (RAP) across the country. It is designed to protect critical regions such as Ankara, the Bosphorus and Dardanelles straits, and strategic assets like the Akkuyu nuclear power plant.
robotIoTenergymaterialsair-defenseradar-systemselectronic-warfareartificial-intelligencemilitary-technologyScientists discover DNA coils tightly when put under stress
A recent study led by the University of Cambridge challenges the long-standing belief that DNA strands form knots under torsional stress. Using nanopore technology, researchers observed that instead of tangling, DNA coils into highly organized, spring-like structures called plectonemes. This discovery overturns previous interpretations of irregular current signals during nanopore experiments, which were thought to indicate knot formation. The distinction between knots and coils is crucial: coils are orderly and reversible, allowing DNA to manage torsional stress predictably, whereas knots are irregular and difficult to resolve. This finding has significant implications for biology and technology. Inside living cells, DNA frequently experiences torsional stress during processes like chromosome packing and enzymatic activity. The formation of plectonemes could influence gene accessibility, replication, and regulation. Additionally, understanding the difference between coils and knots can enhance the accuracy of nanopore sequencing technologies, which rely on detecting electrical disruptions caused by DNA structures. Overall, the study reframes DNA mechanics by portraying the molecule as a
materialsDNA-mechanicsnanopore-sequencinggenome-technologymolecular-biologybiophysicsgenetic-materialReal-time 3D imaging shows nuclear materials corroding under stress
MIT researchers have developed a novel real-time 3D imaging technique that uses focused high-intensity X-rays combined with a silicon dioxide buffer layer to observe nanoscale corrosion and strain in nuclear reactor alloys, specifically nickel-based metals. This method overcomes previous challenges by stabilizing samples and allowing phase retrieval algorithms to capture the dynamic failure processes inside materials under conditions simulating those in nuclear reactors. By watching corrosion and cracking as they happen, scientists can better understand material degradation, which could lead to designing safer, longer-lasting nuclear reactors. An unexpected outcome of the research was the ability to tune strain within crystals using X-rays, a finding with potential applications beyond nuclear engineering, including microelectronics manufacturing where strain engineering improves device performance. The team plans to extend this technique to study more complex alloys relevant to nuclear and aerospace industries and investigate how varying buffer thickness affects strain control. Experts highlight the significance of this work for advancing knowledge on nanoscale material behavior under radiation and the importance of substrate effects in strain relaxation.
materialsnuclear-materialscorrosion3D-imagingX-ray-imagingnuclear-reactorsmaterial-scienceFrom Harvest To Housing: CLT Locks Away More Carbon Than It Emits - CleanTechnica
The article from CleanTechnica discusses the carbon accounting of cross laminated timber (CLT) and its potential as a carbon-negative building material. CLT stores significant amounts of carbon absorbed by trees during growth, locking it into building structures for as long as they stand. Although emissions occur throughout the CLT lifecycle—from harvesting and transport to drying, adhesive production, and assembly—the amount of carbon stored in the wood far exceeds these emissions. For example, producing one cubic meter of CLT emits about 120 kilograms of CO2, while the wood stores nearly a ton of CO2, making CLT net carbon negative from cradle to gate according to Canadian Environmental Product Declarations (EPDs). However, current carbon accounting standards often separate stored carbon from emissions rather than netting them, due to uncertainty about the wood's end-of-life fate. If wood is incinerated or landfilled without proper gas management, stored carbon is released back into the atmosphere. Conversely, reuse, recycling, or conversion into stable
energymaterialscarbon-storagecross-laminated-timbersustainable-constructionembodied-carbonclimate-changeCosmic butterfly reveals crystals, fiery jets and life-linked molecules in Webb image
Astronomers using the James Webb Space Telescope (JWST) have made significant discoveries in the Butterfly Nebula (NGC 6302), located 3,400 light-years away, shedding light on how rocky planets like Earth may form. Webb’s infrared instruments revealed a dense torus of dust surrounding an extremely hot central star (220,000 Kelvin), containing crystalline silicates such as quartz alongside larger-than-usual dust grains. These findings suggest that cosmic dust, the building blocks of planets, can form and grow under both calm and violent cosmic conditions, providing new insights into dust formation processes in space. The observations also detected carbon-based molecules known as polycyclic aromatic hydrocarbons (PAHs), which are linked to life-friendly chemistry and are commonly found on Earth in smoke and exhaust. This may be the first evidence of PAHs forming inside an oxygen-rich planetary nebula, indicating complex organic chemistry occurring in such environments. Additionally, iron and nickel were traced in powerful jets emanating from the
materialscosmic-dustcrystalline-silicatespolycyclic-aromatic-hydrocarbonsplanetary-nebulaJames-Webb-Space-Telescopespace-chemistryPlants that shine in various colors developed, charge with sunlight
Scientists have developed glow-in-the-dark succulents that emit various colors such as green, red, and blue by infusing them with micron-sized afterglow phosphor particles. These particles absorb sunlight or indoor LED light and slowly release it, enabling the plants to glow for up to two hours after brief exposure. The research, published in the journal Matter, highlights that succulents are particularly effective hosts due to their compact microstructure and evenly distributed leaf channels, which facilitate uniform particle dispersion and bright luminescence. This method overcomes previous challenges where smaller nanoparticles were dimmer and larger particles could not move efficiently within plants. The glowing plants rival the brightness of small night lights and present potential for sustainable, plant-based lighting systems that could be used in architecture, urban planning, and interior decor. The researchers even created a glowing plant wall with 56 succulents capable of illuminating nearby objects and reading material. Each plant costs roughly $1.40 to prepare, excluding labor. While the light
materialssustainable-lightingplant-based-lightingluminescent-plantsafterglow-phosphorsunlight-chargingglow-in-the-dark-plantsWhy cement is climate's hardest challenge
The article highlights cement as one of the most significant climate challenges, responsible for about 8% of global CO₂ emissions—more than aviation and shipping combined. In 2022, the cement industry emitted roughly 1.6 billion tonnes of CO₂, with production at 4.1 billion tonnes annually and rising due to urbanization. China alone produces about half of the world’s cement, underscoring the scale of the problem. A key difficulty in reducing emissions lies in the chemical process of cement production: about 60% of CO₂ emissions come from the decomposition of limestone into clinker, not just from fuel combustion, meaning renewable energy alone cannot solve the issue. Despite efficiency gains since 1990, emissions could nearly double by 2050 without transformative changes. Engineers are pursuing multiple strategies to lower cement’s carbon footprint, particularly by reducing clinker content through blending alternative materials, often industrial byproducts. Ground granulated blast-furnace slag (GGBS), a steelmaking
materialscementcarbon-emissionssustainable-constructionindustrial-byproductsCO2-reductionclimate-solutionsHyundai is working with a startup on plant-based leather that smells like the real thing
Hyundai is collaborating with the startup Uncaged to develop a plant-based leather alternative designed for automotive interiors. Unlike traditional synthetic leathers made from fossil fuel-derived plastics, Uncaged’s material is primarily composed of plant proteins sourced from grains such as wheat, soy, and corn. The startup has engineered this material to closely mimic the texture, durability, and even the scent of real animal leather by replicating the fibrous collagen structure found in tanned hides. This innovation aims to offer a customizable, animal- and climate-friendly substitute with a carbon footprint reportedly 95% lower than conventional leather. Uncaged’s plant-based leather is already used in vegan handbags and watch straps, but the automotive sector represents a larger market due to the high leather consumption in vehicle interiors. The material is competitively priced, with costs ranging from under $10 per square foot for small orders to about half that for large orders, offering both environmental and economic benefits. The startup is currently conducting tests with several automakers
materialsplant-based-leathersustainable-materialsautomotive-materialseco-friendly-leather-alternativescarbon-footprint-reductionleather-substitutesSpaceX’s Starship makes history with its most successful test yet
SpaceX’s Starship achieved a major milestone on its 10th test flight, marking the company’s most successful trial to date after a series of setbacks. Launching from Starbase, Texas, the 403-foot rocket executed a smooth ascent with flawless stage separation. The Super Heavy booster successfully splashed down in the Gulf of Mexico, testing alternative landing methods rather than the previously used tower catch system. This mission demonstrated key capabilities, including the deployment of mock Starlink satellites from Starship’s payload bay—an important first that showcased the rocket’s potential as a cargo delivery vehicle for future satellite constellations. The flight also featured a successful reignition of a vacuum-optimized Raptor engine, only the second time this maneuver has been completed, advancing Starship’s goal of full reusability. Reentry, historically a challenging phase, was deliberately made demanding to test new heat shield materials and the rocket’s rear flaps under extreme conditions. Despite visible damage to one flap, Starship survived
energymaterialsspace-technologyrocket-propulsionsatellite-deploymentreusable-rocketsheat-shield-materialsPaving the Road for Cement and Concrete Technologies - CleanTechnica
The National Renewable Energy Laboratory (NREL) hosted its third annual Cement and Concrete Critical Technologies meeting on June 9–10 in Golden, Colorado, bringing together over 80 representatives from startups, investment firms, academia, industry, and government labs. The event focused on addressing the challenges and innovations in the cement and concrete industry, which is the second most utilized resource globally and vital to U.S. infrastructure. Key topics included modernizing domestic production, improving material durability, reducing import reliance, funding acquisition, accelerated performance testing, and scaling technologies for field deployment. A regional discussion highlighted how Denver and Colorado transportation and architectural agencies are adopting new procurement methods and infrastructure projects. NREL researchers emphasized the lab’s unique role as a trusted third party that supports the industry across all technology readiness levels, from early discovery to implementation. The meeting underscored the critical need for innovative cement and concrete formulations to meet growing infrastructure demands driven by urbanization and aging construction. Accelerating testing protocols and enabling broader adoption of alternative
materialscement-technologyconcrete-innovationinfrastructure-materialssustainable-constructionmaterial-scienceenergy-efficient-materialsSpaceX notches major wins during tenth Starship test
SpaceX achieved significant progress during the tenth test flight of its Starship rocket, marking a turnaround after a series of prior failures. The 403-foot vehicle launched from Starbase, Texas, powered by 33 methane-fueled Raptor engines, and successfully separated its Super Heavy booster about three minutes after liftoff. Notably, the booster demonstrated a new landing maneuver by intentionally switching from primary to backup engines during descent, culminating in a targeted splashdown in the Gulf of Mexico. Meanwhile, the upper stage, known as Starship, reached space and for the first time opened its payload bay doors to release eight Starlink mass-simulator satellites, a capability previously unproven in flight. The upper stage also successfully reignited a Raptor engine in orbit and reentered the atmosphere, testing its upgraded thermal protection system under extreme heat. SpaceX conducted various experiments during reentry, including testing new tile materials and configurations on the vehicle’s exterior. Importantly, the Starship maintained communication with
energymaterialsaerospaceSpaceXrocket-technologythermal-protection-systemsatellite-deploymentWhy the U.S. government is not the savior Intel needs
The Trump administration recently announced a controversial plan to convert government grants originally intended for Intel into a 10% equity stake in the company. This move, unprecedented and legally uncertain, aims to support Intel but does not address the company’s core challenges, particularly its struggling Intel Foundry division. Intel Foundry, responsible for manufacturing custom semiconductors for external customers, has failed to secure major contracts and has operated at a loss, contributing to layoffs and internal leadership changes. Industry experts argue that Intel’s problems stem less from funding shortages and more from a flawed customer service approach and internal culture that prioritizes manufacturing over client relationships. Intel itself has acknowledged risks associated with the government equity deal, including dilution of existing shareholders’ stakes and potential negative impacts on its international business, which accounts for the majority of its revenue. The involvement of the U.S. government as a partial owner could complicate Intel’s relationships with foreign customers amid ongoing trade tensions. While some analysts view the government’s intervention as a positive sign of
materialssemiconductor-manufacturingIntel-Foundrygovernment-grantsequity-stakechip-industrysemiconductor-industryHow CLT Displacement Makes Steel & Cement Decarbonization Realistic - CleanTechnica
The article discusses how cross laminated timber (CLT) serves as a critical lever for decarbonizing the traditionally carbon-intensive steel and cement industries by displacing these materials in construction. While CLT is often highlighted for its benefits in faster, more affordable, and lower-carbon housing, its broader impact lies in reducing global demand for cement and steel over time. This substitution effect, especially in mid-rise residential and commercial buildings, contributes to bending demand curves downward, making decarbonization of heavy materials more achievable. The article builds on previous analyses that positioned CLT and modular construction as key solutions to housing shortages and embodied emissions, emphasizing the need for integrated value chains and government policy support to scale CLT adoption. Contrary to conventional projections that assume steady growth in cement and steel demand aligned with GDP and urbanization, the article argues that demand will peak earlier and decline gradually due to several factors: the end of China's infrastructure boom, shifts in advanced economies from expansion to maintenance, efficiency gains, and
energymaterialsdecarbonizationcross-laminated-timbercementsteelconstruction-materialsThe wait is almost over: The 2025 Startup Battlefield 200 list drops tomorrow
TechCrunch is set to announce the 2025 Startup Battlefield 200 list on Wednesday, August 27, at 9:00 a.m. PT. This list features a curated selection of the most promising early-stage startups from thousands of global applications, who will compete at TechCrunch Disrupt 2025, scheduled for October 27-29 in San Francisco. The event marks the 20th anniversary of TechCrunch Disrupt, a platform that has historically launched successful companies like Dropbox, Cloudflare, Fitbit, and Discord. The top 20 finalists from the Battlefield 200 will be revealed on the first day of Disrupt, where they will compete live for a $100,000 prize and the Disrupt Cup. Last year’s winner, Salva Health, gained recognition for its portable breast cancer detection device aimed at underserved rural populations. Other notable finalists included geCKo Materials, which innovated in adhesive technology. The Startup Battlefield competition is presented by Google Cloud and continues to be a
materialsstartupsinnovationadhesive-materialsbreakthrough-technologytech-startupsTechCrunch-DisruptAfter falling behind in generative AI, IBM and AMD look to quantum for an edge
IBM and AMD are collaborating to develop a commercially viable quantum computing architecture as a strategic move to regain competitiveness after lagging behind in the generative AI market. Their joint effort aims to create a scalable and open-source quantum system, making advanced quantum computing more accessible to researchers and developers. This initiative targets complex real-world applications such as drug and materials discovery, optimization, and logistics. By leveraging AMD’s AI-specialized chips and IBM’s expertise in quantum technology, the partnership seeks to position both companies as key infrastructure providers in the evolving tech landscape. IBM’s CEO, Arvind Krishna, emphasized the transformative potential of quantum computing to simulate the natural world and represent information in fundamentally new ways, highlighting the significance of this venture for future technological advancements.
materialsquantum-computingAI-chipsIBMAMDdrug-discoveryoptimizationiPhone 17, the ‘thinnest iPhone ever,’ and everything else we’re expecting out of Apple’s hardware event
Apple is expected to hold its annual hardware event on September 9, unveiling the iPhone 17 lineup alongside updates to the Apple Watch and AirPods. The iPhone 17 series will include the standard iPhone 17, 17 Pro, and 17 Pro Max models, featuring notable upgrades such as a slightly larger 6.3-inch screen for the base model with a 120Hz refresh rate, a 24-megapixel front camera, and new color options like purple and green. The Pro models may see a redesign of the rear camera layout into a rectangular bar spanning the device’s width, with the Apple logo centered for aesthetic balance. The iPhone 17 Pro might switch from a titanium to an aluminum frame to reduce weight and cost, while the Pro Max is expected to have a thicker body to house a larger battery. Pricing rumors suggest the iPhone 17 at around $800, the Pro at $1,050, and the Pro Max at $1,250
materialssmartphonesAppleiPhone-17battery-technologydevice-designmobile-technologyScientists turn seafood waste into powerful CO2 adsorbent material
Researchers at the University of Sharjah in the UAE have developed an innovative method to convert shrimp waste—specifically shells, heads, and guts—into activated carbon capable of capturing carbon dioxide (CO₂). This process addresses two major environmental challenges simultaneously: managing the vast amounts of seafood waste generated globally (up to eight million tons annually) and mitigating climate change by reducing greenhouse gas emissions. The shrimp waste, sourced from Souq Al Jubail in Sharjah and originally from Oman, undergoes a multi-step treatment involving pyrolysis to create biochar, followed by acid treatment, chemical activation, and ball milling to produce a highly effective and stable CO₂ adsorbent. Beyond carbon capture, the activated carbon derived from shrimp waste has versatile applications including air and water purification, solvent recovery, gold extraction, and certain medical uses. The researchers emphasize that this approach exemplifies a circular economy by transforming problematic waste into a valuable resource, enhancing resource efficiency and sustainability. The study, published in the journal Nanos
energymaterialscarbon-captureactivated-carbonwaste-managementclimate-change-mitigationsustainable-materialsLab-grown oils promise deforestation-free future for food, cosmetics
The Paris-based biotech startup SMEY is pioneering lab-grown coconut, palm, and shea oils using AI-driven yeast fermentation, aiming to provide deforestation-free, traceable alternatives for food and cosmetics industries. By leveraging a “Neobank of Yeasts” comprising over 1,000 non-GMO yeast strains and machine learning to identify strains with precise lipid profiles, SMEY dramatically reduces oil production time from the traditional 18–24 months to about 30 days. This approach replaces plantation agriculture with bioreactors, eliminating the need for land, pesticides, fertilizers, and associated environmental harms such as deforestation, biodiversity loss, and labor abuses. The technology also promises localized supply chains and new formulations with improved shelf life and stability. SMEY’s innovation aligns with the European Union’s upcoming Deforestation Regulation, which imposes strict penalties on imports linked to deforestation, motivating brands to seek sustainable oil alternatives. The company is initially marketing Noyl Silk, a cultivated high-oleic butter
materialsbiotechnologylab-grown-oilssustainable-materialsAI-in-materials-sciencefermentation-technologydeforestation-free-materialsChina’s underground neutrino lab JUNO begins hunt for ghost particles
China’s Jiangmen Underground Neutrino Observatory (JUNO) officially began data collection on August 26, 2025, after more than a decade of development. Located 700 meters underground to shield it from cosmic rays, JUNO features a massive 35.4-meter diameter acrylic sphere filled with 20,000 tons of liquid scintillator. This detector is designed to capture faint flashes of light produced when antineutrinos interact with the liquid, with tens of thousands of photomultiplier tubes converting these signals into data for analysis. JUNO’s primary scientific goal is to resolve the long-standing mystery of neutrino mass ordering—determining which of the three neutrino types is heaviest or lightest—by precisely measuring the energy spectrum of antineutrinos. Beyond neutrino mass ordering, JUNO aims to deliver highly precise measurements of neutrino properties and explore a range of phenomena, including neutrinos from the Sun and supernovae, potential new neutrino types, and
materialsparticle-physicsneutrino-detectoracrylic-spherephotomultiplier-tubesliquid-scintillatorunderground-laboratoryTrump warns US could 'destroy China' over magnets with 200% tariff
Former U.S. President Donald Trump warned that the U.S. might impose steep tariffs—up to 200%—on China if Beijing restricts exports of rare-earth magnets, a critical component in various industries. Trump highlighted China’s near-monopoly on these magnets, which supply about 90% of the global market, and suggested that the U.S. holds stronger leverage through aerospace exports, citing Boeing’s aircraft sales to China as a key bargaining chip. He emphasized that tariffs would be a more powerful tool than magnets themselves and hinted at the potential to escalate trade pressure, though he claimed he would refrain from using the most severe measures. The comments came amid a fragile trade truce between the U.S. and China, agreed upon in June, which eased some export restrictions and reduced tariffs on both sides. Despite a recent rebound in China’s rare-earth magnet shipments to the U.S., supply chain vulnerabilities persist, as seen in production halts at companies like Ford and Tesla due to magnet shortages.
materialsrare-earth-magnetstrade-tariffsChina-US-tradesupply-chainaerospace-componentsrenewable-energy-materialsFrom Sawmill To Module: How Canada Can Scale A Low-Carbon Timber Value Chain - CleanTechnica
The article from CleanTechnica outlines Canada’s significant opportunity to develop a low-carbon mass timber value chain by integrating the entire process from forests to finished housing modules. Rather than simply expanding sawmill capacity, the strategy involves linking sawmills, energy systems, adhesives, logistics, and modular factories into a cohesive industrial ecosystem. According to the Transition Accelerator’s roadmap, this integrated approach could grow the Canadian mass timber market to $1.2 billion by 2030 and $2.4 billion by 2035, potentially capturing up to 25% of the global market. Achieving these targets requires addressing several critical bottlenecks in feedstock supply, energy-intensive drying processes, petrochemical-based adhesives, and carbon-heavy logistics. Key challenges include the mismatch between sawmill outputs and the specific lumber dimensions and moisture content needed for engineered wood products like cross-laminated timber (CLT), leading to supply shortages and higher costs. Drying lumber to the required moisture level is energy-intensive, often relying on
energymaterialssustainable-energytimber-industrybioenergymodular-constructionlow-carbon-materialsNew laser helps decode rare earth element samarium’s secret spectrum
Scientists at Johannes Gutenberg University Mainz and the Helmholtz Institute Mainz have developed an advanced laser-based technique, dual-comb spectroscopy (DCS), to uncover previously unknown atomic transitions in the rare earth element samarium. This method builds on the 2005 Nobel Prize-winning optical frequency comb technology and uses two synchronized comb lasers to measure atomic spectra across a broad electromagnetic frequency range with high resolution and sensitivity. By employing multiple photodetectors to enhance the signal-to-noise ratio, the team achieved ambiguity-free, high-precision measurements, enabling the detection of weak spectral signals that were previously difficult to resolve. The research revealed several new samarium absorption lines, highlighting the technique’s capability to expose hidden atomic properties. Samarium is vital for manufacturing high-performance samarium-cobalt permanent magnets used in electric vehicle motors and wind turbines, making these findings significant for both fundamental physics and applied materials science. This work also lays the foundation for “Spectroscopy 2.0,” a next-generation, massively parallel spect
materialsrare-earth-elementssamariumdual-comb-spectroscopyatomic-spectroscopypermanent-magnetsenergy-materialsMolten droplets in meteorites help date Jupiter’s planetary birth
A recent study by researchers from Japan’s Nagoya University and the Italian National Institute for Astrophysics (INAF) has dated Jupiter’s formation to approximately 1.8 million years after the solar system began. This breakthrough was achieved by analyzing chondrules—tiny, 0.1-2 millimeter molten rock droplets found in meteorites. The study’s computer simulations showed that Jupiter’s growing gravity caused high-speed collisions between water-rich planetesimals, vaporizing water and producing steam explosions that shattered molten rock into these droplets. These chondrules later cooled and became part of asteroids that eventually fell to Earth as meteorites. The research not only explains the long-standing mystery of chondrule formation but also links it directly to the birth of Jupiter. By correlating the timing of planetesimal collisions in their models with the ages of chondrules found in meteorites, the team pinpointed Jupiter’s formation during its rapid gas accumulation phase. This method provides a novel way to
materialsmeteoriteschondrulesplanetary-formationmolten-dropletssolar-systemJupiterHow Carney’s Housing Initiative Can Industrialize Canada’s Mass Timber Sector - CleanTechnica
Canada faces a severe housing affordability crisis intertwined with its climate commitments, as traditional construction methods using concrete and steel lock in high greenhouse gas emissions. Mark Carney’s Build Canada Homes initiative aims to address both issues by targeting the construction of 500,000 new homes annually using modular and mass timber (cross-laminated timber, CLT) methods. The initiative pairs this target with low-cost loans, equity support, and standardized design templates to promote faster, higher-quality, and more sustainable construction. However, past attempts at modular building in Canada have struggled due to focusing on detached homes, fluctuating demand, and slow, inconsistent municipal permitting processes. The article argues that for the initiative to succeed, the government must act as a stable, guaranteed buyer by issuing multi-year offtake contracts to modular and CLT factories, ensuring steady demand and high factory utilization. It should also publish pre-approved design templates for mid-rise multifamily housing (six to twelve storeys) and fast-track permitting for projects using
materialsmass-timbermodular-constructionprefabricationsustainable-buildinghousing-innovationclimate-targetsiPhone 17, the ‘thinnest iPhone ever,’ and everything else we’re expecting out of Apple’s hardware event
Apple is expected to hold its annual hardware event on September 9, unveiling the iPhone 17 lineup alongside updates to the Apple Watch and AirPods. The iPhone 17 series will include the iPhone 17, 17 Pro, and 17 Pro Max, with notable changes such as a slightly larger 6.3-inch screen on the base model, a 120Hz display, and a 24-megapixel front camera. The Pro models may feature a redesigned rear camera layout with three lenses arranged in a rectangular bar and a centered Apple logo. A significant material change is anticipated for the iPhone 17 Pro, potentially replacing the titanium band with aluminum to reduce cost and weight. The Pro Max model is expected to be thicker to accommodate a larger battery. Pricing rumors suggest the base iPhone 17 will start around $800, the Pro at $1,050, and the Pro Max at $1,250, with fewer storage options available compared to the previous generation.
materialssmartphonesAppleiPhone-17battery-technologydevice-designmobile-technologyCanada’s Timber Moment: CLT As The Fastest Lever for Housing, Jobs, & Climate - CleanTechnica
The article highlights Canada’s urgent need to address two converging crises: a chronic housing shortage and the construction sector’s significant greenhouse gas emissions, particularly from embodied carbon in materials like cement and steel. Traditional site-built construction is insufficient to meet the growing demand for housing, with annual completions far below the 500,000 units needed to stabilize affordability. Additionally, the heavy reliance on concrete and steel in mid-rise residential buildings locks in millions of tons of carbon emissions before occupancy, exacerbating climate challenges. Cross laminated timber (CLT), combined with modular manufacturing, is presented as the fastest and most effective solution to simultaneously increase housing supply, create jobs, and reduce carbon emissions. CLT is a renewable, carbon-storing material that enables industrialized, factory-based production of housing components, significantly accelerating construction timelines by 30 to 50%. This approach transforms housing delivery from a labor-intensive craft into a scalable manufacturing process. Initiatives like Mark Carney’s Build Canada Homes plan and the Transition Accelerator’s
energymaterialscross-laminated-timbermodular-constructionembodied-carbonsustainable-housingclimate-changeTwo-Thirds Of River Trash Is Plastic (Research) - CleanTechnica
A recent study from the University of California–Santa Barbara highlights the alarming extent of plastic pollution in rivers worldwide, estimating that 1.95 million metric tons of plastic—equivalent to the weight of 5.3 Empire State Buildings—flow through rivers annually. This plastic originates primarily from mismanaged waste, including littering, illegal dumping, and leakage from inadequately controlled landfills. Much of this waste is mobilized by rain and wind, traveling from distant locations through urban drainage systems into rivers. The research emphasizes that nearly all everyday plastics are derived from fossil fuels, and only about 10% of plastic waste is recycled globally, underscoring significant gaps in waste management infrastructure. The study also discusses the environmental and human health impacts of riverine plastic pollution. Plastic debris harms river ecosystems by entangling and poisoning wildlife, smothering habitats, and transporting invasive species and pathogens. It also poses risks to human communities by contaminating food sources with microplastics, blocking drainage systems which
materialsplastic-pollutionwaste-managementrecyclingfossil-fuelsenvironmental-researchriver-pollutionThe Trump administration’s big Intel investment comes from already awarded grants
The Trump administration announced an $8.9 billion investment in Intel, which the company described as government funds previously awarded but not yet disbursed, rather than new funding. This amount includes $5.7 billion from the Biden administration’s CHIPS Act and $3.2 billion from the Secure Enclave program. Despite President Trump’s claim that the U.S. paid nothing for these shares and his characterization of the deal as beneficial for both America and Intel, the funds are essentially government grants being converted into equity. Trump has been critical of the CHIPS Act and urged House Speaker Mike Johnson to repeal it. Intel had already received $2.2 billion in CHIPS Act funding and requested an additional $850 million reimbursement that had not yet been paid. Some legal experts question whether the CHIPS Act permits the government to convert grants into equity, suggesting potential legal challenges to the deal. Trump also previously accused Intel CEO Lip-Bu Tan of conflicts of interest, though he later praised Tan for negotiating
materialssemiconductorchip-manufacturingCHIPS-ActIntelgovernment-grantstechnology-investmentNew acetone breath test could offer quicker diabetes screening
Researchers at Penn State have developed a novel graphene-based breath sensor that can rapidly and inexpensively detect diabetes and prediabetes by measuring acetone levels in exhaled breath. The device uses a combination of laser-induced porous graphene and zinc oxide to selectively identify acetone, a biomarker linked to diabetes risk when present above 1.8 parts per million. Unlike traditional diabetes tests that require blood draws or lab visits, this sensor provides results within minutes by simply exhaling into a bag and dipping the sensor, eliminating the need for induced sweat or complex lab analysis. The sensor’s design overcomes challenges such as moisture interference by incorporating a membrane that blocks water molecules while allowing acetone to pass through, enhancing detection accuracy. Currently, the test requires breath collection in a bag to avoid environmental airflow disruption, but future iterations aim to enable direct detection under the nose or inside a mask. Beyond diabetes screening, the researchers envision broader health applications by tracking acetone fluctuations related to diet and exercise. The study,
materialsgraphenesensor-technologydiabetes-detectionzinc-oxidebreath-analysishealth-monitoringPulsed electricity makes copper better at CO2 fuel conversion
Scientists from the Fritz Haber Institute have developed a novel method to enhance copper’s ability to convert carbon dioxide (CO2) into valuable fuels such as ethylene and ethanol by applying pulsed electric potential treatments to copper single crystal surfaces. This approach involves alternating anodic (oxidizing) and cathodic (reducing) pulses, which induce dynamic structural and chemical changes on the copper surface. Specifically, the anodic pulses create unique inverted pyramid-like surface structures and generate a thin (~1 nm) Cu(I) oxide layer, while the cathodic pulses help stabilize these features. These transformations improve the catalytic efficiency and allow tunable selectivity in CO2 conversion, as revealed through advanced spectro-microscopy techniques (LEEM/XPEEM) that provide spatial and chemical resolution of the surface changes. The research offers a promising pathway for sustainable energy solutions by enabling more efficient reutilization of CO2, a major greenhouse gas, into renewable hydrocarbons and alcohols. By closing the carbon cycle through
energymaterialscopper-catalystCO2-conversionrenewable-fuelselectrochemical-treatmentsustainable-energyThe next Starship flight will test much more than hardware
SpaceX is preparing for its next Starship test flight from South Texas, aiming to recover from a series of recent setbacks including the breakup of the upper stage during reentry and the booster’s explosion during landing attempts. The last flight, nearly three months ago, marked progress but ended with significant losses. Subsequent ground testing mishaps forced hardware replacements and delayed the program. The Federal Aviation Administration has cleared investigations related to the previous flight, allowing SpaceX to proceed. This upcoming flight is critical not only for testing hardware but also for demonstrating SpaceX’s ability to learn from failures and achieve new milestones in its iterative “build-fly-fix-repeat” development approach. Starship remains central to SpaceX’s long-term ambitions, including NASA’s Artemis program, which relies on a Starship variant to return astronauts to the Moon by mid-2027. To meet this goal, SpaceX must perfect several challenging technologies such as the reusable heat shield, in-orbit cryogenic propellant transfer, and lunar
materialsenergyspace-technologyreusable-rocketsaerospace-engineeringSpaceXStarshipWrinkled 2D sheets may unlock faster, more efficient devices
Researchers at Rice University have discovered that tiny wrinkles in two-dimensional (2D) materials, such as molybdenum ditelluride, can precisely control electron spin, a quantum property that could revolutionize computing. Unlike traditional devices that rely on electron charge, spintronics uses electron spin states ("up" or "down") to process information, potentially enabling faster, smaller, and more energy-efficient devices. A major challenge in spintronics has been the rapid decay of spin information due to electron scattering, but the Rice team found that bending 2D materials creates a unique spin texture called a persistent spin helix (PSH), which preserves spin states even amid collisions. This effect arises from the flexoelectric polarization generated by uneven strain when the 2D sheet is bent—stretching on one side and compressing on the other—creating internal electric fields that split spin-up and spin-down electrons into distinct bands. The curvature-induced interaction is strongest in highly curved regions like wrinkles or
materials2D-materialsspintronicsenergy-efficient-deviceselectron-spinquantum-computingflexoelectric-polarizationDeep-sea mining dilemma: Powering green tech at the cost of ocean life
The article discusses the complex dilemma posed by deep-sea mining, particularly the extraction of polymetallic nodules from the Clarion-Clipperton Zone (CCZ) in the Pacific Ocean. These nodules, rich in critical metals like nickel, copper, and manganese, are essential for manufacturing batteries and renewable energy technologies, with global demand expected to surge by 2040. Proponents argue that harvesting these nodules could stabilize supply chains and reduce reliance on environmentally damaging and ethically problematic land-based mining. The mining process involves a sophisticated system operating 4,000 meters below the ocean surface, using a robotic collector to vacuum nodules from the seafloor, which are then transported to the surface for processing. However, scientists and environmentalists warn that deep-sea mining could irreversibly damage fragile ecosystems that have developed over millions of years. The seabed habitats, including newly discovered species like the gelatinous "gummy squirrel" sea cucumber, depend on the nodules for survival.
energymaterialsdeep-sea-miningpolymetallic-noduleselectric-vehiclesrenewable-energybattery-materialsFolding spacecraft design could be enhanced with origami patterns
Researchers at Brigham Young University have developed a new class of origami-inspired structures called bloom patterns, designed to fold flat and unfold like flower petals. These radially expansive, flat-foldable patterns offer a compact and reliable way to deploy large structures in space, such as antennas, telescopes, solar arrays, and optical devices. The study, published in the Proceedings of the Royal Society A, introduces a standardized mathematical framework for creating these crease patterns and demonstrates their consistent and reliable unfolding—critical for space missions where a single misfold could cause failure. Beyond space applications, bloom patterns show promise for terrestrial uses including portable shelters, pop-up architecture, and expandable robotics. Their rotational symmetry and circular shape provide enhanced structural stability compared to other fold patterns. The research team also created physical prototypes using materials like 3D printed plastics and cardboard, and developed a computer program to generate crease patterns for specific bloom designs such as the Yoshimura pattern. This work lays the foundation for further exploration of the mechanical
materialsorigami-designspacecraft-technologydeployable-structuressolar-arraysantennas3D-printed-plasticsWorld’s Smallest Cat 🐱✨
The article highlights a groundbreaking scientific achievement where researchers have created the world’s smallest "cat," not a living feline but a single rubidium atom precisely arranged using lasers and artificial intelligence. This atomic-scale creation symbolizes the cutting-edge advancements in quantum technology, showcasing the ability to manipulate individual atoms with extraordinary accuracy. This feat is more than a novelty; it represents a significant step toward the future of quantum computing. By controlling atoms at such a fine level, scientists aim to develop quantum machines capable of processing information far beyond the capabilities of current computers. The work underscores the potential of combining laser technology and AI to push the boundaries of quantum mechanics and computing innovation.
materialsquantum-computingAIlasersatomic-manipulationquantum-technologyprecision-engineeringChina develops cement that can cool itself by scattering heat
Researchers from Southeast University in China have developed a novel "supercool" cement that significantly reduces surface temperature by scattering sunlight rather than absorbing it. This cement, engineered with metasurfaces and a photonic architecture, achieves a high solar reflectance of 96.2% and an emissivity of 96% in the mid-infrared spectrum, enabling it to cool itself by radiative heat dissipation. Performance tests demonstrated the material’s robustness against mechanical stresses, abrasive forces, and harsh environmental conditions such as UV radiation, corrosive liquids, and freeze-thaw cycles. The cement also maintains plasticity for complex shapes and amphiphobic properties, making it versatile for structural applications in roofs and walls. The researchers adjusted the chemical composition of clinker particles to promote the self-assembly of reflective ettringite crystals and hierarchical pores, enhancing sunlight scattering and heat emission. Real-world testing on building roofs showed that the supercool cement could reduce surface temperatures by up to 9.72°F (5.
materialscementradiative-coolingmetasurfacessustainable-building-materialscarbon-emission-reductionphotonic-architectureFirst protein-based quantum bit could change biological research
Researchers at the University of Chicago Pritzker School of Molecular Engineering have developed the first protein-based quantum bit (qubit) by converting a living cell protein—enhanced yellow fluorescent protein (EYFP)—into a functional qubit. Unlike traditional quantum sensors that require extremely cold, controlled environments, this protein qubit operates effectively within the warm, noisy environment of living cells. The team demonstrated that the protein qubit exhibits quantum behaviors such as spin coherence and optically detected magnetic resonance, and can be initialized, manipulated with microwaves, and read out using light inside living cells. This breakthrough challenges the long-held belief that quantum phenomena cannot survive in biological systems and opens new possibilities for biological research. Although the protein qubits are currently less sensitive than diamond-based quantum sensors, their ability to be genetically encoded directly into living cells offers a unique advantage. This capability could enable unprecedented observation of biological processes at the molecular level, such as protein folding and early disease stages, potentially leading to quantum-enabled nanoscale MRI
materialsquantum-computingprotein-qubitquantum-sensormolecular-engineeringbiological-researchquantum-technologyIndia tests 3,000-mile nuclear missile that can hit China, Europe
India successfully test-fired its Agni-5 ballistic missile on August 20, 2025, marking a significant advancement in its long-range nuclear strike capabilities. The missile, with a range of approximately 3,100 miles (5,000 kilometers), can target nearly all of China and parts of Europe. Developed by the Defense Research and Development Organisation (DRDO), the Agni-5 features a three-stage solid-fuel propulsion system and lightweight composite motor casings, enhancing its range and efficiency. This missile is the longest-range weapon in India’s operational arsenal and serves as the backbone of its nuclear deterrence strategy. The test also highlights India’s progress in Multiple Independently Targetable Reentry Vehicle (MIRV) technology, demonstrated in a prior flight test of an Agni-5 MIRV variant called Mission Divyastra. MIRV capability allows a single missile to carry multiple warheads aimed at separate targets, complicating missile defense efforts and placing India among a select group of nations
materialsenergydefense-technologymissile-technologynuclear-propulsioncomposite-materialssolid-fuel-propulsionBreaking Rules but Not Waves: Plasmons in Correlated Materials - CleanTechnica
A recent study led by researchers from the National Renewable Energy Laboratory (NREL) and collaborators worldwide has revealed that hybrid plasmon-polaritons (HPPs)—waves formed by the coupling of plasmons and light—can persist for an exceptionally long time in strongly correlated materials known as "bad" metals. These materials, characterized by intense electron interactions and incoherent electron motion, were previously thought to be unfavorable for sustaining such collective charge waves. The team focused on molybdenum dichloride dioxide (MoOCl2), a bad metal where electron behavior is chaotic, and discovered that HPPs remain stable and propagate effectively even at room temperature, surviving for up to 10 oscillation cycles—longer than in any known crystal. This finding challenges conventional understanding by demonstrating that coherent plasmonic excitations can exist in systems with high resistance and electron incoherence. The research utilized advanced imaging techniques and theoretical models to explain the dielectric response responsible for plasmon creation and longevity. Unlike
materialsplasmonicscorrelated-materialsmolybdenum-dichloride-dioxidehybrid-plasmon-polaritonselectronic-propertiesenergy-researchInjection-based drug delivery may replace cancer infusion drips
A Stanford research team has developed a novel drug delivery platform that could transform cancer and autoimmune disease treatments by replacing lengthy intravenous (IV) infusions with quick, high-concentration injections that patients can self-administer at home. The innovation centers on a specially designed polyacrylamide copolymer called MoNi, which stabilizes protein-based drugs at concentrations exceeding 500 mg/mL—more than double typical levels—without causing clumping or loss of efficacy. This is achieved by spray-drying protein molecules coated with MoNi into fine, glassy microparticles that remain stable under stress, including freeze-thaw cycles and high temperatures, and can be smoothly injected through tiny needles. The technology has been successfully tested on proteins such as albumin, human immunoglobulin, and a COVID antibody treatment, demonstrating broad applicability across biologic drugs. MoNi’s mechanical properties, rather than the chemical nature of the proteins, enable this versatility. Preclinical studies have shown no adverse effects, and the platform
materialsdrug-deliveryprotein-stabilitypolymer-sciencebiomedical-engineeringcancer-treatmentpharmaceutical-technologyGroup14 lands $463M from SK, Porsche, and others to make silicon anodes for EVs
Group14, a battery materials startup specializing in silicon anode technology, has secured $463 million in a funding round led by battery manufacturer SK, with participation from Porsche, ATL, Lightrock, and Microsoft. This investment aims to expand Group14’s manufacturing capabilities and underscores continued investor confidence in the electric vehicle (EV) market, which is projected to grow over 15% annually and quintuple in size over the next decade. Group14 produces silicon anode materials that significantly enhance lithium-ion battery storage capacity, addressing the limitations of traditional graphite anodes. Silicon is considered a promising alternative to graphite because it can hold up to ten times more electrons, potentially increasing battery energy density by up to 50% and reducing fast-charging times to under 10 minutes. However, silicon anodes typically suffer from structural degradation due to expansion and contraction during charge cycles. Group14 overcomes this challenge by engineering a scaffold material with internal voids that accommodate silicon’s expansion, maintaining anode integrity. This
energymaterialslithium-ion-batteriessilicon-anodeselectric-vehiclesbattery-technologyenergy-storageFossil-free plastics production to start with sustainable polymer tech
The world’s first industrial-scale fossil-free plastics production complex is set to be built in Belgium by Vioneo, utilizing Lummus Technology’s sustainable polymer technology. The facility will have a capacity of 200,000 tons per annum (KTA) and will produce fossil-free polypropylene grades using 100% segregated green propylene and ethylene derived from industrially proven Methanol-To-Olefins technology. The plant aims to be highly electrified with renewable electricity and incorporate renewable hydrogen, resulting in fully traceable, CO2-negative plastics that help customers reduce their Scope 3 emissions. Vioneo’s collaboration with Lummus includes licensing the Novolen polypropylene polymerization technology, which is part of Lummus’ Verdene suite designed for sustainable polymer production from bio-feedstocks. This technology enables the production of high-performance, drop-in bio-polypropylene grades that function identically to traditional fossil-based polymers but with significantly reduced or net-negative carbon emissions due to CO2 sequestration in the
energymaterialssustainable-polymersfossil-free-plasticsrenewable-hydrogengreen-methanolpolypropylene-technologyAustrian hook-and-loop fastener to cut building repair costs
Scientists at Graz University of Technology (TU Graz) in Austria have developed an innovative hook-and-loop fastening system designed to reduce construction waste and facilitate easier building repairs and adaptations. Inspired by Velcro, this 3D-printed fastener incorporates mushroom-shaped hooks directly into building components such as concrete, wood, or paper-based materials, enabling secure yet reversible connections. This allows structural elements like floors, interior walls, and installations to be swapped or upgraded without demolition, significantly extending a building’s service life and reducing material consumption. The fastener has demonstrated tensile strength comparable to industrial fasteners in laboratory tests, with future production methods like injection molding or stamped metal expected to enhance performance further. Primarily intended for indoor use on non-load-bearing walls and components housing wiring or plumbing, the system supports more sustainable construction practices by enabling selective replacement of worn or outdated parts. Complementing this, the ReCon project team also developed a digital tagging system using embedded RFID chips and QR codes to track material composition and installation data
materialsconstruction-technologysustainable-building3D-printingfastenersbuilding-repairconstruction-waste-reductionSchrödinger’s cat video made with 2,024 atoms in quantum breakthrough
A team of physicists from the University of Science and Technology of China has created what is described as the "world’s smallest cat video," depicting Schrödinger’s cat thought experiment using just 2,024 rubidium atoms. This quantum-level visualization uses optical tweezers—focused laser beams—to precisely manipulate individual atoms within a 230-micron-wide array. Machine learning algorithms enable real-time calculations that direct the lasers to rearrange all atoms simultaneously in just 60 milliseconds, a significant improvement over previous methods that moved atoms one by one. The glowing atoms form images representing key moments of the Schrödinger’s cat paradox, illustrating the concept of superposition where a particle exists in multiple states simultaneously. This breakthrough addresses a major bottleneck in neutral-atom quantum computing by enabling rapid, defect-free assembly of large atom arrays with high accuracy—reported as 99.97% for single-qubit operations and 99.5% for two-qubit operations. The technique is highly scalable, maintaining
materialsquantum-computingmachine-learningoptical-tweezersrubidium-atomsAIquantum-technologyUltrasonic device reduces sea sand salt to 0.04% for construction
The Korea Institute of Ocean Science & Technology (KIOST) has developed an innovative ultrasonic washing device designed to remove salt from sea sand, addressing a critical challenge in the construction industry. With river sand supplies dwindling due to environmental restrictions and overextraction, sea sand has become a necessary alternative. However, its high salt content poses a risk of corrosion to steel reinforcements in concrete, compromising structural safety. The ultrasonic device uses cavitation-driven washing with ultrasonic waves to efficiently reduce salt levels to 0.04% or below—the maximum recommended by the Ministry of Land, Infrastructure and Transport—while using significantly less water than traditional methods. This technology offers both practical and economic benefits by accelerating the desalination process and reducing water consumption, making it more sustainable and feasible for large-scale construction needs. The process involves mixing sea sand with water at a 1:2 ratio and applying ultrasonic energy of 300W or higher for three minutes, achieving rapid and precise salt removal even in confined spaces.
materialsultrasonic-technologyconstruction-materialsdesalinationsustainable-constructionsand-washingcorrosion-preventionNew off-road vehicle blends dune buggy fun with rally car features
Meyers Manx and Tuthill have collaborated to create the LFG, a new off-road vehicle unveiled at Monterey Car Week 2025 that blends the playful style of a dune buggy with the rugged capabilities of a rally car. The LFG features a lightweight yet strong carbon fiber body, a built-in rollover protection system meeting both motorsport and recreational standards, and advanced suspension with adjustable dampers and hydraulic bump stops for versatile terrain handling. It offers multiple engine options, including a four-valve Tuthill K-based engine paired with a six-speed sequential gearbox and a sophisticated four-wheel-drive system with three limited-slip differentials to maintain traction on diverse surfaces. The vehicle’s interior emphasizes comfort and adaptability, with climate control and a cabin that can be converted from enclosed to open-air by removing the roof and doors in two minutes. It also includes a satellite-based GPS navigation system for off-grid travel. The LFG’s exhaust system is made from durable Inconel, and its fuel tank
materialsoff-road-vehiclescarbon-fiberInconeldrivetrainsuspension-systemautomotive-engineeringWater-cooled computer looks like a Victorian machine on the wall
The article highlights a unique steampunk-inspired, water-cooled computer built by modder Felix Ure of Billet Labs, known for combining Victorian-era aesthetics with high-performance PC hardware. This wall-mounted PC resembles a vintage time machine, featuring brass and copper plumbing that serves both as an artistic element and an efficient custom water-cooling loop. The open-air design showcases every component, with analog dials and industrial-grade fans enhancing the retro, industrial character. The build started from a metal-backed panel to support heavy components and elaborate cooling, with meticulous placement ensuring a balanced and symmetrical appearance. Inside, the system boasts top-tier hardware including an AMD Ryzen 9 9950X CPU, NVIDIA GeForce RTX 3090 Ti GPU, 64GB RAM, 8TB storage, and a B650 EI motherboard, making it capable of demanding tasks like 4K video editing and 3D scanning. The cooling system features hand-soldered copper pipes and a reservoir, supported by four high
materialscooling-technologywater-coolingcomputer-hardwarecustom-PC-buildsteampunk-designthermal-managementUS scientists create reusable 'jelly ice' that never melts
US scientists at the University of California, Davis have developed a reusable, compostable cooling material called “jelly ice” that mimics the cooling properties of regular ice without melting into a watery mess. Inspired by frozen tofu’s ability to retain water and gelatin’s hydrogel structure, the team created jelly ice from natural polymers that trap water even through freeze-thaw cycles. Jelly ice is about 90% water, can be molded into various shapes, and offers up to 80% of the cooling efficiency of regular ice. It remains firm below freezing and becomes soft and jiggly at room temperature, allowing easy reuse by rinsing and refreezing. Jelly ice addresses problems associated with melting ice, such as contamination and dilution, making it particularly useful in food storage and shipping, including seafood and medical supplies. It is compostable and has shown potential benefits for plant growth when composted, without contributing to microplastic pollution. While licenses for the technology have been secured, further market analysis and
materialsreusable-materialshydrogelsbiopolymerscompostable-materialscooling-technologyfood-safe-materialsSelf-powered microneedle patch monitors biomarkers without blood
Researchers have developed a self-powered microneedle patch that enables painless, blood-free collection of health biomarker samples from dermal interstitial fluid (ISF) just below the skin’s surface. Unlike traditional blood tests, which require needles and complex processing to isolate relevant fluids, this patch uses microneedles that swell upon contact with ISF, drawing the fluid into a paper layer where it is stored. The patch can collect and store biomarkers for up to 24 hours, allowing for easier and faster health monitoring without the need for batteries or external devices. In proof-of-concept tests on synthetic skin, the patch successfully measured cortisol, a stress biomarker, within 15 minutes, demonstrating potential for frequent, noninvasive monitoring of various health indicators. Made from inexpensive materials, the patch eliminates the need for phlebotomists and blood collection supplies, potentially transforming home and clinical diagnostics. The research team is advancing human trials and developing electronic readers to analyze the collected samples, seeking industry
materialsenergy-harvestingwearable-technologybiosensorshealth-monitoringmicroneedlesself-powered-devicesiPhone 17, the ‘thinnest iPhone ever,’ and everything else we’re expecting out of Apple’s hardware event
Apple is expected to hold its hardware event on September 9, unveiling the iPhone 17 lineup alongside updates to the Apple Watch and AirPods. The iPhone 17 series will include the standard 17, 17 Pro, and 17 Pro Max models, with notable changes such as a slightly larger 6.3-inch screen on the base model and a 120Hz display, up from 60Hz. The front camera is rumored to be upgraded to 24 megapixels, and new colors like purple and green may be introduced. The Pro model might feature a redesigned rear camera layout with a rectangular bar spanning the phone’s width, and a shift from a titanium to an aluminum frame to reduce weight and cost. The Pro Max is expected to have fewer upgrades but could include a thicker body to house a larger battery. Pricing is anticipated to start around $800 for the iPhone 17, $1,050 for the Pro, and $1,250 for the Pro Max,
materialssmartphonesiPhone-17Apple-hardwarebattery-technologydisplay-technologymobile-device-designThe wait is almost over: The 2025 Startup Battlefield 200 list drops August 27
TechCrunch is set to announce the 2025 Startup Battlefield 200 list on August 27 at 9:00 a.m. PT, featuring a curated selection of the most promising early-stage startups worldwide. These startups will compete at TechCrunch Disrupt 2025, taking place October 27–29 in San Francisco, marking the event’s 20th anniversary. The Startup Battlefield has historically launched major tech companies such as Dropbox, Cloudflare, Fitbit, and Discord, and this year’s cohort is expected to continue that legacy. The Top 20 finalists from the Battlefield 200 will be revealed on the first day of Disrupt, where they will compete live for a $100,000 prize and the Disrupt Cup. Last year’s winner, Salva Health, gained attention for its portable breast cancer detection device aimed at underserved rural populations, exemplifying the kind of innovative solutions showcased in the competition. Runner-up geCKo Materials also impressed with its breakthrough adhesive technology disrupting the Velcro
materialsadhesive-materialsstartup-innovationtech-startupsbreakthrough-materialsVelcro-industrydisruptive-technologyMelting ice races faster than Death Valley rocks on new lab surface
Researchers at Virginia Tech, led by Professor Jonathan Boreyko, have engineered a specially designed aluminum surface that causes melting ice discs to self-propel rapidly across it. The surface features asymmetric, arrowhead-shaped grooves with a herringbone pattern that direct the flow of meltwater, effectively carrying the ice disc forward without external forces like wind. This phenomenon was inspired by the natural mystery of "sailing stones" in Death Valley's Racetrack Playa, where rocks move across flat ground due to ice rafts propelled by wind and melting water. A surprising discovery emerged when the team applied a water-repellent coating to the grooved plates. Instead of facilitating faster movement, the ice disc initially stuck to the surface, creating a "slingshot effect." Meltwater pooling on one side of the ice disc generates a surface tension imbalance that suddenly dislodges and propels the ice at high speed, making it move much faster than the Death Valley rocks. This breakthrough has potential applications in rapid defrost
energymaterialsenergy-harvestingice-propulsionsurface-engineeringdefrosting-technologybiomimicryScientists discover oxygen 'breathing' crystal for clean energy tech
Scientists from Pusan National University in South Korea and Hokkaido University in Japan have developed a novel metal oxide crystal composed of strontium, iron, and cobalt that can "breathe" oxygen by repeatedly releasing and reabsorbing it when heated in a simple gas environment. This oxygen-breathing ability is reversible and occurs under mild conditions without degrading the crystal’s structure, overcoming limitations of previous materials that required extreme environments or were too fragile. The discovery, published in Nature Communications, holds promise for advancing clean energy technologies such as solid oxide fuel cells, as well as smart thermal devices and energy-efficient smart windows that can dynamically regulate heat flow. The crystal’s stable structure and selective cobalt reduction allow it to maintain consistent performance over many oxygen absorption-release cycles, making it practical for real-world applications. According to the researchers, this breakthrough could enable innovations like thermal transistors that control heat flow similarly to electrical switches, contributing to smarter, more sustainable buildings and devices. The findings mark a significant step toward
materialsclean-energysolid-oxide-fuel-cellssmart-windowsoxygen-breathing-crystalenergy-efficient-buildingsthermal-transistorsChina's ‘ionic glass’ method turns brains and hearts transparent
Chinese researchers have developed a novel "ionic glass" technique that renders whole organs, such as brains and hearts, transparent while preserving their fine structure and shape. Unlike existing tissue-clearing methods that often distort or damage samples, this approach uses ionic liquids—solvents liquid below 100°C—that infiltrate organs to create an “ionic glassy state.” This state maintains tissue integrity without expansion, shrinkage, or ice crystal formation during cold storage. Additionally, the method significantly enhances fluorescent dye signals by 2 to 30 times, enabling clearer visualization of subtle cellular details like rare proteins and neuron connections. The breakthrough has major implications for biomedical research and precision medicine, as it allows for highly accurate 3D imaging and mapping of entire organs at microscopic resolution. The team demonstrated the technique’s utility by examining human neuron micro-connectivity and comparing it to non-human brains, revealing functional differences. Beyond neuroscience, the method could be applied broadly to various organs, aiding in disease marker detection and potentially advancing AI-driven
materialsionic-liquidstissue-transparencybiomedical-imagingorgan-preservationfluorescent-dyes3D-imagingUltracold cesium atoms challenge rules of physics, refuse to heat up
Researchers at the University of Innsbruck have demonstrated that ultracold cesium atoms can defy the expected process of thermalisation, where systems typically absorb energy and lose order by heating up. By cooling about 100,000 cesium atoms to just billionths of a degree above absolute zero and confining them in one-dimensional microscopic tubes, the team subjected the atoms to repeated laser pulses intended to jolt and heat them. Contrary to classical expectations, after an initial period, the atoms’ momentum distribution ceased to spread even after hundreds of energy kicks, effectively freezing into a stable quantum state with nearly identical velocities rather than dispersing chaotically. This discovery challenges a fundamental assumption in physics that interacting many-particle systems inevitably thermalise and lose coherence. It confirms longstanding theoretical predictions that quantum effects can protect such systems from heating and entropy increase, a phenomenon difficult to observe experimentally due to the complexity of many-body interactions. The ability to prevent thermalisation is crucial for advancing quantum technologies like sensors, memories,
materialsquantum-physicsultracold-atomsentropythermalisationquantum-coherenceenergy-flowAncient humans moved diverse stones over substantial distances: Study
A recent study led by the Smithsonian’s National Museum of Natural History has uncovered a 2.6 million-year-old Oldowan stone toolkit in southwestern Kenya that provides the earliest evidence of ancient humans transporting diverse raw materials over distances exceeding six miles. This finding pushes back the timeline for long-distance resource transport by 600,000 years, indicating that early hominins possessed advanced planning abilities and mental mapping skills to source high-quality stones far from their habitation sites. The toolkit, found in Nyayanga, includes tools used for butchering large animals, highlighting the role of stone tools in expanding dietary options and enhancing adaptability during this early stage of human cultural development. The research emphasizes that these early humans did not merely create tools but intentionally moved raw materials to “homebases” for tool production, demonstrating foresight and complex behavior previously thought to have evolved much later. Unlike nonhuman primates, who transport food and rocks over shorter distances, these hominins exhibited a significant milestone in human evolution by carrying
materialsstone-toolshuman-evolutionarchaeologyancient-technologyOldowan-toolkitprehistoric-toolsAncient humans moved diverse stones over substantial distances: Study
A recent study led by the Smithsonian’s National Museum of Natural History has uncovered a 2.6 million-year-old Oldowan stone toolkit in southwestern Kenya, revealing that early humans transported diverse stone materials over distances exceeding six miles. This finding pushes back the evidence of long-distance resource transport by hominins by approximately 600,000 years. Unlike previous assumptions that longer transport distances were a more recent evolutionary development, this discovery shows that early toolmakers had the knowledge and intent to carry high-quality raw materials to resource-rich locations, indicating advanced planning and forward thinking. The study, published in Science Advances, highlights that these early humans used stone tools not only for crafting but also for butchering large animals, suggesting a wide range of activities that enhanced their adaptability. Researchers emphasize that the ability to transport resources marks a major milestone in human evolution, reflecting mental mapping skills and strategic behavior. The toolkit from Nyayanga, Kenya, provides a significant snapshot of early human cognitive and cultural development, demonstrating that ancient
materialsstone-toolsancient-technologyhuman-evolutionarchaeologyraw-materialsOldowan-toolkitScientists observe new quantum behavior in superconducting material
Researchers have observed novel quantum behavior in the chromium-based kagome metal CsCr₃Sb₅, marking a significant advance in understanding superconductivity. Kagome metals feature a distinctive lattice geometry of corner-sharing triangles, which theoretically can host flat electronic bands—compact molecular orbitals that influence electron behavior. Unlike most kagome materials where these flat bands lie too far from active energy levels, in CsCr₃Sb₅ the flat bands actively participate in shaping the material’s superconducting and magnetic properties. This discovery confirms theoretical predictions and opens a pathway for engineering exotic superconductivity through precise chemical and structural control. The study, led by scientists from Rice University and Taiwan’s National Synchrotron Radiation Research Center and published in Nature Communications, combined advanced experimental techniques such as angle-resolved photoemission spectroscopy (ARPES) and resonant inelastic X-ray scattering (RIXS) with theoretical modeling. These methods revealed distinct signatures of the flat bands and their role in magnetic excitations, demonstrating
materialssuperconductivityquantum-materialskagome-latticeelectron-behaviorcondensed-matter-physicsadvanced-synthesis-techniquesNew method recovers 90% of key rare-earth elements from used magnets
Researchers at Kyoto University have developed an innovative recycling method called the selective extraction–evaporation–electrolysis (SEEE) process to recover rare-earth elements (REEs) from used magnets, particularly those containing neodymium (Nd) and dysprosium (Dy). These REEs are critical for high-performance magnets used in green technologies such as electric vehicles and wind turbines. The SEEE process demonstrated high efficiency, recovering 96% of neodymium and 91% of dysprosium, both with purities exceeding 90%. This method offers a more sustainable alternative to traditional mining and hydrometallurgical recycling, which are often environmentally damaging or energy-intensive. The SEEE process involves three stages: selective extraction using a molten salt mixture to isolate REEs from magnet scraps; selective evaporation to remove byproducts and concentrate the rare-earth elements; and selective electrolysis to separate and recover the metals in high-purity metallic form based on their distinct electrochemical potentials. This approach not
materialsrare-earth-elementsrecyclingsustainable-technologyelectric-vehiclesgreen-technologyhigh-performance-magnetsPistol-sized vacuum tube in China's lab could boost radar tech
Chinese scientists have developed a miniaturized traveling-wave tube (TWT) that could significantly advance electronic warfare and radar technologies. This pistol-sized vacuum tube, created by a team led by Shi Xuechun at the Beijing Vacuum Electronic Research Institute, amplifies microwave pulses between 8 and 18 gigahertz with over 500 watts of output. Notably, the device is less than half the thickness of comparable Western models at just 20 millimeters tall, enabling easier integration into next-generation phased array radar systems, which require hundreds or thousands of such components. The TWT operates by synchronizing an electron beam with a slowed radio frequency (RF) field inside a cylindrical structure containing an electron gun, helix, and collector. This design allows for wide bandwidth amplification critical to radar, satellite communication, and microwave links. According to the researchers’ peer-reviewed June 2025 publication, the miniaturized TWT improves bandwidth, power output, and efficiency, enhancing detection range and accuracy for
materialsenergymicrowave-technologyvacuum-tuberadar-technologyelectronic-warfarecommunication-technologyCIA’s Kryptos mystery solution heads to auction after 35 years
The CIA’s Kryptos sculpture, a cryptographic artwork created by Jim Sanborn and installed at the agency’s Langley headquarters in 1990, is nearing the end of its decades-long mystery. While the first three of its four coded panels have been solved, the final panel, known as K4, has resisted all decoding attempts despite limited hints from Sanborn. In November 2025, Sanborn plans to auction the handwritten plaintext solution to K4, along with related papers and a copper proof-of-concept plate, with an expected winning bid between $300,000 and $500,000. Sanborn hopes the buyer will maintain the secret and potentially oversee future verification of code-breaking attempts. Over the years, Kryptos has attracted thousands of solvers, including persistent individuals and renewed interest fueled by popular culture references such as Dan Brown’s novels. However, the rise of artificial intelligence has led to many inaccurate attempts, which partly motivated Sanborn’s decision to sell the final solution. Pro
materialssculpturecoppercryptographyart-installationcodebreakingauctionMIT study could help predict graphite lifespan in nuclear reactors
A recent MIT study has advanced understanding of how graphite, a critical material in nuclear reactors, behaves under radiation. Graphite is widely used as a neutron moderator and reflector in reactors, playing a key role in sustaining controlled nuclear chain reactions. However, radiation exposure causes graphite to deform through swelling, shrinking, and cracking, complicating predictions of its lifespan. The MIT team applied a statistical method called the Weibull Distribution alongside X-ray scattering techniques to analyze irradiated graphite samples from Oak Ridge National Laboratory. Their research revealed unexpected pore behavior: initially, pores fill as graphite degrades, but over prolonged irradiation, a recovery or annealing process occurs where new pores form and existing pores smooth and enlarge, influencing the material’s volume changes. This discovery sheds light on graphite’s complex composite structure—comprising crystalline filler particles, a less crystalline binder matrix, and pores ranging from nanometers to microns—that affects its radiation response. The study’s findings could lead to more accurate, non-destructive predictions of graphite’s
materialsgraphitenuclear-reactorsradiation-damagematerial-lifespancomposite-materialsenergy-materialsSpaceX redesigns Starship's grid fins to improve stability, control
SpaceX has redesigned the grid fins on its Super Heavy booster, part of the Starship system destined for Mars, to enhance stability and control during descent. The new design replaces four smaller fins and a landing fin with three larger, 50% bigger and stronger grid fins featuring a honeycomb-like structure. These fins, among the largest aerodynamic control surfaces ever built for a rocket, enable the booster to descend at steeper angles with improved maneuverability. The fins are also repositioned lower on the booster to align with the launch tower’s catch arms, allowing the rocket to be caught directly during landing—eliminating the need for a landing pad—and to protect the fins from engine heat. Internal components like the fin shafts are now housed inside the main fuel tank for added protection. This redesign follows recent test flight failures, including a May incident where the Super Heavy booster crashed into the Gulf of Mexico after failing to return to the launchpad, and a June explosion of the upper stage during ground testing.
materialsaerospace-engineeringSpaceXrocket-technologyaerodynamic-control-surfacesgrid-finsspacecraft-designElusive carbon ring finally tamed for room-temperature research
Chemists at the University of Oxford have successfully synthesized a cyclocarbon molecule—specifically cyclo[48]carbon—as a [4]catenane that remains stable in solution at room temperature for up to 92 hours. This achievement marks a significant breakthrough in molecular science, as cyclocarbons were previously only observable fleetingly under extreme conditions such as in the gas phase or at cryogenic temperatures. The team’s innovative approach involved threading the C48 ring through three protective macrocycles, which shield the reactive carbon ring from degradation, and using a larger cyclocarbon to reduce molecular strain. The mild conditions employed during the final unmasking step further preserved the molecule’s integrity. The structure and stability of the cyclocarbon catenane were confirmed through various spectroscopic techniques, including mass spectrometry, NMR, UV-visible, and Raman spectroscopy. Notably, a single intense ^13C NMR resonance indicated a symmetrical environment for all 48 sp^1 carbon atoms,
materialscarbon-allotropescyclocarbonmolecular-synthesisspectroscopychemical-analysisnanomaterialsScientists create eco-friendly plastic from plants and captured CO2
Scientists at the FAMU-FSU College of Engineering have developed an innovative, eco-friendly polyurethane made from lignin—a natural polymer found in plant cell walls—and captured carbon dioxide. This new plant-based plastic maintains the strength, heat resistance, and flexibility typical of conventional polyurethane but avoids the use of toxic isocyanates, hazardous chemicals traditionally required in polyurethane production. The process uses fewer steps, consumes less energy, and produces a biodegradable material from renewable resources, offering significant environmental and health benefits. The resulting lignin-based polyurethane is also easier to process, dissolving readily in solvents, which enhances its scalability and commercial viability compared to other biomass-derived plastics. This advancement builds on previous work by the team exploring lignin’s potential in sustainable polymers, expanding its application from polycarbonate to the more widely used polyurethane. Supported by Florida State University’s resources and funding from the U.S. Army Research Office and South Korea’s Ministry of Trade, Industry & Energy, the research represents a promising step toward greener manufacturing
materialssustainable-plasticspolyurethanelignincarbon-dioxide-utilizationbiodegradable-polymersgreen-chemistrySweat-activated winter jacket improves body heat control by 82.8%
A team of scientists led by Xiuqiang Li at Nanjing University of Aeronautics and Astronautics has developed a sweat-activated winter jacket that significantly improves thermal regulation by up to 82.8% compared to traditional textiles. The jacket uses a bacterial cellulose membrane as its filling, which automatically adjusts its thickness based on humidity levels: it remains thick (13 millimeters) in dry, cold air to retain warmth and shrinks to 2 millimeters when humidity rises from sweating, allowing better cooling during physical activity. This adaptive feature helps maintain comfort by preventing overheating without sacrificing insulation. The membrane was tested both in controlled lab settings, using a system simulating human skin, and in real-world trials where volunteers wore the jacket while walking or cycling outdoors. Results showed the jacket could extend the “no-thermal stress zone” by an average of 7.5 hours across 20 cities, making it particularly beneficial for outdoor workers such as sanitation staff, couriers, and police
materialsadaptive-clothingthermal-regulationbacterial-cellulosewearable-technologysmart-textilesinsulation-materialsU.S. government is reportedly in discussions to take stake in Intel
The U.S. government, under the Trump administration, is reportedly in talks to acquire a stake in semiconductor company Intel. This potential investment aims to support Intel’s expansion of its manufacturing capabilities within the United States. The discussions follow concerns raised by Republican Senator Tom Cotton regarding Intel board member Tan’s alleged connections to China, which prompted scrutiny from the administration. These developments come shortly after President Trump took unspecified actions related to Intel, possibly influenced by perceived conflicts of interest. A meeting between Intel and government officials intended to address these concerns reportedly led to the idea of the government taking a direct ownership position in the company. Further details from Intel have not been disclosed, and the situation remains evolving.
materialssemiconductormanufacturingIntelU.S.-governmenttechnologychip-industryThe wait is almost over: The 2025 Startup Battlefield 200 list drops August 27
TechCrunch is set to announce the 2025 Startup Battlefield 200 list on August 27 at 9:00 a.m. PT, featuring the most promising early-stage startups selected from thousands of global applications. These startups will compete at TechCrunch Disrupt 2025, taking place October 27–29 in San Francisco, marking the event’s 20th anniversary. The Startup Battlefield has historically launched major tech companies such as Dropbox, Cloudflare, Fitbit, and Discord, and continues to spotlight the next generation of innovative startups. Last year’s winner, Salva Health, gained recognition for its portable breast cancer detection device aimed at underserved rural populations. Other notable startups included geCKo Materials, which is innovating adhesive technology to disrupt the Velcro industry. The top 20 finalists from the 2025 cohort will be revealed on the first day of Disrupt, competing live for a $100,000 prize and the Disrupt Cup. The competition is sponsored by Google Cloud and led
materialsadhesivesstartupinnovationtechnologybreakthroughresearchiPhone 17, the ‘thinnest iPhone ever,’ and everything else we’re expecting out of Apple’s hardware event
Apple is expected to hold its annual hardware event on September 9, unveiling the iPhone 17 lineup along with updates to the Apple Watch and AirPods. The iPhone 17 series will include the standard iPhone 17, 17 Pro, and 17 Pro Max models, featuring notable upgrades such as a slightly larger 6.3-inch screen for the base model with a 120Hz refresh rate, a 24-megapixel front camera, and new color options like purple and green. The Pro models may see a redesign of the rear camera layout and a material change from titanium to aluminum for the Pro’s frame to reduce weight and cost. The Pro Max is expected to have a thicker body to accommodate a larger battery. Pricing rumors suggest the iPhone 17 will start around $800, the Pro at $1,050, and the Pro Max at $1,250, with fewer storage options available on the Pro model. In addition to the main lineup, Apple might
materialssmartphonesAppleiPhone-17battery-technologydevice-designconsumer-electronicsHarvard team builds sunlight-powered disc to explore mesosphere
A research team from Harvard’s John A. Paulson School of Engineering and Applied Sciences has developed a lightweight, disc-shaped device powered by sunlight that can levitate in the mesosphere, the atmospheric layer between 30 and 60 miles above Earth’s surface. This region has been historically difficult to study because it lies beyond the reach of planes and balloons but below satellite orbits. The device leverages photophoresis—a physical effect where light causes gas molecules to exert a lifting force on an object in low-pressure environments—to achieve levitation. Using advanced nanofabrication, the team created centimeter-scale devices composed of thin ceramic alumina membranes and chromium layers that absorb sunlight, enabling the device to float when exposed to light under mesosphere-like conditions. The researchers tested the device in a low-pressure chamber simulating mesosphere conditions and demonstrated that a 1-centimeter-wide structure could levitate at pressures equivalent to 60 kilometers altitude with only 55% of sunlight’s intensity. This marks the
energymaterialsnanofabricationphotophoresisatmospheric-researchsunlight-powered-devicesalumina-ceramicsResearchers Surf the Magnon Wave to Control Particles in Next-Gen Electronics - CleanTechnica
A recent study led by researchers from the National Renewable Energy Laboratory (NREL) and international collaborators has demonstrated how magnons—waves in magnetic systems—can be used to control interactions between excitons, which are neutral quasiparticles that carry energy in materials. By linking magnetic and charge excitations in certain magnetic semiconductors, the team showed that electron pair interactions, fundamental to next-generation electronics, can be modulated. This was explained through a newly developed quantum-mechanical theoretical framework. The findings, published in Nature Materials, suggest potential applications in quantum technologies, particularly in developing quantum transducers essential for quantum communication and computing. Excitons form when an energized electron and the hole it leaves behind bind together, influencing how materials absorb and emit light, which is critical for devices like solar panels, LEDs, and smartphones. Magnons, related to electron spin orientations, offer a means to manipulate magnetic properties in these materials. The ability to control exciton behavior via magnons opens new avenues for opt
energymaterialsquantum-technologiesmagnetic-semiconductorsexcitonsmagnonsquantum-communicationBuilding AI Foundation Models to Accelerate the Discovery of New Battery Materials - CleanTechnica
Researchers at the University of Michigan, leveraging the powerful supercomputers Aurora and Polaris at the Argonne Leadership Computing Facility (ALCF), are developing AI foundation models to accelerate the discovery of new battery materials. Traditionally, battery material discovery relied heavily on intuition and incremental improvements to a limited set of materials identified mainly between 1975 and 1985. The new AI-driven approach uses large, specialized foundation models trained on massive datasets of molecular structures to predict key properties such as conductivity, melting point, boiling point, and flammability. This enables a more efficient exploration of the vast chemical space—estimated to contain up to 10^60 possible molecular compounds—by focusing on promising candidates for battery electrolytes and electrodes. The team’s foundation model, trained on billions of molecules using text-based molecular representations (SMILES) and enhanced by a novel tool called SMIRK, allows for more precise and consistent learning of molecular structures. This approach helps overcome the limitations of traditional trial-and-error methods by providing
energymaterialsartificial-intelligencebattery-technologymolecular-designsupercomputingbattery-materials-discoveryScientists mimic seashells to improve recycled plastic performance
Researchers at Georgia Tech, led by aerospace engineering assistant professor Christos Athanasiou, have developed a bio-inspired material that mimics the structure of seashells to improve the performance and consistency of recycled plastics. By replicating nacre—the natural architecture of seashells composed of brittle mineral “bricks” bonded with soft protein “mortar”—the team created a composite using recycled high-density polyethylene (HDPE) sheets layered with a softer adhesive polymer. This design significantly reduces variability in mechanical properties, maintaining the strength of virgin plastics while improving reliability, particularly in maximum elongation by over 68%. This advancement addresses a major challenge in recycling, where less than 10% of plastics are effectively reused due to inconsistent material quality. The seashell-inspired approach restores trustworthiness in recycled HDPE, which typically degrades after exposure to sunlight and heat, limiting its reuse in high-performance applications. The researchers also introduced an “uncertainty-aware” Tension Shear Chain model to quantify both
materialsrecycled-plasticsbio-inspired-designsustainabilitypolymer-compositesplastic-recyclingmaterial-scienceHair protein toothpaste could repair enamel, stop tooth decay
Researchers at King’s College London have developed a novel keratin-based toothpaste derived from human hair protein that could repair tooth enamel, reduce sensitivity, and prevent decay. Unlike enamel, which cannot regenerate naturally, keratin forms a protective, enamel-like coating by interacting with minerals in saliva, creating a dense mineral layer that halts decay and seals exposed nerve channels. This biomimetic approach offers both structural protection and symptomatic relief, potentially reducing the need for fillings or crowns in early-stage tooth damage. The keratin used in the toothpaste is sustainably sourced from biological waste such as hair and wool, providing an eco-friendly alternative to traditional toxic plastic resins used in restorative dentistry. The protein forms a crystal-like scaffold on the tooth surface that attracts calcium and phosphate ions, gradually rebuilding enamel with a natural color match that improves aesthetics and patient satisfaction. The researchers anticipate that keratin-based enamel regeneration products could be available within two to three years, delivered either as daily toothpaste or professionally applied gels, marking a significant advancement in
materialsbiomaterialsenamel-repairkeratindental-technologysustainable-materialstooth-decay-preventionScientists turn grapevine waste into stronger plastic alternative
Researchers at South Dakota State University, led by Dr. Srinivas Janaswamy, have developed a biodegradable plastic-like film made from grapevine canes, an agricultural waste product. These canes, typically discarded or composted after grape harvests, are rich in cellulose—a naturally strong and rigid biopolymer. By drying, grinding, and extracting cellulose from the canes, the team created films that are stronger than traditional plastic bags and decompose fully within 17 days in soil, addressing significant issues related to plastic pollution and waste management. This innovation leverages an abundant, low-water-content biomass that is usually underutilized, turning it into a sustainable packaging alternative with high transparency, which is beneficial for food packaging by enhancing product visibility. The researchers emphasize that this approach not only offers an eco-friendly substitute to single-use plastics but also supports the circular bioeconomy by adding value to agricultural byproducts. The study marks a significant step toward producing biodegradable plastic-like bags, aligning with broader environmental
materialsbiodegradable-plasticssustainable-packagingcelluloseagricultural-wasteplastic-alternativeenvironmental-innovation$195,000 3D-Printed Housing Come To The US
The article discusses the emerging presence of affordable 3D-printed housing in the United States, focusing on a project in Austin, Texas. The company Icon, in collaboration with Michael Hsu Office of Architecture, is developing a community featuring homes constructed using 3D-printing technology. These homes are priced around $195,000, aiming to provide cost-effective housing solutions. This initiative highlights the potential for 3D printing to address housing affordability challenges by reducing construction time and costs. The Austin project serves as a test case for the viability and scalability of 3D-printed homes in the US market, signaling a possible shift in how residential buildings are designed and built in the future.
materials3D-printingconstruction-technologyaffordable-housingsustainable-materialsadditive-manufacturingNew self-healing plastic outperforms steel in strength tests
US researchers from Texas A&M University and the University of Tulsa have developed a new recyclable carbon-fiber plastic composite called Aromatic Thermosetting Copolyester (ATSP) that exhibits self-healing properties and outperforms steel in strength tests. Led by Dr. Mohammad Naraghi and funded by the US Department of Defense, ATSP can repair cracks and deformations when heated, restoring or even improving its original strength. This adaptive material shows promise for critical applications in aerospace, defense, and automotive industries, where it can enhance safety by enabling on-demand healing of damaged components and potentially restoring vehicle shapes after collisions. ATSP combines the flexibility of thermoplastics with the stability of thermosets, and when reinforced with carbon fibers, it becomes several times stronger than steel while remaining lighter than aluminum. The material’s chemistry remains stable over multiple reshaping cycles, making it a sustainable alternative to traditional plastics by reducing waste without sacrificing durability. Laboratory tests demonstrated that ATSP could endure hundreds of stress and
materialsself-healing-plasticcarbon-fiber-compositeadvanced-materialsaerospace-materialssustainable-materialssmart-materialsColumbia's radiation-proof chip built to decode the universe at CERN
Columbia University engineers have developed a specialized, radiation-hardened analog-to-digital converter (ADC) chip designed for CERN’s Large Hadron Collider (LHC) upgrade, specifically for use in the ATLAS detector. This custom silicon chip can capture and digitize signals from up to 1.5 billion particle collisions per second, a significant increase from the current 400 million collisions per second. The chip’s resilient design allows it to operate reliably in the LHC’s extreme radiation environment, where standard commercial electronics fail. By converting analog signals from the liquid argon calorimeter into precise digital data, these ADC chips enable scientists to analyze particle collisions with unprecedented detail. Due to the intense radiation and the niche market for radiation-resistant electronics, commercial components were unsuitable, prompting Columbia’s team to create their own robust solution using existing circuit-level techniques. Two versions of these chips are integral to the ATLAS experiment: one acts as a “digital gatekeeper,” filtering collisions to select the most promising events
materialsradiation-hardened-chipssilicon-chipparticle-physicsLarge-Hadron-Collideranalog-to-digital-converterCERNStudent-built satellite to study rare atmospheric phenomenon in space
A team of University of Calgary students is preparing to launch FrontierSat (CTS-SAT-1), the city’s first student-built satellite, in early 2026. Led primarily by undergraduates from the Schulich School of Engineering and the Faculty of Science, the CubeSat-sized satellite aims to study a rare upper atmospheric phenomenon called Strong Thermal Emission Velocity Enhancement (STEVE), which is a narrow, purple light similar to the aurora borealis but less understood. FrontierSat will carry two instruments: a mini plasma imager to capture data on STEVE and a deployable composite lattice boom equipped with a camera to monitor the spacecraft and capture space imagery. The project is managed by CalgaryToSpace, a student group founded in 2020 with over 100 members involved, and is partly funded by the Canadian Space Agency along with university and student fundraising efforts. Despite technical challenges and delays in securing a launch provider, the satellite has undergone rigorous testing, including a final vibration test to simulate launch stresses
materialssatellite-technologyCubeSatspace-weatheraerospace-engineeringstudent-projectplasma-imagingNew heat-resistant plastic can be recycled endlessly without loss
Researchers at Texas A&M University, in collaboration with the University of Tulsa and supported by the U.S. Department of Defense and the Air Force Office of Scientific Research, have developed a new high-strength plastic called Aromatic Thermosetting Copolyester (ATSP) that can be recycled endlessly without losing quality. This innovative material is heat-resistant, ultra-durable, and capable of self-healing and shape recovery after damage, making it highly suitable for demanding industries such as aerospace, automotive, medical, and electronics manufacturing. When reinforced with carbon fibers, ATSP becomes several times stronger than steel while remaining lighter than aluminum, offering a combination of strength and lightness critical for high-performance applications. The research team conducted extensive testing, including cyclical creep and deep-cycle bending fatigue tests, demonstrating that ATSP can endure repeated stress and heat cycles while maintaining or even improving its durability. The material’s unique bond exchanges enable on-demand self-healing at elevated temperatures (around 160 °C to 280 °
materialsrecyclable-plasticheat-resistant-polymeraerospace-materialsself-healing-plasticsustainable-materialshigh-performance-materialsVitamin K2 breakthrough could supercharge bone and heart health
A recent study has uncovered how the bacterium Lactococcus lactis, commonly used in dairy fermentation, regulates its production of vitamin K₂ (menaquinone), a vital nutrient for bone health, blood clotting, and cardiovascular function. The microbe naturally produces only enough vitamin K₂ to sustain itself, due to an internal self-limiting mechanism that prevents toxic buildup of an unstable intermediate compound essential to all forms of vitamin K₂. This biological “brake” has posed challenges for efforts to engineer bacteria to overproduce the vitamin for commercial use, which could otherwise offer a greener, cheaper alternative to current chemical synthesis or plant extraction methods. Researchers combined biosensing, genetic engineering, and mathematical modeling to decode these production limits. They developed a highly sensitive biosensor to detect the hard-to-measure vitamin K₂ precursor and discovered that production plateaus when substrate supply is depleted. Additionally, they found that the order of enzyme-encoding genes on DNA influences intermediate compound levels, revealing a previously unknown evolutionary
materialssynthetic-biologygenetic-engineeringbiosensorsmicrobial-productionvitamin-K2biotechnologyApple announces $100B American Manufacturing program - The Robot Report
Apple has announced a $100 billion American Manufacturing Program (AMP), expanding its total U.S. investment to $600 billion over the next four years. The initiative aims to increase domestic production of critical components and advanced manufacturing for Apple products, while incentivizing global partners to manufacture more in the U.S. Apple plans to hire 20,000 workers primarily in research and development, silicon engineering, software development, and AI/machine learning. Initial AMP partners include Corning, Coherent, GlobalWafers America, Applied Materials, Texas Instruments, Samsung, GlobalFoundries, Amkor, and Broadcom. Key projects under AMP include a major expansion of Apple’s partnership with Corning to produce advanced smartphone glass in Harrodsburg, Kentucky, and the opening of an Apple-Corning Innovation Center there. Apple also renewed a multiyear agreement with Coherent to produce VCSEL lasers in Sherman, Texas, and committed to sourcing American-made rare earth magnets from MP Materials, which will also establish
materialsmanufacturingsemiconductorsiliconrare-earth-magnetsadvanced-glasssupply-chainiPhone 17, the ‘thinnest iPhone ever,’ and everything else we’re expecting out of Apple’s hardware event
Apple is expected to hold its annual hardware event on September 9, unveiling the iPhone 17 lineup alongside updates to the Apple Watch and AirPods. The iPhone 17 series is rumored to feature notable changes, including a slightly larger screen (an increase of 0.2 inches from the iPhone 16), a higher refresh rate display (upgrading from 60Hz), and a 24-megapixel front camera. New colors like purple and green may be introduced. The iPhone 17 Pro could see a redesigned rear camera layout with a rectangular bar spanning the device’s width and a shift from a titanium to an aluminum frame, potentially reducing cost and weight. The Pro Max model is expected to have fewer upgrades but a thicker body to accommodate a larger battery. Pricing estimates suggest the base iPhone 17 around $800, the Pro at $1,050, and the Pro Max at $1,250. Additionally, Apple may launch the ultra-thin iPhone Air
materialsenergyIoTsmartphonesApplebattery-technologywearable-technologyNew Jersey Wins $2 Billion Settlement From DuPont Over PFAS Contamination - CleanTechnica
The article discusses the recent $2 billion settlement won by New Jersey from DuPont over contamination caused by PFAS (per- and poly-fluoroalkyl substances), also known as "forever chemicals" due to their persistence in the environment. PFAS are widely used in consumer products such as food packaging, non-stick cookware, textiles, cosmetics, and firefighting foam because of their water- and grease-resistant properties. However, these chemicals do not break down naturally and have been linked to serious health issues, including cancers, fertility problems, and developmental disorders in children. Despite the growing evidence of harm, the U.S. federal government has cut nearly $15 million in research funding on PFAS contamination in farms, a move criticized by public health advocates as prioritizing corporate profits over citizen health. The article highlights the environmental and health risks posed by PFAS contamination in agriculture, noting that pesticides and sewage sludge used as fertilizer introduce these chemicals into soil and water, thereby entering the food supply. The
materialsPFASchemical-contaminationenvironmental-pollutionwater-pollutiontoxic-chemicalspublic-healthNew magnetic model explains why delta-plutonium shrinks when heated
Researchers at Lawrence Livermore National Laboratory (LLNL) have developed a new magnetic free-energy model that explains why delta-plutonium, unlike most materials, contracts when heated above room temperature. This counterintuitive behavior, puzzling scientists for decades, is linked to the complex interplay of plutonium’s electronic structure, magnetism, and crystal arrangement. By incorporating temperature-dependent magnetic fluctuations into their calculations of the material’s free energy, the model successfully reproduces delta-plutonium’s unusual thermal contraction and offers a deeper understanding of its unique and often unpredictable properties. The study marks the first time magnetic fluctuations have been explicitly included in a free-energy model for plutonium, providing fresh insights into the subtle forces governing its behavior. Beyond plutonium, this dynamic magnetism approach could be applied to other materials where magnetic states vary with temperature. Future work aims to extend the model by including microstructures, defects, and other real-world imperfections to improve prediction accuracy. Such advancements could enhance the safe handling, material
materialsplutoniumthermal-expansionmagnetic-modelelectronic-structurefree-energymaterial-scienceScientists use perfectly timed lasers pluses to pause silicon melting
Researchers from the University of California and the University of Kassel have developed a novel laser technique that can pause the ultra-fast melting of silicon by precisely timing two laser pulses separated by 126 femtoseconds. Typically, a single high-energy laser pulse causes silicon to undergo non-thermal melting, where atoms lose their ordered crystalline structure in less than a trillionth of a second without significant heating. However, by splitting the laser energy into two pulses and synchronizing them accurately, the team was able to halt this melting process mid-way, creating a metastable form of silicon that retains most of its original electronic properties, including a slightly reduced band gap. Using ab initio molecular dynamics simulations, the researchers showed that the first pulse initiates atomic motion, while the second pulse disrupts this motion to effectively "freeze" the atoms in place, preventing the loss of crystalline order. This metastable state also exhibited cooler and more stable atomic vibrations (phonons) than expected, indicating enhanced control over atomic behavior.
materialssiliconlaser-pulsesultrafast-meltingelectronic-propertiesmolecular-dynamicsmaterial-scienceIt's Time To Divest From Plastic — Ceramics Are One Viable Alternative - CleanTechnica
The article discusses the ongoing global efforts to address the plastic pollution crisis through a landmark United Nations treaty, with negotiations taking place in Geneva and set to conclude by August 2025. Despite broad international recognition of plastic pollution's harmful effects—including cancer, hormone disruption, and environmental contamination—progress is hindered by opposition from major plastic-producing countries like Saudi Arabia and the United States. While 175 nations agreed in 2022 to create a legally binding treaty targeting the entire plastic lifecycle, disagreements remain over production limits and chemical additives. Greenpeace advocates for a 75% reduction in plastic production by 2040, emphasizing that recycling alone is insufficient to solve the problem. Amid these challenges, the article highlights innovative alternatives to plastic, focusing on GaeaStar, a company producing ceramic cups as a sustainable substitute for single-use plastic drinkware. Made from natural materials like clay, salt, and water, these cups are reusable, inert, and free from harmful chemical leaching. GaeaStar’s products combine
materialsplastic-alternativesceramicsenvironmental-sustainabilityplastic-pollutionrecyclingsustainable-materialsScientists measure quantum distance in a solid for the first time ever
Scientists have, for the first time, experimentally measured the full quantum metric tensor of electrons in a real solid crystal, using black phosphorus. Quantum distance, a theoretical concept describing how similar or different two quantum states are, had long eluded direct measurement in materials due to the difficulty of capturing the subtle quantum geometry of electrons. By employing angle-resolved photoemission spectroscopy (ARPES) combined with synchrotron radiation at the Advanced Light Source, the researchers mapped the pseudospin texture of electrons in black phosphorus, enabling them to reconstruct the quantum distance and the full quantum metric tensor of Bloch electrons within the crystal. This breakthrough is significant because understanding quantum distances and the quantum metric tensor can illuminate anomalous quantum phenomena in solids, such as high-temperature superconductivity and resistance-free electrical conduction. Moreover, precise knowledge of quantum geometry is crucial for advancing quantum technologies, including the development of fault-tolerant quantum computers. While the current demonstration is limited to black phosphorus, the approach opens new avenues for exploring
materialsquantum-materialsblack-phosphorusquantum-distancesuperconductorsquantum-computingelectron-behaviorScientists show a way to speed or slow reactions using tiny mirror gaps
Researchers at the University of Rochester have uncovered a detailed explanation for how chemical reaction rates can be controlled without traditional methods like heat, light, or added chemicals, by exploiting a quantum effect called vibrational strong coupling (VSC). This phenomenon occurs when molecules are placed inside an optical microcavity—an extremely tiny gap between gold-coated mirrors—that alters the electromagnetic environment around the molecules. The interaction between molecular vibrations and confined light fields within this cavity can either speed up or slow down reactions by changing how energy is exchanged between molecules and their surroundings, effectively tuning reaction rates by adjusting the coupling strength. This discovery resolves a long-standing mystery about VSC, first observed in 2016, where reaction speeds changed under these conditions despite constant temperature and light. The University of Rochester team combined quantum mechanics with large-scale simulations to develop a model explaining when and how VSC occurs and how it can be controlled. Their findings suggest that manipulating the quantum environment, rather than the molecules themselves, offers a new, energy-efficient
materialsquantum-chemistryvibrational-strong-couplingoptical-microcavityreaction-rate-controlenergy-saving-technologymolecular-vibrationsThis New Pyramid-Like Shape Always Lands With the Same Side Up
The article discusses a longstanding mathematical problem concerning the tetrahedron, one of Plato’s five polyhedra, specifically whether a tetrahedron made of uniform material can be constructed to rest stably on only one face. In 1966, mathematicians John Conway and Richard Guy proved that a uniformly weighted monostable tetrahedron—one that always lands on the same face—is impossible. However, the question remained open if uneven weight distribution was allowed. While roly-poly toys achieve similar behavior through weighted bottoms, such effects are well understood only for smooth or rounded shapes, not for polyhedra with flat faces and sharp edges. In 2023, Gábor Domokos and his collaborators, including graduate students and Robert Dawson, resolved this problem by proving that a tetrahedron’s weight can indeed be distributed unevenly to create a shape that always lands on the same face. They went further by constructing the first physical model of this “monostable” tetrahedron, made from lightweight carbon fiber
materialsgeometrypolyhedratetrahedronmonostable-shapesmathematical-modelingmaterial-scienceChina creates rare meteorite diamonds much harder than ones on Earth
Chinese scientists have successfully synthesized rare hexagonal diamonds, known as lonsdaleite, which are much harder than the conventional cubic diamonds typically found on Earth. These hexagonal diamonds were first discovered in the Canyon Diablo meteorite, which struck Earth around 50,000 years ago. Unlike the cubic structure formed deep within Earth under high temperature and pressure, lonsdaleite forms under the extreme conditions of meteorite impacts, giving it a unique honeycomb-like atomic arrangement and potentially up to 60% greater hardness. The breakthrough was achieved by a joint team from the Centre for High Pressure Science and Technology Advanced Research and the Chinese Academy of Sciences. They used ultra-pure single-crystal graphite and applied uniform high pressure and temperature while monitoring the transformation with in-situ X-ray techniques. This approach minimized impurities and prevented the material from reverting to the cubic diamond structure, allowing the creation of pure hexagonal diamond crystals about 100 micrometers wide. This marks the first macroscopic proof of lons
materialsdiamondshexagonal-diamondmeteorite-diamondshigh-pressure-synthesiscrystal-structurelonsdaleitePhotos: A horse-inspired design marks Bugatti’s new ultra-rare coupe
Bugatti has unveiled the Brouillard, a new ultra-rare coupe that inaugurates its “Programme Solitaire,” an exclusive initiative to produce no more than two highly personalized masterpiece vehicles annually. The Brouillard will officially debut at Monterey Car Week 2025. Inspired by Bugatti’s early 20th-century coachbuilding heritage, the car’s design draws from the form of Ettore Bugatti’s horse, featuring smooth, curved surfaces and a darker lower body that evokes the car’s shadow. A prominent aerodynamic element is the fixed ducktail wing integrated into the carbon fiber and aluminum chassis, enhancing both performance and elegance. The interior reflects the equestrian theme with custom-woven Parisian tartan fabrics, green-tinted carbon fiber, machined aluminum components, and horse motifs embroidered on door panels and seat backrests. A standout detail is the gear shifter, crafted from a single aluminum block and containing a glass insert with a miniature sculpture of Ettore Bugatti’s horse. The cabin benefits from a
materialscarbon-fiberaluminumautomotive-designaerodynamicsluxury-carscraftsmanshipAeroFarms® Raises Equity to Fund Pre-Construction Activities for Second Farm; Refinances Debt to Support Ongoing Operations in Danville, Virginia - CleanTechnica
AeroFarms, a leading U.S. indoor vertical farming company specializing in microgreens, has raised equity funding from existing investors—including Grosvenor Food & AgTech, Ingka Investments, Cibus Capital, and ACEG—to support pre-construction activities for a second farm and ongoing operations at its Danville, Virginia facility. The company aims to expand its sustainable, profitable vertical farming model that uses patented aeroponics technology, robotics, AI, and 100% renewable energy to produce nutritious greens year-round while using significantly less land and water than traditional farming. AeroFarms currently commands over 70% of the U.S. retail microgreens market. In addition to equity financing, AeroFarms refinanced its debt with an asset-based loan from Siguler Guff, which fully paid off the previous Horizon Technology Finance facility and provided additional capital for operations. The new loan offers more favorable terms, including a lower interest rate, interest-only payments, and provisions for equipment financing. Siguler
energymaterialsroboticsIoTvertical-farmingsustainable-agriculturerenewable-energyDual-function molecule powers OLEDs and sharp medical imaging
Researchers at Kyushu University have developed a novel organic molecule, CzTRZCN, that uniquely combines two previously conflicting properties: strong thermally activated delayed fluorescence (TADF) for efficient light emission in OLED displays, and high two-photon absorption (2PA) for safer, high-precision deep-tissue medical imaging. This dual-function molecule features a design that allows it to maintain orbital overlap during light absorption for effective 2PA, then switch to a twisted structure that enables TADF emission. In OLED devices, CzTRZCN achieved a record external quantum efficiency of 13.5% for triazine-based TADF materials, while also demonstrating promising brightness and biocompatibility for medical imaging applications. The breakthrough addresses the longstanding challenge of merging the planar structures needed for 2PA with the twisted configurations favored by TADF, enabling a single molecule to serve both consumer electronics and biomedical diagnostics. The metal-free, low-toxicity nature of CzTRZCN makes it suitable for
materialsOLEDthermally-activated-delayed-fluorescencetwo-photon-absorptionmedical-imagingorganic-moleculesenergy-efficient-displaysExplained: The physics behind Eiffel Tower's growing height in summer
The Eiffel Tower experiences a measurable increase in height during summer due to the thermal expansion of its iron structure. Originally designed to stand 300 meters tall for the 1889 World’s Fair, the tower’s iron lattice expands when heated because atoms in solids vibrate more and push apart as temperature rises. The coefficient of thermal expansion for the tower’s iron is about 12 × 10⁻⁶ per °C, meaning that for every degree Celsius increase, a one-meter iron piece lengthens by roughly 12 micrometers. Given Paris’s temperature swings from below –20 °C in winter to around 40 °C in summer, the tower can theoretically grow by up to 36 centimeters (about 14 inches) at its full height. In practice, engineers observe a seasonal height variation of about 12 to 15 centimeters (5 to 6 inches), which aligns with theoretical predictions once the tower’s complex lattice structure and uneven heating are considered. Additionally, sunlight causes one side
materialsthermal-expansionironEiffel-Towerstructural-engineeringtemperature-effectsmetallurgyQuantum state unlocked in object at room temperature in world-first
Researchers from TU Wien and ETH Zurich have achieved a world-first by unlocking quantum states in glass nanoparticles at room temperature, bypassing the need for ultra-low temperatures typically required in quantum experiments. Their work focused on slightly elliptical nanoparticles smaller than a grain of sand, which were held in electromagnetic fields causing them to rotate around an equilibrium orientation. By using a system of lasers and mirrors capable of both supplying and extracting energy, the team was able to reduce the rotational energy of these particles, effectively bringing their motion close to the quantum ground state despite the particles being several hundred degrees hot. This breakthrough challenges the conventional understanding that quantum states can only be observed in systems cooled near absolute zero to isolate them from environmental disturbances. The researchers emphasized the importance of treating different degrees of freedom separately, which allowed them to manipulate the rotational movement independently and achieve quantum behavior at ambient temperatures. This advancement opens new avenues for studying quantum properties in larger objects and at practical temperatures, potentially accelerating developments in quantum sensing, computation, simulation, and crypt
materialsquantum-physicsnanoparticlesenergy-statesquantum-computingquantum-sensingroom-temperature-quantum-statesAmazon & Brimstone Advance Lower-Carbon Cement Collaboration - CleanTechnica
Amazon and Brimstone have announced promising initial test results for Brimstone’s lower-carbon Ordinary Portland Cement (OPC), intended for use in concrete construction. The tests, conducted with Amazon’s concrete consultants, evaluated key properties such as workability and compressive strength based on Amazon’s slab mix designs. Brimstone’s OPC met ASTM C150 standards and performed comparably to conventional cement currently used in Amazon buildings. Encouraged by these outcomes, Amazon has signed a commercial agreement to reserve annual volumes of Brimstone’s OPC and supplementary cementitious materials (SCM) from Brimstone’s upcoming Oakland, CA plant. Building on this success, Amazon and Brimstone plan to conduct more extensive testing in 2025 and 2026 to assess durability, sulfate resistance, aggregate reactivity, and other critical properties across a wider range of concrete mixes and applications. Brimstone’s CEO highlighted that their process produces industry-standard cement at competitive prices, facilitating fast market adoption due to compliance with
energymaterialslow-carbon-cementsustainable-constructionindustrial-materialscarbon-footprint-reductionconcrete-technology3D image reveals atomic dance moments before molecule explosion
Scientists at the European XFEL near Hamburg have, for the first time, directly observed the quantum zero-point motion—the intrinsic, smallest possible vibrations of atoms—in a complex molecule just moments before it exploded. Using ultrashort, high-intensity X-ray pulses to ionize a 2-iodopyridine molecule, the team caused it to shatter into charged fragments. By tracking these fragments with a reaction microscope called COLTRIMS, which captures particle trajectories on femtosecond timescales, researchers reconstructed a three-dimensional map of the molecule’s shape and internal atomic motion at the instant of breakup. The observed fragment directions revealed subtle distortions inconsistent with classical flat molecular geometry, indicating coordinated quantum trembling rather than random thermal vibrations. The experiment demonstrated that classical physics alone could not explain the data; only quantum mechanical models matched the observations, confirming the presence of coherent quantum fluctuations in the molecule’s structure. The researchers used statistical methods to reconstruct complete molecular geometries from partial fragment data, enabling a detailed
materialsquantum-physicsmolecular-imagingXFELatomic-motion3D-visualizationquantum-fluctuationsRecord-breaking single-photon detector ends need for cryogenics
Researchers at ICFO have developed a groundbreaking single-photon detector capable of sensing mid-infrared photons at significantly higher temperatures—around 25 Kelvin—compared to conventional detectors that require cryogenic cooling below 1 Kelvin. This advance eliminates the need for bulky, energy-intensive cryogenic systems, making the technology more practical for integration into photonic circuits. The detector is constructed from stacked two-dimensional materials, specifically bilayer graphene sandwiched between hexagonal boron nitride layers, precisely aligned to create a moiré pattern that induces a bistability effect. This bistability allows the device to switch between two stable states when triggered by a single photon, enabling detection without ultra-low temperatures. The novel detection mechanism differs fundamentally from traditional superconducting and semiconductor detectors by operating near an electrical tipping point, where a single photon acts as a trigger to switch the device’s state. This approach enhances sensitivity to long-wavelength photons and has potential applications in astronomy, quantum communication, and medical imaging by improving the
materialsgraphenephoton-detectorquantum-communication2D-materialsmid-infrared-detectioncryogenicsHow China's record-breaking maglev train silenced 'tunnel boom'
China’s CRRC has developed a novel 100-meter-long porous buffer installed at tunnel entrances to address the “tunnel boom” phenomenon caused by high-speed maglev trains exiting tunnels. This boom results from compressed air rapidly releasing as trains traveling up to 600 km/h (373 mph) emerge from tunnels, creating intense low-frequency shock waves. The buffer, made from lightweight porous materials and combined with a porous tunnel wall coating, vents compressed air gradually, reducing pressure spikes by up to 96%. This innovation promises a quieter, safer ride and fewer disturbances to nearby communities, wildlife, and infrastructure, without significantly increasing construction complexity or costs. This breakthrough is critical for the advancement of maglev technology, which can surpass conventional high-speed rail speeds limited by wheel-rail friction. China’s latest maglev prototype, capable of sustained 600 km/h service, will incorporate this buffer. The technology could revolutionize travel along major corridors like Beijing–Shanghai by offering a faster, quieter alternative to domestic flights,
energymaterialsmagnetic-levitationhigh-speed-railaerodynamic-engineeringnoise-reductiontransportation-technologyUS Air Force to use Tesla Cybertrucks as missile practice targets
The U.S. Air Force plans to purchase two Tesla Cybertrucks to use as target vehicles for precision munitions testing, rather than for transportation or patrol. These trucks will help simulate potential real-world threats, as the military anticipates adversaries might deploy Cybertrucks in future conflicts. The vehicles will be part of a broader acquisition of 33 target vehicles by the Air Force Test Center (AFTC) for use at the White Sands Missile Range in New Mexico. Unlike other vehicles on the list, the Cybertruck required a formal sole-source justification due to its unique design and materials, including an unpainted stainless steel exoskeleton and a 48V electrical architecture, which contribute to its superior durability and efficiency. Tesla CEO Elon Musk has previously promoted the Cybertruck as “apocalypse-proof” and bullet-resistant, even pitching it to defense officials as a military vehicle. However, the Air Force’s documents reveal that these trucks are now intended to serve as tough targets in missile tests because
robotenergymaterialsTesla-Cybertruckmilitary-technologyprecision-munitionsstainless-steel-exoskeletonBreakthrough acoustic shield cancels noise without airflow loss
Researchers at Boston University’s Zhang Lab have developed a novel broadband acoustic silencer called the Phase Gradient Ultra-Open Metamaterial (PGUOM) that effectively cancels noise across a wide range of frequencies while preserving airflow. Unlike previous narrowband sound shields, PGUOM adapts to dynamic, real-world noise environments—such as airports, offices, and factories—where sound frequencies and volumes fluctuate unpredictably. The device uses a phase-gradient structure to convert incoming sound waves into surface waves that dissipate along the material, with a design that includes open central cells to maintain ventilation without sacrificing noise reduction. This innovation marks a significant advancement over earlier fixed, uniform designs by offering customizable frequency ranges and airflow levels tailored to specific applications. The PGUOM’s ability to balance broad-spectrum noise suppression with minimal airflow resistance makes it highly suitable for integration into commercial ventilation systems and public infrastructure. The research team has progressed from simulations to physical prototypes and is working on scalable manufacturing methods. Motivated by the health impacts
materialsacoustic-metamaterialsnoise-cancellationphase-gradient-metamaterialsbroadband-noise-reductionairflow-preservationmetamaterial-innovationSkincare acid creates metal-like, transparent film for wearables
Scientists at La Trobe University have developed a groundbreaking transparent, metal-like polymer film using hyaluronic acid, a compound commonly found in skincare products. By applying hyaluronic acid to a gold surface, the researchers created a highly conductive, flexible polymer called 2D PEDOT, which combines metal-like conductivity with near invisibility. This novel material addresses longstanding challenges in polymer science by offering reproducible, scalable, and industrially viable conductive films that outperform traditional polymers in transparency, flexibility, and electrical performance. The new 2D PEDOT film holds significant promise for advancing wearable technology, touchscreens, biosensors, and medical devices such as drug delivery implants and patient monitoring systems. The technique, known as tethered dopant templating, enables precise control over the polymer’s shape, transparency, and conductivity, overcoming issues of inconsistent quality and poor performance seen in previous conductive polymers. This innovation could transform the future of flexible, transparent electronics, marking a major step forward in smart device technology. The research was
materialsconductive-polymerswearable-technologytransparent-electronicssmart-devicesbiosensorsnanomaterialsNew curing concrete can reduce cracks, save 8 billion liters of water
Asian Paints has launched CureAssure, the world’s first internal curing concrete additive, in the UAE. This innovative self-curing liquid additive eliminates the need for traditional external curing by enhancing moisture retention within the concrete, enabling controlled and uniform hydration. CureAssure is chloride-free and compatible with all types of portland cement, including those with pozzolanic materials, and various admixtures. It is suitable for diverse concrete applications such as pumped, precast, high fluidity, high strength, ready-mixed, and long-distance transport concrete. The key benefits of CureAssure include significant water savings—up to eight billion liters annually in the UAE—and a reduction in shrinkage cracks due to minimized stress during hydration. The additive is mixed with gauging water during batching and requires specific mixing protocols to optimize performance. Asian Paints emphasizes that CureAssure represents a fundamental shift in curing technology by addressing hydration internally rather than relying on external methods, resulting in more durable and reliable concrete structures.
materialsconcrete-additivewater-conservationconstruction-technologysustainable-buildingpolymer-additivescrack-reductionBreakthrough camouflage for soldiers copies plants, dodges enemy lasers
Chinese scientists from the Micro-Nano Optoelectronics and Intelligent Sensing Research Group at the National University of Defense Technology have developed an advanced multispectral camouflage device inspired by the infrared radiation characteristics of Rosaceae plants. Utilizing the phase change material In3SbTe2 (IST), the device achieves multifunctional capabilities including infrared camouflage, thermal management, laser stealth, and visible light camouflage. The design employs particle swarm optimization combined with finite difference time domain methods to optimize performance, enabling it to mimic plant emissivity in key atmospheric infrared windows (3–5 µm and 8–14 µm) and achieve ultra-low emissivity for stealth. The device demonstrates impressive results in both its amorphous and crystalline states, with emissivities closely matching those of natural leaves, thus effectively blending into infrared imaging. It also achieves high laser absorption rates at wavelengths of 1.064 µm, 1.55 µm, and 10.6 µm, enabling laser stealth capabilities. Thermal management
materialsphase-change-materialsinfrared-camouflagethermal-managementlaser-stealthoptoelectronicsmilitary-technologyHow China’s CHSN01 super steel could shrink fusion reactors, cut costs
China has developed a new high-strength steel alloy, CHSN01, designed to revolutionize fusion reactor construction by enabling smaller, more cost-effective tokamaks. Traditional fusion projects like ITER have relied on cryogenic stainless steels such as 316LN, which have yield strengths limited to about 0.9–1.1 GPa at liquid-helium temperatures and lose ductility after repeated stress cycles. These limitations cap ITER’s magnetic field at 11.8 tesla and necessitate large, expensive reactor designs. In contrast, CHSN01 can withstand magnetic fields up to 20 tesla and combined electromagnetic stresses of 1.3 GPa, while maintaining about 30% ductility before breaking. It also retains these properties after 60,000 on/off cycles, matching the operational demands of China’s Burning-Plasma Experimental Superconducting Tokamak (BEST). The alloy’s superior performance stems from precise chemical engineering: starting with a nitrogen-strengthened austenitic steel base (
materialssteelfusion-reactorssuperconducting-magnetscryogenic-materialshigh-strength-alloysenergy-materialsScottish brothers row 9,000 miles in F1-inspired boat across Pacific
Three Scottish brothers—Ewan, Jamie, and Lachlan Maclean—are undertaking a remarkable 9,000-mile unsupported row across the Pacific Ocean in a high-performance boat inspired by Formula One technology. Their vessel, named Emily-Rose, is a lightweight, carbon-fiber craft co-designed with the Ocean Rowing Company, weighing just 280 kilograms and constructed using F1-grade materials. The boat incorporates over 40 custom 3D-printed parts made with a Formlabs Form 4 printer and engineering resins, including ergonomic rowing seats, a removable bed, and mounts for satellite communication. This cutting-edge design allows the brothers to maximize efficiency, durability, and safety during their journey, which began in Lima, Peru, on April 13 and aims to reach Sydney, Australia, by early August. The Macleans trained for two years, preparing physically and mentally, and dehydrating over 1,000 meals to sustain their unsupported expedition. Their mission extends beyond breaking the world record for
materials3D-printingcarbon-fiberFormula-One-technologyocean-rowingengineering-resinscustom-partsNew super-strong hydrogel can help advance biomedical and marine tech
Researchers at Hokkaido University have developed a new super-strong hydrogel with record-breaking underwater adhesive strength, capable of supporting objects weighing up to 139 pounds (63 kg) on a postage-stamp-sized patch. This hydrogel, inspired by adhesive proteins found in diverse organisms such as archaea, bacteria, viruses, and eukaryotes, was designed by analyzing nearly 25,000 natural adhesive proteins using data mining and machine learning techniques. By replicating key amino acid sequences responsible for underwater adhesion, the team synthesized 180 unique polymer networks, with machine learning further optimizing the hydrogel’s adhesive properties. The resulting material exhibits instant, strong, and repeatable adhesion across various surfaces and water conditions, including fresh and saltwater. The hydrogel’s adhesive strength was demonstrated through practical tests, such as holding a rubber duck firmly on a seaside rock despite ocean tides and waves, and instantly sealing a leaking pipe with a patch that could be reapplied multiple times without loss of effectiveness. Its
materialshydrogelunderwater-adhesionbiomedical-engineeringpolymer-networksmachine-learningbioinspired-materialsScientists levitate 300 million atoms at room temp for quantum purity
Researchers at ETH Zurich have achieved a significant breakthrough in quantum physics by levitating a nano-cluster composed of three glass spheres, totaling 300 million atoms, at room temperature. Using an optical tweezer—a device that employs polarized laser light in a vacuum—they stabilized the cluster nearly motionless, effectively neutralizing gravity. Despite this, the cluster exhibited zero-point fluctuations, a quantum phenomenon where no object can be perfectly still, oscillating at one million deflections per second with movements measured at a thousandth of a degree. The team attributed 92% of the cluster’s motion to quantum effects, demonstrating an unprecedented level of quantum purity in such a large object without the need for cryogenic cooling. This achievement marks multiple records in precision and scale, as manipulating an object of this size quantum mechanically is notably challenging. Conducted at room temperature, the experiment offers a cost-effective and scalable platform for developing sensitive quantum sensors. These sensors have potential applications in navigation, medical imaging, and fundamental physics research, including
materialsquantum-physicsnano-glass-spheresoptical-tweezerlaser-levitationquantum-sensorsroom-temperature-quantum-effectsUS tests nuclear fusion steel at 1112°F, finds flaw in radiation
Researchers at the University of Michigan have tested an advanced reduced activation ferritic/martensitic (RAFM) steel, designed for use in fusion reactors, at temperatures of 1112°F (600°C) under simulated radiation conditions. This steel, known as castable nanostructured alloy #9 (CNA9), contains billions of nanoscale titanium-carbide (TiC) particles intended to trap helium produced during fusion reactions and prevent material swelling. Using a novel dual ion beam technique to simultaneously induce radiation damage and helium implantation, the team found that while TiC particles effectively trapped helium at lower radiation levels, they began to dissolve at high damage levels (50 to 100 displacements per atom), causing the steel to swell by about 2%. This unexpected dissolution of TiC precipitates at high radiation doses challenges previous assumptions about the material's stability and highlights the need for further alloy refinement. The researchers suggest increasing the density of TiC particles by a factor of 1,000 to
energymaterialsnuclear-fusionsteel-alloysradiation-tolerancetitanium-carbidefusion-reactor-materialsZeekr 7X Awarded 5-Star Euro NCAP Rating - CleanTechnica
The Zeekr 7X, an all-electric midsize SUV, has received the highest possible 5-star safety rating from Euro NCAP, scoring 91% for Adult Occupant Protection, 90% for Child Occupant Protection, and 83% for Safety Assist. This achievement follows similar 5-star ratings awarded to the Zeekr 001 and Zeekr X models in 2024, making every Zeekr vehicle offered in Europe Euro NCAP 5-star rated. The 7X benefits from the SEA modular vehicle architecture, which incorporates ultra-high strength steel and a unique large aluminum casting for the rear underbody to enhance body stiffness and occupant protection. In addition to its robust structural safety, the Zeekr 7X features an extensive suite of advanced driver assistance systems (ADAS), including Autonomous Emergency Braking with pedestrian and cyclist detection, Adaptive Cruise Control, Automated Lane Change Assist, and Child Presence Detection. A notable safety innovation is its mechanical, electrically independent
energymaterialsadvanced-driver-assistance-systemselectric-vehiclesautomotive-safetyultra-high-strength-steelaluminium-castingNew algae-based blue dye could replace synthetic food colorant
Researchers at Cornell University have developed a stable, vibrant blue food dye derived from phycocyanin, a protein found in algae, offering a natural alternative to synthetic blue dyes commonly used in the food industry. Blue pigments are rare in nature, making synthetic dyes like Blue No. 1 and Blue No. 2 prevalent despite growing consumer concerns and regulatory pressures. The team overcame phycocyanin’s traditional instability under heat and light by using a denaturant to break the protein into smaller, uniform fragments that retain their blue color and function as effective emulsifiers, potentially replacing multiple synthetic additives simultaneously. This innovation addresses increasing demand for “clean label” ingredients free from artificial chemicals amid bans and restrictions on synthetic dyes due to health concerns such as hyperactivity and toxicity. Supported by the U.S. Department of Agriculture, the researchers aim to scale the technology with industry partners, emphasizing that the cost of this algae-based dye is likely reasonable when considering health benefits and consumer preference. Published in Food Hydro
materialsalgae-based-dyenatural-food-colorantphycocyaninprotein-engineeringsustainable-materialsfood-chemistryUS Coast Guard Report on Titan Submersible Implosion Singles Out OceanGate CEO Stockton Rush
The US Coast Guard’s Marine Board of Investigation released a critical report on the 2023 Titan submersible implosion, placing primary responsibility on OceanGate CEO Stockton Rush for numerous technical and managerial failures. The report accuses Rush of repeatedly misrepresenting the Titan as indestructible and highlights significant discrepancies between OceanGate’s written safety protocols and actual practices. The investigation, chaired by Jason Neubauer, emphasized that Rush’s leadership style fostered a toxic workplace environment that discouraged employees from raising safety concerns. Notably, the Titan was not registered, inspected, or certified by any recognized authority, and Rush allegedly lied about the submersible’s specifications during his Coast Guard credential application. The report details multiple technical flaws with the Titan’s innovative carbon fiber hull, including a history of operational failures such as a titanium dome detaching in 2021 and exposure to freezing conditions that could degrade the composite material. It suggests the fatal implosion at approximately 3,000 meters depth was likely caused by either
materialscarbon-fiber-compositestitaniumsubmersible-technologysafety-protocolsmarine-engineeringstructural-integrityHow engineers are reinventing coastal protection
The article "How engineers are reinventing coastal protection" highlights the urgent need to rethink flood defense strategies in the face of increasing coastal risks driven by climate change. With nearly a billion people in low-lying cities vulnerable to coastal hazards by 2100, and global coastal defense costs projected to rise from tens of billions annually to potentially hundreds of billions by 2050, engineers are tasked with developing more resilient and adaptive solutions. Traditional approaches based on hard infrastructure, such as concrete seawalls, are being reconsidered due to their high costs, maintenance demands, and catastrophic failure risks if overtopped. A key focus of the article is the comparison between "gray" (hard) infrastructure and "green" (nature-based) solutions. Gray infrastructure like seawalls and rock breakwaters typically have high capital costs ($5,600–18,500 per foot for seawalls), long design lives (50–100+ years), but pose risks of sudden catastrophic failure. In contrast, green infrastructure such as veget
energymaterialscoastal-engineeringflood-defenseclimate-adaptationinfrastructuregreen-infrastructure2D InSe wafer outperforms silicon in mobility, switching, leakage
Chinese scientists have achieved a major breakthrough by fabricating the world’s first wafer-scale, two-dimensional indium selenide (InSe) semiconductor chip, which outperforms silicon in key performance metrics. Using a novel “solid–liquid–solid” growth method, the team led by Professor Liu Kaihui at Peking University produced a 2-inch InSe wafer with exceptional crystal quality, phase purity, and thickness uniformity. The resulting InSe-based transistors demonstrated electron mobility up to 287 cm²/V·s, ultra-low subthreshold swings, minimal leakage at sub-10nm gate lengths, high on/off ratios, and energy-delay products surpassing the 2037 International Roadmap for Devices and Systems (IRDS) benchmarks. This advancement overcomes longstanding challenges in synthesizing large-area InSe due to vapor pressure differences and phase instability, by maintaining a perfect atomic ratio of indium and selenium during growth. The process is compatible with existing CMOS technology, facilitating potential real
materialssemiconductorindium-selenide2D-materialswafer-scale-growthtransistor-technologynext-generation-chipsPlastics cost world $1.5 trillion in health damages yearly: Report
A recent expert review highlights the escalating global health crisis caused by plastics, estimating that plastic-related diseases cost the world at least $1.5 trillion annually. Since 1950, plastic production has surged over 200 times and is projected to nearly triple by 2060, driven largely by single-use items like fast-food containers and beverage bottles. The report emphasizes that plastics pose dangers at every stage—from fossil fuel extraction and production to waste disposal—contributing to air pollution, toxic chemical exposure, and microplastic contamination in humans. Plastic pollution also facilitates disease spread by creating mosquito breeding grounds in littered waste. The environmental impact is severe, with over 8.8 billion US tons of plastic waste polluting ecosystems worldwide, from Mount Everest to the Mariana Trench, and less than 10% of all plastic ever produced has been recycled. The report calls for urgent international action, particularly as over 100 countries push for a legally binding global plastics treaty to cap production, though opposition remains from oil
materialsplastic-pollutionhealth-impactenvironmental-crisisplastic-productionrecycling-challengesglobal-plastics-treatyChina deploys breakthrough super steel to build nuclear fusion plant
China has developed a breakthrough alloy called CHSN01 (China high-strength low-temperature steel No 1) specifically engineered for the extreme conditions inside nuclear fusion reactors. This steel can withstand intense magnetic fields up to 20 Tesla and pressures of 1,300 MPa at cryogenic temperatures, addressing a longstanding challenge in fusion technology materials. After more than a decade of research and development—including key improvements in alloy composition and toughness—CHSN01 was successfully integrated into the construction of China’s BEST fusion reactor, which began assembly in 2023 and aims for completion by 2027. China’s fusion ambitions surpass those of international projects like ITER, which is designed primarily for research and operates at lower magnetic field strengths (up to 11.8 Tesla). Chinese scientists, led by researchers such as Li Laifeng and supported by renowned physicist Zhao Zhongxian, set stringent material standards in 2021 to enable stronger, more durable reactor components. The development of CHSN01 involved a national
materialsnuclear-fusionsuperconducting-magnetshigh-strength-steelcryogenic-materialsChinaenergySelf-cleaning glass from China uses electric fields to remove dust
Chinese scientists at Zhejiang University have developed an innovative self-cleaning glass that uses electric fields to remove dust and particles from its surface efficiently. This thin, transparent glass (0.62 mm thick) is embedded with electric-field-driven electrodes that can clean itself within seconds, erasing up to 98% of both organic and inorganic particles without the need for water, chemicals, or significant energy. The technology leverages the unexpected behavior of charged particles exposed to alternating electric fields, causing some particles to reverse direction or jump off the surface entirely, enabling effective dust removal even in dry, dusty conditions where traditional cleaning methods struggle. Beyond removing existing dust, the glass also prevents new dust from settling by deflecting charged airborne particles, a phenomenon the researchers call the "particle shielding effect," which reduces dust buildup by nearly 90%. The glass maintains high transparency, with minimal reduction in visible light and most light loss occurring in the infrared spectrum, making it suitable for applications requiring clear visibility and energy efficiency, such as
materialsself-cleaning-glasselectric-fieldsdust-removalsustainable-technologysolar-panel-maintenanceparticle-shielding-effectWorld's largest-scale brain-like computer with 2 billion neurons unveiled
Chinese engineers at Zhejiang University and Zhejiang Lab have unveiled "Darwin Monkey," the world’s largest-scale brain-like neuromorphic computer, designed to mimic the macaque monkey brain. The system integrates 960 third-generation Darwin 3 neuromorphic computing chips across 15 blade-style servers, supporting over 2 billion spiking neurons and more than 100 billion synapses. This neuron count approaches that of a macaque brain, enabling advanced cognitive functions such as vision, hearing, language, learning, logical reasoning, content generation, and mathematical problem-solving. The Darwin 3 chips feature specialized brain-inspired instruction sets and an online neuromorphic learning mechanism, marking a significant technological breakthrough in brain-inspired computing and operating systems. Consuming approximately 2,000 watts during typical operation, Darwin Monkey represents the first neuromorphic brain-like computer based on dedicated neuromorphic chips. The system can run large brain-like models such as DeepSeek, demonstrating its capacity for complex intelligent applications. This development follows similar
materialsneuromorphic-computingbrain-like-computerneural-processing-unitsadvanced-chipsenergy-consumptionartificial-intelligenceRemarkable longevity of Roman concrete could build sustainable future
A recent study published in iScience explores the remarkable longevity and sustainability potential of ancient Roman concrete, which has endured for over two millennia in structures like aqueducts and bridges. Researchers compared Roman concrete recipes—using locally sourced rocks, volcanic pozzolan, and recycled rubble—with modern concrete formulations that mix sand, gravel, and limestone. While Roman concrete did not significantly reduce carbon emissions or energy demand compared to modern concrete, it notably lowered emissions of air pollutants such as nitrogen and sulfur oxides by 11% to 98%. Additionally, its exceptional durability means it requires less maintenance and repair, potentially reducing the environmental impact over time by prolonging the lifespan of concrete structures. The study highlights that modern concrete production contributes approximately 8% of global CO2 emissions and 3% of total energy demand, driving the search for greener alternatives. Although simply adopting Roman concrete recipes today may not substantially cut emissions, the research suggests that combining ancient Roman techniques with modern innovations could lead to more sustainable construction materials
materialssustainable-concreteRoman-concreteconstruction-industrydecarbonizationcarbon-footprintdurabilityVintage Levi's denim gives classic Porsche 911 stunning design aesthetic
Designer Sean Wotherspoon, known for his distinctive color-blocking style, collaborated with a small team to transform a classic Porsche 911 Carrera 2.7RS from collector Philip Sarofim’s garage. The eight-month project blends automotive history with vintage streetwear aesthetics, featuring a meticulously detailed exterior where each panel was individually painted in a color palette inspired by Wotherspoon’s past projects and historical automotive references, including hues originally developed for Meyers Manx. This approach echoes the aesthetic of Wotherspoon’s earlier Harlequin Golf project, emphasizing a fusion of unique color schemes aligned with the original RS silhouette. Inside, the car’s cabin showcases a textured mix of vintage materials such as Levi’s denim, corduroy, and flannel sourced from 1960s garments, alongside a cork dashboard repurposed from Wotherspoon’s previous Porsche Taycan project. The interior design highlights themes of reuse and repair, with functional Levi’s pockets integrated into the door cards and patchwork lining
materialsautomotive-designvintage-deniminterior-designPorsche-911sustainable-materialscar-restorationRich Bronze Age grave from Iran hints ancient woman's power status
Archaeologists have uncovered the richest Bronze Age tomb to date at Tepe Chalow in eastern Iran, part of the recently identified Greater Khorasan Civilization (GKC). This necropolis, first excavated in 2011, revealed Grave 12, belonging to a young woman under 18, filled with 24 exquisitely crafted grave goods such as pottery, gold jewelry, bronze objects, and stone artifacts made from materials like lapis lazuli and chlorite. The presence of multiple seals among her belongings strongly suggests she held a significant social and economic role, indicating that women in the GKC may have enjoyed prominent status within this progressive society. The GKC was a major Bronze Age urban culture spanning northeastern Iran into parts of modern Turkmenistan, Afghanistan, and Uzbekistan, with extensive trade networks linking it to Mesopotamia, the Indus Valley, and the Persian Gulf. Archaeological evidence points to the civilization’s wealth and sophistication, with Grave 12 providing unprecedented insights into its
materialsbronze-ageancient-tradearchaeologybronze-artifactslapis-lazuliancient-metallurgyPeacock Feathers Are Stunning. They Can Also Emit Laser Beams
A recent study published in Scientific Reports reveals that peacock feathers, known for their vivid iridescent colors produced by nanostructured photonic crystals, can also emit laser light when repeatedly dyed. Unlike pigments, the feathers’ colors arise from the precise periodic arrangement of melanin rods coated in keratin within the barbules, which act as tunable photonic crystals that selectively reflect certain wavelengths. By staining the feathers multiple times with dye and then exciting them with light pulses, researchers observed laser emissions at two distinct wavelengths across the feathers’ eyespot regions, with green areas producing the strongest laser light. Single staining was insufficient to induce lasing, likely due to limited dye diffusion and structural constraints. Although the exact microstructures responsible for the laser effect remain unidentified, the study suggests that protein granules or other small internal features, rather than the keratin-coated melanin rods themselves, may serve as the laser cavity. This discovery not only advances understanding of natural photonic structures but also holds promise for
materialsphotonic-crystalsbiolasernanostructuresiridescencebiomimicryoptical-materials2,000-year-old Chinese technique found to double artillery gun lifespan
Chinese researchers have developed a technique inspired by a 2,000-year-old anti-corrosion method used on bronze weapons from the Qin dynasty Terracotta Army, significantly extending the lifespan of modern artillery barrels. The ancient method involved a thin chromium salt coating that preserved weapons underground for millennia. Building on this, the team at the Northwest Institute of Mechanical and Electrical Engineering in Xianyang created a dual-layer chromium coating for artillery barrels: a soft, ductile inner layer applied at low temperature and current to reduce pores and internal stress, and a hard, wear-resistant outer layer applied at higher temperature and current. This layered structure acts as a barrier to crack propagation, similar to laminated safety glass. Testing showed that barrels with the dual-layer coating experienced 23% less wear at room temperature compared to standard single-layer chromium plating, and significantly less wear at elevated temperatures (33% increase versus 98% for conventional chrome at 600°C). Live-fire tests with 400 rounds revealed that dual-layer barrels maintained
materialschromium-coatinganti-corrosionartillery-barrelswear-resistancedual-layer-coatingmaterial-scienceFrozen organic particles mapped in stunning new imaging method
Researchers at Tohoku University have developed an advanced cryo-electron microscopy technique that overcomes longstanding challenges in mapping the elemental composition of frozen organic and biological nanoparticles. Traditional cryo-transmission electron microscopy (cryo-TEM) excels at revealing the size and structure of delicate samples preserved in a near-natural frozen state but struggles to accurately identify elemental makeup due to background noise from ice and image drift during scanning. Existing methods like energy-filtered TEM (EF-TEM) and electron energy loss spectroscopy (EELS) often damage samples or produce blurred images, limiting their use primarily to metals or bulk materials. The new approach refines the “3-window method” for background correction to effectively remove interference from ice in frozen samples and incorporates a drift compensation system to stabilize images during long elemental scans. Additionally, a software extension automates energy shift adjustments, enhancing the precision and efficiency of elemental mapping. This breakthrough enabled researchers to clearly visualize silicon distribution in silica nanoparticles as small as 10 nanometers and to map
materialscryo-electron-microscopyelemental-mappingnanomaterialsimaging-technologyelectron-energy-loss-spectroscopybiological-materialsScientists rewrite life’s code to create virus-resistant bacteria
Researchers at the MRC Laboratory of Molecular Biology in Cambridge have engineered a synthetic strain of Escherichia coli, named Syn57, that operates with only 57 codons instead of the standard 64 used by nearly all known life forms. This represents the most radically compressed genetic code created to date. By removing redundant codons—specifically seven codons including those for serine, alanine, and one stop signal—the team replaced over 101,000 codon instances across the bacterium’s 4-megabase genome. The genome was reconstructed from 38 synthetic DNA fragments assembled using a novel technique called uREXER, which combines CRISPR-Cas9 and viral enzymes for precise DNA swapping. Syn57 retains normal growth and function despite its streamlined genetic code, freeing up codons that can be reassigned to incorporate non-canonical amino acids and produce novel synthetic polymers and materials with programmable properties. Importantly, the recoded genome may confer resistance to many viruses that depend
materialssynthetic-biologygenetic-engineeringpolymersbioengineeringvirus-resistancebiotechnologyPeacocks can shoot lasers from tail feathers, scientists discover
Scientists from Florida Polytechnic University and Youngstown State University have discovered that peacock tail feathers can emit narrow beams of laser light when infused with dye and energized by an external light source. The research revealed that the colored eyespots on the feathers contain tiny reflective structures capable of amplifying light into laser emissions at two distinct frequencies, primarily in the yellow-green spectrum. This phenomenon represents the first known example of a biolaser cavity in the animal kingdom. The feathers required multiple staining cycles with dye before laser emission was observed, and the greatest laser intensity was found in the green color regions of the eyespots. The study involved repeatedly wetting the peacock feathers with dye solutions, drying them, and then stimulating them with pulsed light to measure emissions. While the researchers confirmed the presence of laser light emission, they were unable to pinpoint the exact microstructures responsible for the lasing effect. It is suggested that protein granules or similar small internal structures, rather than the keratin-coated melanin rods, might
materialsbiolaserphotonic-structurespeacock-featherslaser-emissionbiomaterialsoptical-materialsQuantum Liquid Crystal: New state of matter found by US scientists
Researchers at Rutgers University have discovered a new quantum state of matter called the quantum liquid crystal by combining two exotic materials—Weyl semimetal and spin ice—under extremely high magnetic fields. Weyl semimetals are known for allowing electricity to flow rapidly without energy loss due to quasiparticles called Weyl fermions, while spin ice exhibits unique magnetic properties resembling hydrogen atom arrangements in ice. The interaction between these two materials at high magnetic fields led to the emergence of a novel quantum topological state, characterized by electronic anisotropy, where electrical conductivity varies depending on direction. The team observed that within a full 360-degree rotation, the material’s conductivity was lowest along six specific directions, and increasing the magnetic field caused electrons to flow in opposite directions, indicative of rotational symmetry breaking—a hallmark of new quantum states. This discovery was made possible through extensive experimental work at the National High Magnetic Field Laboratory and advanced theoretical modeling by Rutgers physicists, which took over two years to fully understand. The
materialsquantum-liquid-crystalWeyl-semimetalspin-iceexotic-materialsquantum-state-of-matterelectronic-anisotropyYou may be inhaling 68,000 microplastics a day inside your home
A recent study by French scientists reveals that people may be inhaling up to 68,000 microplastic particles daily inside their homes and cars, far exceeding previous estimates. Using advanced Raman spectroscopy, researchers detected plastic particles predominantly smaller than 10 micrometers—tiny enough to penetrate deep into the lungs and potentially enter the bloodstream. These microplastics originate from the degradation of common household items such as carpets, curtains, paint, textiles, and especially car interiors, which contain numerous plastic-based materials that shed particles due to heat, friction, and sunlight exposure. The study highlights a significant but overlooked source of microplastic pollution: indoor air, where people spend about 90% of their time. Unlike prior research focused on oceans or outdoor environments, this work emphasizes the intimate exposure risks within everyday living spaces. The health implications are concerning, as inhaled microplastics may cause respiratory inflammation and carry toxic additives like bisphenol A and phthalates, which are linked to various health problems including endocrine
materialsmicroplasticsindoor-air-pollutionplastic-pollutionhealth-risksenvironmental-scienceair-qualityNew enzyme trick could slash chemical waste in drug production
Researchers at the University of Basel have engineered a natural haemoprotein enzyme to catalyze metal hydride hydrogen atom transfer (MHAT) reactions, a synthetic method crucial for creating complex three-dimensional molecules used in drug and fine chemical manufacturing. This breakthrough marks the first time an enzyme has been shown to perform MHAT reactions, combining the high selectivity and mild conditions of enzymatic catalysis with the versatility of synthetic chemistry. The engineered enzyme demonstrated exceptional stereoselectivity, producing desired enantiomers in ratios up to 98:2, which is significant for drug development where different enantiomers can have vastly different biological effects. While this hybrid biocatalytic approach offers greener, more efficient chemical synthesis with reduced waste, challenges remain. The enzyme’s high specificity limits its use to a narrow range of substrates, requiring redesign for different starting materials—a process that demands time and expertise. Additionally, the team is seeking more environmentally friendly methods to generate the metal hydride catalysts integral to the reaction.
materialsenzyme-engineeringbiocatalysisgreen-chemistrychemical-synthesisdrug-productionstereoselectivityGold coating breakthrough boosts quantum chip stability and scale
Researchers at the University of California, Riverside, led by physicist Peng Wei, have developed a breakthrough technique to enhance the stability and scalability of quantum chips by applying an ultra-thin gold coating to superconducting materials. Quantum computers rely on qubits, which are highly sensitive to environmental noise and microscopic material defects that disrupt their fragile quantum states. Wei’s team addressed this by depositing a uniform gold layer about ten atoms thick onto niobium, a common superconducting metal used in quantum processors. This gold layer smooths out surface imperfections that typically trap Cooper pairs—electron pairs responsible for superconductivity—thereby reducing noise and preserving qubit coherence without impairing the superconducting properties. The gold coating acts as a chemically inert, stable shield that prevents oxidation and environmental interference, striking a balance between thickness and superconductivity. This innovation is compatible with existing chip fabrication processes, making it attractive for commercial quantum computing development. The technique has garnered interest from leading institutions such as MIT, NIST, and SEEQC
materialsquantum-computingsuperconducting-materialsgold-coatingqubit-stabilityquantum-chipnanotechnologyScientists simulate icy moon volcanoes that could reveal alien life
Scientists from the University of Sheffield, the Open University, and the Czech Academy of Sciences have successfully simulated the extreme conditions of cryovolcanic activity on icy moons such as Europa and Enceladus. Using a specialized low-pressure chamber called the Large Dirty Mars Chamber, they recreated near-vacuum environments where water simultaneously boils and freezes, mimicking the geologic processes that reshape these moons. Their experiments revealed that under low pressure, water forms a thin ice layer while continuing to boil underneath, allowing liquid to escape through cracks—contradicting previous assumptions that a thick ice crust would seal off the water. This new understanding of water behavior under cryovolcanic conditions provides insights into effusive cryovolcanism, a process difficult to observe astronomically but crucial for interpreting surface changes on icy moons. The findings, published in Earth and Planetary Sciences Letters, could help scientists identify ancient signs of cryovolcanic activity on these moons and other celestial bodies. Such markers may guide future exploration
materialscryovolcanismicy-moonswater-behaviorplanetary-scienceextraterrestrial-geologysimulation-technologyHow a New Jersey startup found an electrifying way to slash copper costs
Still Bright, a New Jersey startup founded in 2022, has developed an innovative and environmentally friendly method to extract copper more efficiently from existing ores and tailings. With global copper demand set to surge due to the transition away from fossil fuels, traditional mining faces challenges such as limited easily accessible ores and the need for numerous new mines. Still Bright’s technology uses a vanadium-based solution to soak copper-containing ores, extracting nearly all the copper without the pre-processing losses typical in conventional methods. The solution is regenerated electrically, inspired by vanadium flow battery technology, enabling a cleaner process that avoids the harmful pollution associated with burning unwanted ore components. The startup’s modular system is compact and cost-effective, with equipment 70% to 90% cheaper than traditional pyrometallurgical refining gear, and processes copper rapidly—within minutes to an hour. Although currently operating at pilot scale producing two tons annually, Still Bright plans to build a demonstration unit by 2027 or 2028 capable of producing
energymaterialscopper-extractionvanadium-flow-batterymining-technologysustainable-miningclean-energy-technologyUK firm’s bricks turn waste soil into walls that breathe in carbon
UK-based sustainable materials company earth4Earth (e4E) has developed innovative bricks made from excavated soil and a unique lime-based binder that capture and permanently store atmospheric carbon dioxide (CO₂). Unlike traditional lime binders, which require high-temperature processing that emits CO₂, e4E’s binder is produced at room temperature and stores all CO₂ generated during manufacturing as stable carbonates, eliminating emissions. These bricks use Direct Air Capture (DAC) technology to absorb CO₂ from the air, turning buildings constructed with them into carbon sinks while enhancing the bricks’ material properties. e4E offers a product line with varying binder content—N10, N20, and N30 bricks containing 10%, 20%, and 30% binder respectively—where higher binder percentages correspond to increased carbon absorption. The company has pilot projects underway in the UK and plans to begin local production next year, creating around 30 jobs. With a research center in Sheffield and a factory in Wuhan, China,
materialssustainable-materialscarbon-capturecarbon-storageconstruction-innovationeco-friendly-bricksdecarbonizationPhotonic chip sets loss record, boosts quantum computing scale
Xanadu and HyperLight have jointly achieved a significant breakthrough in photonic chip technology, crucial for advancing scalable photonic quantum computers. By refining the fabrication process of thin-film lithium niobate (TFLN) chips, they reduced waveguide loss to below 2 dB per meter and electro-optic switch loss to just 20 milli-decibels (mdB), setting new industry records for low-loss performance. Importantly, these chips were produced using high-volume semiconductor manufacturing processes, demonstrating readiness for commercial-scale deployment and marking a key milestone in Xanadu’s 2025 hardware roadmap. This advancement addresses a critical challenge in photonic quantum computing, where minimizing optical loss is essential to reduce errors and enable scaling. The low-loss waveguides and switches allow photons to be guided and rerouted with minimal signal degradation, supporting the development of large-scale, fault-tolerant quantum computers. Building on their previous collaboration in the Aurora project—the world’s first fiber-networked photonic quantum
materialsphotonic-chipsquantum-computinglithium-niobatesemiconductor-fabricationelectro-optic-switchesquantum-hardwarePresident Trump gets new bulletproof golf truck for ‘safe swings’
President Donald Trump has been provided with a new heavily armored golf utility vehicle, dubbed “Golf Force One,” which was recently seen accompanying him and his son Eric at the Trump Turnberry golf course in Scotland. The Polaris Ranger X-based vehicle is part of the Presidential fleet and offers ballistic protection tailored for rapid off-road response, addressing the unique security challenges posed by open golf course environments. The vehicle’s armor modifications, likely costing up to $190,000, provide scalable ballistic resistance depending on threat levels, ranging from protection against blunt objects to sniper rifles. The introduction of this armored golf buggy follows several recent security incidents involving Trump, including an attempted shooting at his Florida golf club in 2024 and a prior attack during a campaign event. Given Trump’s frequent golfing and tendency to drive his cart away from nearby Secret Service agents, the new vehicle aims to enhance his protection by offering faster emergency response and cover. The Secret Service has not disclosed specific details about the vehicle or its modifications, citing operational security,
materialsenergysecurity-technologyarmored-vehiclesballistic-protectionPolaris-Rangerspecialty-vehiclesSilica from meteorites may hold key to controlling industrial heat
Researchers at Columbia University have identified a unique form of silicon dioxide called tridymite, originally found in meteorites and also present on Mars, which exhibits hybrid crystal-glass thermal properties. Unlike typical materials where thermal conductivity either decreases (crystals) or increases (glasses) with temperature, tridymite maintains a nearly constant thermal conductivity over a wide temperature range (80 K to 380 K). This discovery was made possible by applying a unified equation for heat conduction in both crystals and glasses, developed by Professor Michele Simoncelli’s team using machine learning to overcome computational challenges. Experimental validation was conducted on a tridymite sample from a 1724 meteorite found in Germany, confirming its intermediate atomic structure and stable heat conduction behavior. This breakthrough has significant implications for industrial heat management, particularly in sectors like electronics, aerospace, and steel manufacturing. For instance, tridymite could form in refractory bricks used in steel furnaces after prolonged thermal aging, potentially enabling more efficient heat control and reducing the
materialsthermal-conductivitysilicon-dioxidetridymiteheat-managementcrystal-glass-hybridaerospace-materialsThe science behind plastic recycling and why it needs a rethink
The article explores the challenges and limitations of plastic recycling, emphasizing that the issue extends beyond consumer behavior to fundamental thermodynamic, chemical, and engineering constraints. Since the invention of the first man-made plastic, Parkesine, in 1862, plastics have evolved into a diverse range of durable materials that have become ubiquitous in daily life. However, by the late 1960s, scientists began detecting widespread plastic pollution in the environment, prompting the adoption of recycling as a solution. Although recycling initially appeared promising by reducing waste and conserving resources, it has revealed significant drawbacks over time, including high costs, inefficiencies, toxicity concerns, and the release of microplastics. The article details the three main recycling methods: mechanical, chemical, and energy recycling. Mechanical recycling, the most common commercial method, involves collecting, sorting, washing, and reprocessing plastics like PET and HDPE but is limited by contamination and material degradation. Chemical recycling, a newer approach, aims to break down plastics to their original raw
materialsplastic-recyclingpolymer-sciencechemical-recyclingsustainable-materialswaste-managementenvironmental-engineeringWorld’s smallest spectrometer delivers full scan under one volt
Researchers at North Carolina State University have developed the world’s smallest spectrometer prototype, measuring just a few square millimeters, small enough to be integrated into smartphones or even function as a single pixel in sensor arrays. This compact device can detect light across a broad spectrum, from ultraviolet to near-infrared, by using a specially designed photodetector whose sensitivity varies with applied voltage. By sweeping voltages under one volt and recording the photodetector’s responses, the system computationally reconstructs the full light spectrum reflected or transmitted by materials. The process is rapid, occurring in under a millisecond, and avoids the need for complex optics or high-voltage inputs that have traditionally hindered miniaturization. In laboratory tests, the prototype demonstrated accuracy and sensitivity comparable to conventional commercial spectrometers and photodetectors. Its low voltage operation, fast response, and broad spectral sensitivity mark a significant advancement toward consumer-level spectroscopy. The research team envisions this technology enabling new applications by embedding spect
materialsspectroscopyminiaturizationphotodetectorschemical-analysissensor-technologylow-voltage-devicesSpaceship-style LA museum to launch in 2026 with sci-fi treasures
The Lucas Museum of Narrative Art, designed by MAD Architects, is set to open in Los Angeles in 2026 after years of delays and a relocation from its originally planned Chicago site. The futuristic, spaceship-like structure in Exposition Park features over 300,000 square feet across five floors, including galleries, theaters, and event spaces. Its façade is composed of more than 1,500 curved fiberglass-reinforced polymer panels and glass, with green landscaping and elevated public areas. The museum’s collection spans global narrative art and media, showcasing works by artists such as Norman Rockwell, Frida Kahlo, and Gordon Parks, alongside props and artifacts from George Lucas’s film legacy, including Star Wars. George Lucas and his wife Mellody Hobson envisioned the museum as a tribute to illustrators and narrative art, emphasizing its role in inspiring imagination and achievement, particularly in science fiction. The museum aims to honor often overlooked visual storytellers and serve as a cultural landmark blending architecture, art, and
materialsenergysustainable-architecturefiberglass-reinforced-polymereco-friendly-technologygreen-buildingrenewable-energy-systemsHypersonic leap: China’s zirconium discovery boosts reserve 5-fold
China has discovered a massive new reserve of zirconium-bearing minerals in the northern Tarim Basin of Xinjiang province, estimated to be about four times larger than the country's existing zirconium reserves. This is the first significant onshore zirconium deposit found in China, located in sedimentary layers dating from the Paleogene and Neogene eras. The deposit’s average zircon content exceeds 0.2%, and it can potentially be extracted using less energy-intensive methods than usual. This discovery challenges the prevailing notion that large zirconium deposits are primarily found near coastal areas, opening new avenues for geological exploration inland. Zirconium, primarily extracted from the mineral zircon, is a critical metal used extensively in nuclear reactors, hypersonic vehicles, jet engines, and space shuttle components due to its corrosion resistance, high-temperature stability, and low neutron absorption. Despite its relative abundance in the Earth's crust, refining zirconium is costly and complex. China is already a major global producer alongside Australia, Indonesia, South Africa,
materialszirconiumrare-metalshypersonic-technologynuclear-energyChinamineral-reservesTesla confirms $16.5 billion Samsung deal for next-gen chip supply
Samsung Electronics has secured a $16.5 billion semiconductor supply deal with Tesla to produce next-generation AI chips, confirmed by both Samsung’s regulatory filing and Elon Musk’s social media announcement. The contract, effective from July 26, 2024, through December 31, 2033, involves Samsung’s new Texas semiconductor fabrication plant dedicated to manufacturing Tesla’s AI6 chips. Musk highlighted the strategic importance of this partnership, noting that Samsung currently produces AI4 chips while TSMC handles AI5 chips, with Tesla collaborating closely with Samsung to optimize manufacturing efficiency. Although Samsung has kept full contract details confidential to protect trade secrets, the deal’s scale and duration underscore its significance. This agreement represents a major boost for Samsung’s foundry business, which has been striving to catch up with competitors like TSMC in the rapidly growing AI chip market. Samsung is advancing its semiconductor technology, including plans for mass production of 2-nanometer chips that offer improved speed and energy efficiency—technology expected to
energymaterialssemiconductorAI-chipsTeslaSamsungmanufacturingNo wires needed: German physicists control electronics with light pulses
German physicists at Bielefeld University have developed a novel method to control atomically thin semiconductors using ultrashort pulses of terahertz light instead of traditional electrical signals. By employing terahertz radiation—electromagnetic waves between infrared and microwave frequencies—and specialized nanoantennas that convert this light into extremely strong, vertical electric fields within the semiconductor, they achieved switching speeds on the order of femtoseconds to picoseconds (trillionths of a second). This approach eliminates the need for physical wires or bulky electronic components, enabling faster, more energy-efficient, and potentially miniaturized electronic devices. The team demonstrated their technique on molybdenum disulfide (MoS₂), a semiconductor only a few atoms thick, observing a Stark shift that confirmed the terahertz-induced electric field was effectively altering the material’s electronic properties in real time. This coherent, non-contact control mechanism could revolutionize electronics by enabling light-controlled transistors, ultrafast data transmission, advanced
materialssemiconductorsterahertz-lightultrafast-electronicsnanoantennasenergy-efficient-technologyatomically-thin-materialsIn a first, transmon qubit achieves a coherence time of one millisecond
Researchers at Aalto University in Finland have achieved a breakthrough in quantum computing by extending the coherence time of a superconducting transmon qubit to over one millisecond, with a median coherence time of about 0.5 milliseconds. This marks a new world record, significantly surpassing the previous best echo coherence times of around 0.6 milliseconds. The team accomplished this by using ultra-clean superconducting films, precise electron-beam lithography, and meticulous fabrication of Josephson junctions, all performed in a highly controlled cleanroom environment. Cooling the chip to near absolute zero and employing specialized low-noise amplifiers further preserved the qubit’s fragile quantum state. This advancement is crucial because longer coherence times allow qubits to perform more quantum operations before errors occur, enhancing the reliability and practicality of quantum computers. While this milestone is promising for the development of quantum sensors, simulators, and computers, scaling the technology to many qubits on a single chip with similar coherence remains a significant challenge. To
materialsquantum-computingsuperconducting-qubitstransmon-qubitcoherence-timequantum-technologyquantum-sensorsChina's researchers to resurrect 2,000-year-old earthquake sensor
Chinese researchers are working to reconstruct Zhang Heng’s ancient seismoscope, the Houfeng Didong Yi, originally invented in 132 AD and considered the world’s first earthquake detector. The device reportedly consisted of a bronze jar with eight dragons facing different compass directions, each holding a ball above a toad’s mouth. When an earthquake occurred, the dragon facing the quake’s direction would release its ball into the toad’s mouth, indicating the quake’s direction. Although historically celebrated, the device’s existence and functionality have been questioned, leading to its removal from Chinese textbooks in 2017. Xu Guodong, a researcher at China’s Institute of Disaster Prevention, has re-examined historical texts and developed a realistic reconstruction using modern engineering principles. His model uses a central pendulum that swings during an earthquake, triggering a lever system to release a ball from the corresponding dragon, with a locking mechanism ensuring only one ball drops per event. Xu’s calculations suggest the device could detect ground movements as small
materialsearthquake-detectionancient-technologysensor-reconstructionseismic-engineeringZhang-Henghistorical-sensorsChinese scientists detect rare quantum friction in folded graphene
Chinese scientists from the Lanzhou Institute of Chemical Physics, led by Professors Zhang Junyan and Gong Zhenbin, have experimentally observed quantum friction in folded graphene for the first time. By precisely folding graphene layers to create controlled curvature and internal strain, they altered electron behavior at the nanoscale. This strain forced electrons into fixed energy states called pseudo-Landau levels, reducing energy loss as heat and resulting in a nonlinear, sometimes decreasing friction pattern as the number of graphene layers increased. Their findings challenge classical friction models and provide the first direct evidence of quantum friction occurring between two solid surfaces. The research, conducted at ultra-low temperatures using a carefully engineered graphene system, opens new avenues for understanding friction at the atomic scale. The team plans to investigate whether similar quantum friction effects occur in other materials and under more practical conditions. Ultimately, this work could lead to technologies that better manage or minimize energy loss in nanoscale electronics and quantum computing devices by exploiting quantum friction phenomena. The study was published in Nature Communications
materialsgraphenequantum-frictionnanotechnologyenergy-efficiencynanomaterialsquantum-physicsNew framework clears spin-orbit confusion in solids and unifies physics
Physicists have developed a new theoretical framework that resolves longstanding difficulties in modeling spin-orbit coupling in solids, a phenomenon where an electron’s spin and motion are intertwined. Traditional quantum mechanical tools, particularly the orbital angular momentum operator, fail to accurately describe electron behavior in crystalline solids due to the lack of full rotational symmetry in atomic lattices. The new approach, termed relativistic spin-lattice interaction, bypasses these issues by focusing on how an electron’s spin interacts with the solid’s atomic structure using principles from relativity. This method aligns well with standard descriptions of electrons in crystals and respects the periodic atomic arrangement, overcoming limitations of earlier models. The researchers validated their framework across materials of different dimensionalities—a 3D semiconductor (gallium arsenide), a 2D insulator (hexagonal boron nitride), and a 1D conductor (atomic chains)—demonstrating improved accuracy in predicting spin behavior and reproducing key phenomena such as the Edelstein and spin Hall effects.
materialsspintronicsquantum-mechanicsspin-orbit-couplingelectron-spinsolid-state-physicsspin-lattice-interactionSafer non-stick breakthrough could end Teflon’s toxic dominance
Researchers at the University of Toronto have developed a new ultra-repellent non-stick coating that offers a safer alternative to traditional PFAS-based materials like Teflon, which are known for their environmental persistence and health risks. Their innovation uses a silicone base (polydimethylsiloxane, PDMS) enhanced through a technique called nanoscale fletching, where short PDMS chains are bonded to a base material and tipped with the shortest possible PFAS molecule—a single carbon atom bonded to three fluorine atoms. This design achieves oil and water repellency comparable to commercial PFAS coatings but significantly reduces toxicity and bioaccumulation concerns associated with long-chain PFAS. The new coating demonstrated high performance, scoring a 6 on a standard repellency scale used by the American Association of Textile Chemists and Colorists, matching many existing PFAS products. Importantly, the short-chain PFAS used does not bioaccumulate, addressing major regulatory and health issues linked to longer-chain variants. The
materialsnon-stick-coatingPFAS-alternativessiliconenanoscale-fletchingoil-repellencyenvironmental-safetyIn a first, artificial cell moves on its own using just chemistry
Scientists at the Institute for Bioengineering of Catalonia (IBEC) have created the first artificial cell capable of autonomous movement powered solely by chemical reactions, marking a significant breakthrough in synthetic biology. This minimal synthetic cell consists of just three components: a lipid membrane forming a vesicle, an enzyme inside it, and a membrane pore. When exposed to chemical gradients such as glucose or urea, the enzyme reacts with these molecules, generating an imbalance that drives fluid flow along the vesicle’s surface. The membrane pore creates the necessary asymmetry for propulsion, enabling the vesicle to move directionally toward higher concentrations through chemotaxis—mimicking natural cellular behaviors like bacteria swimming toward nutrients or immune cells moving to infection sites. This research not only demonstrates a simplified model of chemotaxis without complex biological machinery but also offers insights into early evolutionary mechanisms of cellular movement. The team tested over 10,000 vesicles in controlled microfluidic environments, confirming that vesicles with more pores exhibited stronger chem
materialssynthetic-biologyartificial-cellschemotaxisenzyme-reactionsmembrane-technologymicrofluidicsNew AI simulates 4 billion atoms to build carbon-neutral concrete
Researchers at USC Viterbi School of Engineering have developed Allegro-FM, an AI-powered simulation tool capable of modeling the behavior of over 4 billion atoms simultaneously with 97.5% efficiency. This represents a nearly 1,000-fold increase in scale compared to traditional models. Using the Aurora supercomputer at Argonne National Laboratory, Allegro-FM enables scientists to virtually test molecular compositions of concrete, accelerating the discovery of carbon-neutral, stronger, and fire-resistant formulations without costly lab experiments. The AI system can simulate complex atomic interactions across 89 chemical elements, making it versatile for applications beyond concrete, including carbon storage, battery chemistry, and biomedical devices. The key breakthrough is Allegro-FM’s ability to predict atomic interactions without relying on element-specific quantum mechanical equations, instead using machine learning trained on extensive datasets. This allows for highly accurate and efficient simulations of concrete’s mechanical and structural properties. The researchers found that incorporating CO₂ into concrete can trap carbon dioxide released during cement production,
materialsAI-simulationcarbon-neutral-concretesustainable-constructionatomic-modelingconcrete-durabilitycarbon-captureWorld's simplest artificial cell capable of chemical navigation unveiled
Researchers at the Institute for Bioengineering of Catalonia (IBEC) have developed the simplest artificial cell capable of chemical navigation, mimicking the chemotaxis behavior of living cells such as bacteria and white blood cells. This “minimal cell” is a tiny lipid vesicle encapsulating enzymes and membrane pore proteins, enabling it to actively move toward specific chemical substances like glucose or urea. The movement arises from an asymmetry created by enzyme reactions inside the vesicle and chemical exchange through pores, generating fluid flow that propels the vesicle directionally without the need for complex cellular machinery like flagella or signaling pathways. By analyzing over 10,000 vesicles, the researchers found that increasing the number of pores enhanced the chemotactic response, demonstrating a controllable, enzyme-driven navigation system. This minimalist synthetic biology approach helps uncover fundamental principles underlying cellular communication and transport by stripping down biological complexity to its core components. Beyond advancing understanding of cell function, the work also offers insights into how early simple cells
materialssynthetic-biologyartificial-cellschemotaxislipid-vesiclesenzyme-encapsulationbioengineeringRaindrops at rocket speeds: Water's impact on hypersonic craft revealed
A recent study has revealed how tiny water droplets, such as raindrops, can significantly affect hypersonic vehicles traveling at speeds exceeding Mach 5 (over 6,173 km/h). When these droplets impact a hypersonic aircraft or missile, they tend to break up into smaller droplets that become entrapped and accelerate near the vehicle’s surface. This interaction can disrupt the airflow around the vehicle and increase the likelihood of droplet impacts, especially with larger droplets, potentially affecting the vehicle’s structural integrity. The research team used advanced simulations combining Eulerian and Lagrangian frameworks to model the complex multiphase flow interactions between water droplets and hypersonic airflows. Their findings emphasize the importance of considering droplet breakup dynamics when estimating impact forces on hypersonic vehicles. This work not only aids in the design and development of next-generation hypersonic aircraft but also enhances the fundamental understanding of multiphase flows under extreme conditions. The researchers plan to conduct more detailed simulations to further explore individual
materialshypersonic-vehiclesfluid-dynamicsmultiphase-flowaerospace-engineeringsimulationdroplet-impactJapan’s beam tech transforms forever plastics into reusable feedstock
Researchers in Japan have developed an innovative electron beam technique to recycle polytetrafluoroethylene (PTFE), commonly known as Teflon, with significantly improved energy efficiency. By combining moderate heat with electron beam irradiation, the method fully decomposes PTFE at 370 °C (698 °F), which is substantially lower than the 600−1000 °C required by conventional pyrolysis. This approach cuts the energy consumption for recycling from 2.8–4 MWh per ton to roughly half, making large-scale recycling of this durable fluoropolymer more economically viable. The process converts solid PTFE into gaseous oxidized fluorocarbons and perfluoroalkanes, which can potentially be captured and reused as raw materials in chemical manufacturing, promoting a circular economy for these persistent plastics. The research also found that high-temperature irradiation alters the internal structure of PTFE, enhancing its decomposition efficiency. PTFE belongs to the PFAS family, often called “forever chemicals” due
energymaterialsrecyclingelectron-beam-technologyPTFEfluoropolymerssustainable-manufacturingWorld’s largest laser crystal could help China strike satellites
Chinese scientists at the Hefei Institutes of Physical Science have developed the world’s largest barium gallium selenide (BGSe) crystal, measuring 60 millimeters in diameter, designed to enhance long-range laser systems and infrared sensing technologies. This synthetic crystal can convert short-wave infrared lasers into mid- to far-infrared beams, which travel longer distances through the atmosphere with minimal loss. Notably, the crystal withstands laser energy intensities up to 550 megawatts per square centimeter—about ten times higher than most current military-grade materials—making it suitable for ultra-high-power laser applications that previously failed due to internal damage. The creation of this crystal involved a decade of precise, controlled processes, including high-temperature melting, slow cooling, annealing, and meticulous polishing to ensure optical clarity and structural integrity. While the research paper does not explicitly confirm military use, the timing and capabilities of the crystal align with China’s growing interest in directed-energy weapons and space defense, suggesting potential applications
materialslaser-technologysynthetic-crystalsenergy-durabilityinfrared-sensingbarium-gallium-selenidehigh-power-lasersAncient Buddhist scroll virtually unrolled with battery imaging tech
Researchers at the Helmholtz-Zentrum Berlin (HZB) have successfully used advanced 3D X-ray tomography combined with artificial intelligence to virtually unroll and read ancient silk-wrapped Buddhist scrolls from a Mongolian Gungervaa shrine housed at the Ethnological Museum in Berlin. These tiny scrolls, measuring just a few centimeters, contain sacred Sanskrit prayers written in Tibetan script. The non-destructive imaging technique, originally developed for material sciences such as battery research, allowed scientists to create detailed digital reconstructions without physically opening the fragile scrolls, preserving their integrity. The scrolls, part of a portable shrine tradition in Mongolian Buddhism, were nearly lost during the Soviet-backed Mongolian Revolution of 1921 but survived and arrived in Germany in 1932. The virtual unrolling revealed around 50 tightly wound layers of text, with ink containing metal particles rather than traditional soot-based ink. The deciphered text included the famous Tibetan Buddhist mantra for universal compassion, “Om mani pad
materials3D-X-ray-tomographysynchrotron-imagingdigital-preservationcultural-heritage-technologyadvanced-imaging-techniquesnon-destructive-testingRecycling breakthrough turns discarded Covid face masks into EV tech
Researchers from Australia and China have developed an innovative method to upcycle the vast quantities of discarded polypropylene (PP) Covid-19 face masks—estimated at over 950 billion since 2020—into high-performance nanocomposite films for electric vehicle (EV) electronics. The process involves cleaning and shredding used masks, coating the PP fibers with food-grade tannic acid to impart a negative charge, and then self-assembling positively charged graphene nanoplatelets around each fiber. A brief hot-pressing step fuses these into metre-scale films using only water and tannic acid under atmospheric pressure, making the method environmentally friendly and compatible with scalable roll-to-roll manufacturing. The resulting PP@G films exhibit exceptional thermal and electromagnetic interference (EMI) shielding properties, with thermal conductivity reaching 87 W/m·K—about 100 times higher than typical plastics—and EMI shielding effectiveness of 88 dB at 800 micrometers thickness, outperforming many advanced composites. These films can significantly
materialsrecyclingthermal-managementelectromagnetic-interference-shieldingnanocompositesustainable-materialselectronics-coolingWhy lunar regolith is the key to construction on the moon
The article highlights the critical role of lunar regolith—the Moon’s fine, abrasive soil—in enabling sustainable construction for future lunar habitats. Given the prohibitive costs of transporting building materials from Earth (estimated at around $10,000 per pound), utilizing the Moon’s abundant regolith is seen as the most practical and cost-effective solution. Lunar regolith, composed of mineral fragments, rock chips, and glass formed by asteroid impacts and volcanic activity, can be processed into bricks, hardened for roads, and even used to extract materials for solar panels. This in-situ resource utilization (ISRU) approach reduces reliance on Earth resupply missions and supports the Artemis program’s goal of establishing long-term lunar presence. Engineering efforts are focused on innovative methods to transform regolith into usable infrastructure. For example, researchers have proposed using lasers or concentrated sunlight to melt regolith and create paved surfaces, facilitating transportation and construction on the Moon. While some specialized materials may still be transported from Earth to improve processing efficiency, the consensus
materialslunar-regolithspace-constructionin-situ-resource-utilizationlunar-habitatsArtemis-programextraterrestrial-materialsUS turns cargo containers into nuke bunkers for remote military bases
Sandia National Laboratories has developed a mobile, high-security vault housed within a 20-foot shipping container to safeguard nuclear weapons at remote or temporary military locations where permanent bunkers are not feasible. Created under the National Nuclear Security Administration’s Stockpile Responsiveness Program, the project was completed in six months using a rapid, adaptable design approach. The vault features advanced access control, alarm systems, sensors, and backup power, built with a combination of off-the-shelf parts, rapid prototyping, and additive manufacturing. Two additional prototypes are underway, with upcoming testing planned during the Department of Defense’s Grey Flag 25 exercise to simulate real-world conditions. This mobile vault offers a flexible and scalable solution for secure storage of nuclear weapons and other critical assets in field conditions, providing new capabilities for military and civilian missions. The technology aims to protect sensitive materials during transport or operations in locations lacking traditional infrastructure, such as battlefields or disaster zones. Sandia plans to transition the technology to industry for broader production and deployment
energymaterialssecurity-technologyadditive-manufacturingsensorsrapid-prototypingnuclear-safetyRoman ruins inspire scientists to create cement from volcanic rock, no kiln required
Scientists at Stanford, inspired by ancient Roman observations, have developed a new type of cement made from volcanic rock that requires no kiln and produces significantly less carbon dioxide. The research draws on Pliny the Elder’s account from 79 A.D., describing how volcanic ash from the Puteoli region (modern Pozzuoli) naturally hardens into stone when immersed in water—a property that contributed to the durability of Roman structures like the Pantheon. Traditional cement production involves heating limestone above 1,400°C, releasing about 8% of global CO₂ emissions, making it a major contributor to climate change. Tiziana Vanorio and her team studied volcanic rocks beneath the Campi Flegrei supervolcano near Pozzuoli, which had naturally undergone heating and lost carbonate content, thus avoiding CO₂ release during processing. They developed a method to crush these volcanic rocks into a cement-like material that forms tiny internal fibers, providing strength without the need for steel reinforcement. This innovative cement mimics natural
materialscementvolcanic-rockeco-friendly-constructioncarbon-emissionssustainable-materialsRoman-concreteMission Barns is betting that animal-free pork fat will make artificial meat delicious
Mission Barns has developed the first USDA-approved animal-free cultured pork fat, marking a significant milestone in the alternative meat industry. This breakthrough product allows the company and its partners to bring fattened-up meat substitutes to market, enhancing flavor and texture in plant-based meat alternatives. Unlike muscle cells, which are difficult and costly to culture, fat cells are easier to grow and can be produced at a consumer-friendly price. Mission Barns grows the fat by taking a small biopsy from a living pig and cultivating the cells in a specially designed bioreactor that ensures even distribution and growth. The startup’s initial offerings include bacon, meatball, and sausage alternatives made from pea protein combined with their cultured pork fat. By incorporating real pork fat, these products reduce the need for expensive artificial flavorings and excessive salt, potentially making alternative meats healthier. Mission Barns also plans to supply its cultured fat to other food manufacturers, which is expected to be its primary business model. Looking ahead, the company aims to develop
materialscultured-meatbioreactor-technologyalternative-proteinfood-innovationlab-grown-fatsustainable-food-materialsCigarette waste turned into road-building material by scientists
Scientists from the University of Granada (Spain) and the University of Bologna (Italy), supported by the Chinese government, have developed an innovative method to recycle cigarette butts into pellets used as additives in road construction. The process involves removing organic ash from cigarette filters, crushing the remaining cellulose fibers and PLA plastic, and binding the material with a special Fischer-Tropsch-type wax. These pellets are then incorporated into recycled asphalt, where the wax melts during manufacturing, releasing fibers that reinforce the asphalt, enhancing its crack resistance, ductility, and flexibility. This method also allows for higher recycled content in asphalt and reduces manufacturing temperatures, leading to energy savings and lower emissions. The environmental significance of this research is notable given the staggering volume of cigarette waste worldwide—estimated at 4.5 trillion discarded filters annually by the WHO, projected to rise to 9 trillion by 2025. Cigarette butts are a persistent pollutant, contaminating waterways and landscapes. This recycling approach not only addresses this waste problem
materialsrecyclingasphaltcigarette-wastesustainable-constructionroad-building-materialsenvironmental-innovationGold survives 19,000 kelvins without melting, breaks physics limits
Researchers at SLAC National Accelerator Laboratory and the University of Nevada, Reno, have conducted a groundbreaking experiment demonstrating that gold can survive temperatures as high as 19,000 kelvins—about 14 times its normal melting point of 1,337 kelvins—without melting. Using ultrafast lasers to superheat a nanoscale gold sample and ultrabright X-rays to directly measure atomic vibrations and temperature, the team bypassed traditional indirect methods and provided the first direct temperature measurements in “warm dense matter.” This discovery overturns a four-decade-old theory that predicted solids would disintegrate at much lower temperatures, redefining the limits of superheating and challenging the long-held concept of the entropy catastrophe, which posits a hard upper temperature limit for solids. The key to gold’s survival at such extreme temperatures lies in the ultrafast heating process, occurring within trillionths of a second, which prevents the material from expanding or losing its crystalline structure. Importantly, this does
materialsgoldsuperheatingextreme-physicsultrafast-lasersX-ray-measurementwarm-dense-matterTough alloy tested at 1112°F to replace steel in nuclear reactors
Researchers at Canadian Nuclear Laboratories (CNL) are investigating high entropy alloys (HEAs) as potential replacements for stainless steel in nuclear reactors, aiming to improve materials that withstand extreme heat and radiation. HEAs differ from conventional alloys by combining five or more metals in roughly equal atomic proportions, resulting in a stable solid solution with a distorted lattice structure that imparts unique properties such as high strength, ductility, corrosion resistance, and radiation tolerance. The study focused on an HEA composed of iron, manganese, chromium, and nickel, chosen for its stability at high temperatures and manufacturability. Using the ultrabright synchrotron light at the Canadian Light Source, the team exposed the HEA to high-energy protons at 752°F (400°C) and 1112°F (600°C) under varying radiation doses. They observed the formation of small defects called Frank Loops, which increased with temperature, and noted elemental segregation within the alloy at higher temperatures. While the HEA demonstrated better
materialshigh-entropy-alloysnuclear-reactorsradiation-resistancesuperalloysenergy-materialscorrosion-resistance10% recycled glass mix boosts earth block strength by 90%: Study
Researchers at the University of Portsmouth have found that incorporating 10% recycled glass powder along with 10% lime into compressed earth blocks significantly enhances their strength, achieving a 90% increase in compressive strength compared to unstabilized blocks. These "green" blocks reached a compressive strength of 5.77 MPa and a 30% improvement in tensile strength, demonstrating superior structural integrity without cracking under intense pressure. The study involved rigorous testing of various mixes and microscopic analysis over 28 days, confirming the durability and robustness of the optimal composition. This innovation offers a sustainable alternative to traditional cement, which has a high carbon footprint, by using recycled glass as a stabilizing agent in earth blocks. The findings support the potential for large reductions in cement use and contribute to circular economy goals by repurposing industrial waste in construction. This approach could lead to greener buildings, reduced landfill waste, and a more sustainable construction industry. The article also briefly mentions related research from Japan on geopolymer-based
materialsrecycled-glasscompressed-earth-blockssustainable-constructioncement-alternativebuilding-materialsmaterial-strengthAmazon backs programmable optics startup Lumotive
Lumotive, a programmable optics startup based in Redmond, Washington, has expanded its Series B funding round to include Amazon, via its Amazon Industrial Innovation Fund, and ITHCA Group, the investment arm of Oman’s sovereign wealth fund. This extension increased the total Series B funding from $45 million to $59 million, contributing to Lumotive’s overall venture capital raised to over $100 million. CEO Sam Heidari emphasized the strategic value of Amazon’s involvement, highlighting the importance of the partnership beyond just financial investment. Lumotive develops Light Control Metasurface solid-state chips composed of nano-scale pixels that electronically manipulate light, offering a smaller and more cost-effective alternative to traditional Lidar systems used in autonomous vehicles, as well as applications in optical switching for data centers. Founded in 2018 and having begun sales in 2024, the company has deliberately maintained a focused customer base. The new funding will support expanded sales, marketing efforts, and further research and development, with Heidari
materialsprogrammable-opticsmetasurface-chipsautonomous-vehicleslidar-alternativeoptical-switchingAmazon-Industrial-Innovation-FundLatent Labs launches web-based AI model to democratize protein design
Latent Labs, about six months after emerging from stealth mode with initial funding, has launched LatentX, a web-based AI model designed to democratize protein design by enabling users to create novel proteins directly in their browser using natural language. According to CEO and founder Simon Kohl, who previously co-led DeepMind’s AlphaFold protein design team, LatentX has achieved state-of-the-art performance on various metrics, with a high percentage of its designed proteins proving viable in physical lab tests. Unlike AlphaFold, which predicts existing protein structures, LatentX can generate entirely new molecules such as nanobodies and antibodies with precise atomic structures, potentially accelerating therapeutic development. Latent Labs’ business model focuses on licensing LatentX to academic institutions, biotech startups, and pharmaceutical companies rather than developing proprietary medicines itself. While the foundational model is currently free to use, the company plans to introduce paid advanced features over time. This approach addresses the challenge that many organizations lack the resources to build their own AI models
materialsprotein-designAI-in-biologybiotechnologydrug-discoverymolecular-engineeringcomputational-biologyChina's rare earth dominance keeps the US in a strategic bind
The article highlights China’s strategic dominance in the rare earth supply chain, contrasting it with the United States’ focus on upstream mining and political maneuvering. While the US primarily extracts rare earth ores, China has developed a comprehensive, end-to-end supply chain encompassing efficient separation, purification, and downstream processing. This dominance did not arise overnight; it is the result of decades of technological innovation and strategic investment, particularly following breakthroughs in the 1970s that allowed China to move from exporting raw ores to producing high-purity rare earth elements at scale. A pivotal figure in this transformation was Xu Guangxian, who in 1972 introduced the “rare earth cascade extraction” method, significantly improving the efficiency and purity of rare earth separation. This innovation enabled China to industrialize rare earth refining without relying on expensive Western equipment, allowing it to surpass Japan and the US in practical refining capabilities. Subsequently, China aggressively lowered prices, outcompeting Western producers and becoming the primary global hub for rare earth processing.
materialsrare-earth-elementssupply-chainmining-technologyChina-dominanceindustrial-innovationresource-extractionMath in motion: YouTuber turns plastic toy into functional computer
YouTuber Shadowman39 has created a fully functional 8-bit mechanical computer using K’NEX, the plastic construction toy typically used for building roller coasters and towers. This inventive machine features an arithmetic logic unit (ALU) made entirely from K’NEX rods, connectors, and gears, capable of performing basic arithmetic operations on numbers from 0 to 255 (or -128 to 127 in signed binary). The computer uses mechanical registers composed of levers to represent binary values, and a rack-and-pinion drive system powers the calculation process. Unlike electronic computers, this mechanical model visibly demonstrates each step of the computation, making the operation transparent and educational. Building a precise mechanical computer from flexible plastic pieces posed significant engineering challenges, as K’NEX components are not designed for high-precision tasks and can loosen over time. Shadowman39 overcame these difficulties by carefully designing networks of levers and gears to replicate binary addition logic gates, reminiscent of 19th-century mechanical calculators
materialsmechanical-computerK'NEXplastic-construction-toyarithmetic-logic-unitmechanical-registersmechanical-engineeringTurkey unveils ‘world’s first’ tank that jams, fries drones mid-air
Turkey has unveiled the ALKA-KAPLAN, described as the world’s first hybrid tracked vehicle equipped with a directed energy weapon system designed to counter drone threats on the battlefield. Developed jointly by FNSS and ROKETSAN, this system integrates the KAPLAN HYBRID platform with the ALKA Directed Energy Weapon System (DEWS), combining electromagnetic jamming and high-energy lasers to detect, jam, and destroy a wide range of aerial threats including mini and micro UAVs, loitering munitions, helicopters, and drones. The system features AI-assisted tracking and threat identification, enabling rapid response to unmanned aerial vehicles and improvised explosive devices, and can be deployed in fixed, mobile, or portable configurations to protect diverse environments such as urban areas, open land, or convoys. The ALKA-KAPLAN’s hybrid propulsion system, developed by FNSS, includes a high-kilowatt generator that powers both the vehicle and the energy-intensive DEWS without auxiliary power units,
robotenergymaterialsdirected-energy-weaponhybrid-powerpackelectromagnetic-jammingunmanned-aerial-vehiclesScientists create compostable food packaging that leaves no trace
Scientists at Murdoch University in Western Australia have developed a new type of bioplastic that is fully compostable and leaves no environmental trace, addressing the growing problem of plastic pollution. By harnessing native microbes from local environments, the researchers produce a natural polymer called PHB, which microbes store as excess organic molecules. Unlike conventional plastics that break down into harmful microplastics, this bioplastic naturally degrades in soil and water, eliminating long-term contamination risks. The innovation is particularly aimed at creating compostable linings for recycled paper or cardboard food packaging, a sector where over 80% of single-use plastics currently end up in landfills due to lack of recyclability. This research is part of the Bioplastics Innovation Hub, a collaboration between Murdoch University and CSIRO, combining expertise in microbiology, genetics, and engineering to develop sustainable packaging solutions. The team envisions widespread adoption of bioplastics in households as part of a circular economy, aligning with Western Australia’s 10-Year Science
materialsbioplasticscompostable-packagingbiodegradable-plasticssustainable-materialseco-friendly-packagingplastic-alternativesElectromagnetic waves help catch Mercury’s hidden lithium fingerprint
Researchers have, for the first time, confirmed the presence of lithium on Mercury by detecting its unique electromagnetic signature rather than spotting lithium atoms directly. Using magnetic wave data from NASA’s MESSENGER mission, the team identified ion cyclotron waves (ICWs) specifically tuned to lithium ions, which are created when meteoroid impacts vaporize Mercury’s surface material. These impacts release neutral lithium atoms that quickly ionize under solar ultraviolet radiation, and as the solar wind interacts with these lithium ions, it generates detectable ICWs. The study found 12 distinct events over four years where these lithium-specific waves appeared, each lasting only minutes and linked to sudden meteoroid bombardments rather than slow processes like solar heating. This discovery provides crucial evidence that Mercury’s surface remains chemically active and is continuously reshaped by meteoroid impacts. The impacts, involving meteoroids up to 21 centimeters in radius traveling at speeds up to 110 km/s, create mini-explosions that vaporize large
materialselectromagnetic-waveslithium-detectionplanetary-scienceion-cyclotron-wavesspace-explorationMESSENGER-missionNew optical microscope captures atomic world with one-nanometer precision
Researchers have developed a groundbreaking optical microscopy technique called ULA-SNOM (ultralow tip oscillation amplitude scattering-type scanning near-field optical microscopy) that achieves one-nanometer resolution, enabling the visualization of individual atoms using light rather than electrons. This innovation overcomes the longstanding diffraction limit of traditional optical microscopes, which restricts resolution to about 200 nanometers—too coarse to observe atomic-scale features. By precisely controlling a polished silver scanning tip to oscillate with an amplitude of just 0.5 to 1 nanometer under ultrahigh vacuum and cryogenic conditions (8 Kelvin), the team created a plasmonic cavity that confines light to a cubic nanometer volume, allowing detailed optical interaction with single atoms. The ULA-SNOM technique builds on existing scattering-type scanning near-field optical microscopy (s-SNOM) but significantly improves resolution by minimizing tip oscillation amplitude, balancing signal strength and noise reduction. The setup uses a 633-nanometer red laser to
materialsnanotechnologyoptical-microscopyatomic-resolutionscanning-near-field-optical-microscopyquantum-researchimaging-technologySeaweed turns concrete greener as scientists slash cement emissions
Researchers from the University of Washington and Microsoft have developed a low-carbon concrete by incorporating powdered green seaweed into cement, achieving a 21 percent reduction in global warming potential without compromising structural strength. Cement production is a major contributor to global CO₂ emissions, responsible for about 10 percent of the total, primarily due to fossil fuel use and the calcination process. Seaweed, as a photosynthetic organism, acts as a carbon sink during growth and can be used in dried, powdered form without expensive processing, making it a promising sustainable additive for cement. To accelerate the traditionally slow trial-and-error process of optimizing concrete mixtures, the team employed a custom machine learning model that predicted the best seaweed-cement blends. This approach reduced the development time from an estimated five years to just 28 days. The researchers envision using this method to tailor cement formulations to local resources and conditions, potentially incorporating other bio-based materials like different algae species or food waste. Their work, funded by Microsoft Research and published in the
materialssustainable-materialsgreen-concretecement-emissionsseaweed-additivelow-carbon-concretemachine-learning-in-materials-sciencePrinting the future: Scott Miller on the power of hybrid electronics
The article features Dr. Scott Miller, Director of Technology at NextFlex, discussing the transformative potential of flexible hybrid electronics, which combine printed electronics with conventional semiconductor components. This integration allows electronic systems to be printed onto or embedded within objects, creating lightweight, adaptable devices with new form factors. These innovations are already impacting key industries such as defense, aerospace, and healthcare—for example, by printing antennas directly onto UAV airframes for improved robustness and reduced weight, and by enabling stick-to-skin wearable patient monitors that provide continuous health data and facilitate at-home care. Beyond performance benefits, hybrid electronics offer significant advantages for U.S. manufacturing and supply chains. By lowering capital costs, they empower small and mid-sized companies to compete without massive scale, promoting localized, distributed manufacturing that reduces environmental impact, shipping costs, and geopolitical risks. The printing process also minimizes material waste compared to traditional PCB fabrication. Additionally, hybrid electronics support a digital-first design-to-manufacturing workflow, accelerating prototyping and eliminating the need for
materialshybrid-electronicsprinted-electronicsflexible-electronicsmanufacturing-innovationaerospace-technologyhealthcare-devicesNew copper-based alloy could power space, hydrogen tech in extreme cold
A team of Japanese researchers from institutions including Tohoku University, JAXA, and Kyoto University has developed a novel copper-based shape memory alloy (Cu-Al-Mn) that retains its shape memory effect at extremely low temperatures down to -200°C (-328°F). This breakthrough addresses a significant limitation of existing shape memory alloys (SMAs), such as nickel-titanium (Ni-Ti), which lose functionality below -20°C. The new alloy is the first actuator material capable of delivering large mechanical work output in cryogenic conditions, making it suitable for applications in harsh environments like deep space and super-chilled hydrogen systems. To demonstrate its practical potential, the researchers created a mechanical heat switch using the Cu-Al-Mn alloy as an actuator, which operated flawlessly at -170°C by regulating heat flow through contact switching. This innovation paves the way for high-performance actuators in cryogenic environments, with promising uses in space telescope cooling systems and carbon-neutral hydrogen transport and storage technologies. The article
materialsshape-memory-alloycopper-alloycryogenic-technologyspace-technologyhydrogen-technologyactuatorsRecycled rubber tracks underlay slow ballast wear and cut maintenance
A two-year field trial conducted on Sydney Trains’ Chullora freight corridor has demonstrated that a recycled rubber track underlay significantly reduces ballast degradation and maintains track stability under heavy loading. Developed and patented by University of Technology Sydney (UTS) researchers, the system uses tyre-derived rubber “cells” filled with waste materials and covered by recycled rubber grids made from worn mining conveyor belts. Compared to conventional track sections, the rubber-reinforced areas showed markedly less ballast pulverization and slower track settlement, as documented in a peer-reviewed study published in the Canadian Geotechnical Journal. This innovation effectively protects the ballast by absorbing shocks and spreading axle loads more evenly, thereby extending the life of the track structure and reducing maintenance needs such as tamping. The recycled rubber underlay changes the traditional load path by compressing elastically under train wheels, which lowers peak stresses on ballast stones and distributes forces over a wider area of the underlying soil. This prevents soil settlement and weakening of the track foundation, critical for
materialsrecycled-rubberrailway-infrastructureballast-stabilizationtrack-maintenancesustainable-materialsinfrastructure-durabilityChina's bug-inspired tech to detect missiles 20,000x faster than US
Chinese scientists have developed a novel infrared sensor inspired by the fire beetle’s heat-sensing organ, which can detect missiles and heat sources up to 20,000 times faster than existing technologies. Created by researchers at the Shanghai Institute of Technical Physics and Tongji University, the sensor uses materials like palladium diselenide and pentacene to operate in the mid-infrared range, enabling it to detect extremely low heat levels even in challenging environments such as smoke, dust, or fog. Tested in simulated wildfire conditions, the sensor demonstrated nearly 95% accuracy in tracking flame movement and storing heat patterns, highlighting its potential for applications in night vision, fire detection, industrial safety, and defense surveillance. In addition, a related device using black phosphorus and indium selenide achieved photonic memory speeds of 0.5 microseconds, allowing precise real-time data capture and image recognition. This advancement could enhance military systems, including missile defense units like China’s HQ-17AE, by enabling
materialsinfrared-sensormissile-detectionbiomimicrysurveillance-technologysemiconductordefense-technologyPirelli's tires made of rice, recycled materials to drive Range Rover
Pirelli has launched its first full production tires composed of over 70% bio-based and recycled materials, developed specifically for Jaguar Land Rover (JLR). These new P Zero tires incorporate FSC-certified natural rubber, rice husk-derived silica, recycled steel, and bio-circular polymers made from used cooking oil and pyrolysis oil. This marks Pirelli’s initial global market tire with such a high sustainable material content. The tires will debut on select 22-inch Range Rover wheels, aligning with JLR’s sustainability goals for its luxury vehicles. The tires carry FSC certification and a distinct logo indicating their bio-based and recycled material content, verified by third-party Bureau Veritas. Pirelli’s R&D team balanced ultra-high performance with sustainability by using innovative materials like recycled steel and plant-based bio-resins, which enhance wet and dry performance without compromising environmental benefits. This collaboration builds on Pirelli’s 2021 introduction of FSC-certified natural rubber tires and JLR’s pioneering use of
materialssustainable-materialsrecycled-materialsbio-based-materialstire-technologyPirelliJaguar-Land-RoverElephant ear-inspired cement could make buildings cooler, save energy
Researchers at Drexel University have developed an innovative cement-based building material inspired by the heat-regulating ears of jackrabbits and elephants. This material incorporates a network of tiny, paraffin-filled channels—referred to as vasculature—that passively absorb and release heat to help regulate surface temperatures of walls, floors, and ceilings. The paraffin acts as a phase-change material (PCM), absorbing heat when melting and releasing heat when solidifying, thus reducing the need for active heating, ventilation, and air conditioning (HVAC) and addressing the significant energy consumption of buildings, nearly 40% of total energy use globally. The team combined a specially printed polymer matrix with concrete to create the internal vascular system, selecting paraffin with a melting temperature around 18°C to optimize performance in colder climates, with potential for adaptation to warmer regions. Testing various channel patterns and thicknesses revealed that a diamond-shaped grid of channels provided the best balance between mechanical strength and thermal regulation. This bio-inspired approach
energymaterialsphase-change-materialsbuilding-materialsthermal-regulationenergy-efficiencycement-innovationGerman scientists use light to trigger quantum effects in crystals
Researchers at the University of Konstanz in Germany have demonstrated a novel way to alter the properties of a material at room temperature using light, a phenomenon previously unpredicted by theory. By employing laser pulses on iron ore hematite crystals, the team was able to excite pairs of magnons—quasiparticles representing collective electron spin excitations—at their highest magnetic resonance frequencies. This excitation changed the magnetic properties of the material, effectively transforming its "magnetic DNA" and creating a temporary new material with distinct characteristics. Notably, this effect was driven by light rather than temperature, enabling room-temperature manipulation, which is uncommon in quantum experiments. This breakthrough is significant because magnons, which behave like waves, can be controlled by lasers to transmit and store information at terahertz frequencies, making them promising candidates for future quantum technologies such as artificial intelligence and quantum computing. Unlike many modern quantum materials that rely on rare-earth elements or synthetic modifications, the use of abundant hematite crystals highlights the practical potential
materialsquantum-effectsmagnonslaser-pulsesmagnetic-propertiesquantum-computingartificial-intelligenceTurns out quantum secrets can’t be cracked by humans or AI alone
A team of physicists and machine learning (ML) experts collaborated to solve a longstanding puzzle in condensed matter physics involving frustrated magnets—materials whose magnetic components do not align conventionally and exhibit unusual behaviors. Specifically, they investigated what happens to a quantum spin liquid state in a type of magnet called a "breathing pyrochlore" when cooled near absolute zero. While the spin liquid state, characterized by constantly fluctuating magnetic moments, was known to exist, the researchers had been unable to determine its behavior at even lower temperatures. The breakthrough came through a novel AI-human collaboration. The ML algorithm, developed by experts at LMU Munich, was designed to classify magnetic orders and was particularly interpretable, requiring no prior training and working well with limited data. By feeding Monte Carlo simulation data of the cooling spin liquid into the algorithm, the team identified previously unnoticed patterns. They then reversed the simulations, effectively heating the magnetic state, which helped confirm the nature of the low-temperature phase. This iterative dialogue between
materialsquantum-materialsmachine-learningcondensed-matter-physicsquantum-magnetsspin-liquidsquantum-computingNew method converts food waste into plastic and organic fertilizer
Researchers at Binghamton University, led by PhD student Tianzheng Liu and supported by Professors Sha Jin and Kaiming Ye, have developed an innovative microbial process that converts food waste into biodegradable plastic and organic fertilizer. Using the bacteria Cupriavidus necator, which synthesizes polyhydroxyalkanoate (PHA) from fermented food waste containing lactic acid and ammonium sulfate, the team can harvest about 90% of the bioplastic produced. This method addresses two major environmental issues simultaneously: the massive food waste in landfills that emits greenhouse gases and the growing problem of plastic pollution. The process is robust and adaptable, working with various types of food waste as long as the mixture ratios remain consistent, and the waste can be stored for at least a week without impacting results. The leftover residue from fermentation is also being evaluated as an organic fertilizer alternative to chemical fertilizers. The researchers aim to scale up the system for industrial application, seeking partnerships and additional funding to expand the
energymaterialsbiodegradable-plasticsfood-waste-recyclingbioplastic-productionsustainable-materialsenvironmental-technologyChina starts 1,000-ton plant to make green fabric with zero waste
China has inaugurated the world’s first 1,000-ton-scale ionic liquid cellulose fiber plant in Henan Province, developed by the Institute of Process Engineering at the Chinese Academy of Sciences. This facility marks a major breakthrough in sustainable textile manufacturing by using advanced ionic liquid technology to produce regenerated cellulose fibers with near-zero emissions. Unlike conventional fiber production that relies on toxic solvents such as carbon disulfide and N-Methylmorpholine N-oxide (NMMO), this new process employs stable, non-volatile ionic liquids that eliminate wastewater, waste gas, and solid byproducts, significantly reducing environmental pollution. The ionic liquids used are a novel class of salts that remain liquid near room temperature and possess tunable properties, allowing them to dissolve plant-based cellulose without harsh chemicals. This innovation not only cuts carbon dioxide emissions by an estimated 5,000 tons annually compared to traditional fossil fiber production but also achieves over 99% solvent recovery, underscoring its environmental benefits. After more than a decade of
materialssustainable-manufacturingionic-liquidsgreen-technologytextile-industrycellulose-fibersenvironmental-innovationBMW Titan reworks latest street bike into nitrous-fueled drag beast
BMW Motorrad has transformed its R 1300 R street bike into a high-performance drag racer named “TITAN,” featuring a nitrous oxide system that significantly boosts power for rapid acceleration. The nitrous oxide canister is strategically placed between titanium rear silencers and injects into the fuel system when activated, enhancing engine output. The bike’s design emphasizes precision engineering, with a custom Wilbers chassis, rearward footrests for sprint racing posture, and a Magura HC3 brake lever to ensure control during high-speed runs. The “TITAN” maintains the core design elements of the R 1300 R but reinterprets them into an aggressive, aerodynamic form with a monocoque structure to keep optimal front wheel contact during acceleration. Its compact proportions center around the 1300cc boxer engine, with forged carbon-fiber bodywork featuring dynamic graphics and metallic blue accents. Collaboration with Akrapovic resulted in a bespoke titanium exhaust system that enhances performance and complements the bike’s sprint-focused
materialsenergyautomotive-technologycarbon-fibertitaniummotorcycle-engineeringnitrous-oxide-systemApple aims to end rare earth reliance on China with $500M deal
Apple has committed $500 million in a multi-year deal with MP Materials, the only U.S.-based company that mines, processes, and manufactures rare earth materials entirely domestically. This partnership aims to reduce reliance on China for critical rare earth elements, especially neodymium magnets used in Apple devices. As part of the agreement, Apple will purchase American-made magnets from MP Materials’ expanded Independence facility in Texas, which will feature new manufacturing lines tailored for Apple products and is expected to begin global supply by 2027. The expansion will create advanced manufacturing and R&D jobs, alongside training programs to build U.S. expertise in rare earth magnet production. Additionally, Apple and MP Materials will establish a state-of-the-art rare earth recycling plant at the Mountain Pass facility in California to recover materials from electronic waste and industrial scrap, further integrating recycled rare earths into Apple’s supply chain. This initiative builds on Apple’s prior use of recycled rare earth elements since 2019 and supports its broader commitment to invest
materialsrare-earth-elementsneodymium-magnetsrecycling-technologysupply-chainadvanced-manufacturingsustainable-materialsApple commits $500M to U.S.-based rare earth recycling firm MP Materials
Apple has committed $500 million to MP Materials, the only fully integrated rare earth mining company operating in the United States, to bolster the domestic rare earth supply chain. This investment includes Apple's commitment to purchasing American-made rare earth magnets produced at MP Materials’ Fort Worth, Texas facility. The factory will focus on manufacturing neodymium magnets tailored specifically for Apple products, which will be distributed both nationally and globally to meet rising demand. Additionally, Apple and MP Materials will collaborate to establish a rare earth recycling facility in Mountain Pass, California. This plant will process recycled rare earth materials sourced from used electronics and industrial scrap for reuse in Apple devices. The partnership also aims to develop new magnet materials and processing technologies to improve magnet performance. This initiative aligns with Apple’s broader pledge to invest over $500 billion in the U.S. over the next four years and builds on its history of using recycled rare earth elements in its products since 2019.
materialsrare-earth-elementsrecyclingneodymium-magnetssupply-chainApplesustainable-manufacturingGermany creates first-ever hybrid alloy for next-gen quantum chips
Researchers in Germany have developed a groundbreaking hybrid semiconductor alloy composed of carbon, silicon, germanium, and tin (CSiGeSn), marking the first stable material of its kind. Created by teams at Forschungszentrum Jülich and the Leibniz Institute for Innovative Microelectronics, this new compound belongs to Group IV of the periodic table, ensuring full compatibility with existing CMOS chip manufacturing processes. The addition of carbon to the silicon-germanium-tin matrix enables unprecedented control over the band gap, a key factor influencing electronic and photonic properties, potentially allowing innovations such as room-temperature lasers and efficient thermoelectric devices. This advancement overcomes previous challenges in combining these four elements due to differences in atomic size and bonding behavior, achieved through an advanced chemical vapor deposition (CVD) technique. The resulting material maintains the delicate crystal lattice structure essential for chip fabrication and is visually indistinguishable from conventional wafers. The team successfully demonstrated the first light-emitting diode (LED) based on a quantum well
materialssemiconductorquantum-computingalloysiliconphotonicsmicroelectronicsTrack-ready Lambo gets twin-turbo V8, drops hybrid for pure racing
Lamborghini has unveiled the Temerario GT3, a track-focused, FIA GT3-compliant race car derived from its street-legal Temerario model. Developed at Lamborghini’s Sant’Agata Bolognese factory, the GT3 version replaces the road car’s hybrid system with a lightweight aluminum spaceframe and carbon fiber bodywork to reduce weight and enhance durability. The car features quick-release body panels and modular subframes designed for rapid pit stops, alongside a redesigned fuel system that supports faster refueling and improved measurement accuracy in line with FIA standards. Powering the Temerario GT3 is a heavily modified 4.0-liter twin-turbo V8 engine, optimized with race-tuned turbochargers and a bespoke Capristo exhaust system to maximize performance across a broad rev range. Aerodynamics have been extensively refined with input from Lamborghini’s Squadra Corse racing division and Centro Stile design studio, improving cooling and stability. The chassis is lengthened and widened relative to the road version,
materialscarbon-fiberlightweight-aluminumautomotive-engineeringracing-technologyenergy-efficiencymotorsport-materialsChina’s new fast-cooled superalloy engines could power 6th-gen jets
Chinese researchers at Dalian University of Technology have developed a novel superalloy cooling technique that rapidly cools forged turbine discs using a uniform mist of high-speed water jets. This method achieves a cooling speed 3.75 times faster than conventional processes and improves crystal grain size distribution by fourfold. Such advancements enable turbine discs to better withstand extreme temperatures—up to 1,200°C—and mechanical stresses, which are critical for jet engine performance, thrust, efficiency, and lifespan. The breakthrough is seen as a key enabler for China’s next-generation military aviation programs, including sixth-generation stealth fighters and hypersonic platforms. This innovation addresses a longstanding challenge in China’s military aviation: the difficulty in producing reliable, high-performance jet engines, exemplified by delays in the J-20 stealth fighter’s engine development. The new cooling technology, combined with advanced superalloys like the DD6 and the in-development DD9, may help close the technology gap with Western countries. It is particularly relevant for
materialssuperalloyjet-enginescooling-technologyturbine-discsaerospace-materialshypersonic-propulsionWorld's most accurate atomic clock redefines how me measure second
The National Institute of Standards and Technology (NIST) has developed the world’s most accurate aluminum ion-based optical atomic clock, setting a new benchmark by measuring a second to its 19th decimal place. This clock is 41% more accurate and 2.6 times more stable than the previous record holder, reflecting two decades of refinement. Unlike traditional cesium atomic clocks, this device uses a single aluminum ion known for its exceptionally steady high-frequency vibrations, paired with a magnesium ion in a “buddy system” through quantum logic spectroscopy. The magnesium ion helps cool the aluminum ion and facilitates precise measurement of its “ticks.” Achieving this unprecedented precision involved overcoming several technical challenges, including redesigning the ion trap to minimize unwanted ion motion and constructing a vacuum chamber from titanium to drastically reduce hydrogen interference. Additionally, the clock benefits from an ultrastable laser developed at JILA, whose beam travels over two miles via fiber optics to NIST, enhancing the clock’s stability and reducing measurement time from weeks
materialsatomic-clockprecision-measuremention-trapquantum-logic-spectroscopylaser-technologytimekeepingNvidia is set to resume China chip sales after months of regulatory whiplash
Nvidia has announced it is filing applications to resume sales of its H20 artificial intelligence chips to China after several months of regulatory uncertainty. The H20 chip, designed for AI inference tasks rather than training new models, is currently the most powerful AI processor Nvidia can legally export to China under U.S. export controls. Alongside the H20, Nvidia is introducing a new “RTX Pro” chip tailored specifically for the Chinese market, which the company says complies fully with regulations and is suited for digital manufacturing applications like smart factories and logistics. The regulatory back-and-forth began in April when the Trump administration imposed restrictions on sales of high-performance chips, including the H20, potentially costing Nvidia $15 to $16 billion in revenue from Chinese customers. However, after Nvidia CEO Jensen Huang attended a high-profile dinner at Mar-a-Lago and pledged increased U.S. investments and jobs, the administration paused the ban. This episode highlights the ongoing tension between U.S. national security concerns aimed at limiting China’s
materialssemiconductorAI-chipsNvidiaChina-tech-marketexport-controlsdigital-manufacturingNew ultra-secure SSD can self-destruct to protect sensitive data
Taiwanese company TeamGroup has introduced the P250Q-M80, a new internal SSD designed for ultra-secure data protection by featuring a self-destruction mechanism. Targeted at sectors such as defense, industrial automation, AI development, and cryptocurrency storage, this drive can erase sensitive data either through a software-level wipe or a hardware-level kill switch. The software wipe can be interrupted and resumed automatically, while the hardware kill switch, activated by holding an external red button for 5 to 10 seconds, sends a high-voltage surge to physically destroy the NAND flash chips, rendering the drive permanently unusable and data irrecoverable. This irreversible destruction can also be triggered remotely via a wired external button, making it suitable for high-risk environments requiring immediate data elimination. Beyond its security features, the P250Q-M80 offers robust performance and durability. It uses a PCIe Gen4x4 interface with NVMe 1.4 protocol, delivering read speeds up to 7,000
materialsdata-storageSSDcybersecurityindustrial-automationNAND-flashPCIe-Gen4The Structure of Ice in Space Is Neither Order nor Chaos—It’s Both
The article discusses the unique structure of ice found in space, contrasting it with the well-ordered crystalline ice typical on Earth. Terrestrial ice forms hexagonal crystals due to slow freezing under Earth’s temperature and pressure conditions. In contrast, space ice forms under extreme cold and vacuum conditions, leading scientists to believe it is amorphous—lacking a clear molecular order. This distinction complicates understanding of planetary formation and the distribution of water in the universe. Recent research published in Physical Review B challenges the notion that space ice is purely amorphous. Using computer simulations alongside laboratory experiments that mimic space conditions, researchers found that space ice likely consists of small crystalline fragments about 3 nanometers wide embedded within an amorphous matrix. Their model suggests space ice is roughly 20% crystalline and 80% amorphous. This hybrid structure has implications for theories like panspermia, which propose that life’s building blocks could have been transported to Earth via space ice. The presence of crystalline regions affects
materialsice-structureamorphous-icespace-icecrystallographymolecular-simulationastrophysics-materialsA clever glass trick fixes the decade-old photonic crystal laser problem
Engineers at the University of Illinois Urbana-Champaign (UIUC) have solved a decade-old challenge in photonic-crystal surface-emitting lasers (PCSELs) by replacing the traditionally used fragile air holes in the photonic crystal layer with embedded silicon dioxide, a solid dielectric material. This innovation prevents the collapse of the photonic crystal structure during semiconductor regrowth, a problem that previously hindered PCSEL development. Despite silicon dioxide being amorphous and difficult for semiconductor growth, the team successfully grew semiconductor layers laterally around the dielectric and merged them via coalescence, enabling the first demonstration of a room-temperature, eye-safe, photopumped PCSEL. This breakthrough creates a more stable, precise, and scalable PCSEL technology capable of producing high-brightness, narrow, circular laser beams suitable for applications such as LiDAR, optical communication, autonomous vehicle sensors, and defense systems. The use of solid dielectric material also simplifies fabrication and enhances device durability. However, the current design requires
materialsphotonic-crystalsilicon-dioxidelaser-technologysemiconductorPCSELoptical-communicationMolten salt enables powerful cobalt-free lithium-ion battery tech
Researchers at McGill University, in collaboration with teams from the U.S. and South Korea, have developed a novel two-step molten salt synthesis method to produce disordered rock-salt (DRX) cathode materials for lithium-ion batteries. This approach enables the mass production of uniform, highly crystalline DRX particles under 200 nanometers without the need for grinding or post-processing, overcoming previous manufacturing challenges. The resulting cathodes demonstrate significantly improved battery performance, retaining 85% capacity after 100 charge-discharge cycles—more than double the durability of DRX cathodes made by conventional methods. Importantly, these DRX cathodes eliminate the need for cobalt and nickel, metals that are costly, environmentally problematic, and ethically controversial due to mining practices and supply chain volatility. The scalable, energy-efficient molten salt process thus offers a promising path toward cheaper, greener, and more sustainable lithium-ion batteries suitable for electric vehicles and renewable energy storage. The research, supported by Stanford’s SLAC National Accelerator Laboratory
energymaterialslithium-ion-batteriescobalt-free-cathodesmolten-salt-synthesisbattery-technologysustainable-energy-storageMaserati unveils Italian V6 super sports car with Einstein concept
Maserati has unveiled the MCPURA, a new Italian V6 super sports car inspired by Einstein’s theory of relativity, debuting at the Goodwood Festival of Speed 2025. The MCPURA is an evolution of the MC20 Halo Car, maintaining its core spirit while refining exterior design, materials, and interior finishes. Produced entirely in Maserati’s historic Modena facility, the MCPURA is available in both coupé and convertible (Cielo) versions, featuring a carbon-fibre monocoque body that keeps the weight under 1,500 kg. The car is powered by Maserati’s patented 3.0-litre twin-turbo V6 Nettuno engine, delivering 630 CV and 720 Nm of torque, with advanced Formula 1-derived combustion technology. The MCPURA emphasizes pure elegance, emotion, and connection with the driver, encapsulated in its name which reflects Maserati’s authentic values. Key design highlights include distinctive "Butterfly" doors that showcase the
energymaterialsautomotivecarbon-fiberV6-enginesuper-sports-carMaseratiStartups Weekly: Still running
The "Startups Weekly: Still running" article provides a comprehensive roundup of recent developments in the startup ecosystem, highlighting key funding rounds, strategic moves, and emerging trends. Notably, design company Figma is preparing for an IPO that could raise up to $1.5 billion, signaling strong investor interest. Meanwhile, startups like Cluely are gaining traction with aggressive marketing and growing revenues, and fintech entrepreneur Darragh Buckley has achieved a significant milestone with his new venture, Increase. The newsletter also touches on corporate challenges in adopting AI tools, with insights from Brex illustrating broader industry struggles. On the venture capital and funding front, several notable deals are underway: Revolut is seeking a new funding round, SpaceX is raising capital, and micromobility and climate-focused startups like Terra CO2 and Tulum Energy are making strides in sustainability. Genesis AI is advancing foundational models for robotics, while Israeli quantum startup Qedma secures investment from IBM, emphasizing collaborative progress in quantum
robotAIstartupsenergyhydrogen-technologyquantum-computingmaterialsVarda Space to make drugs that are ‘impossible’ to produce on Earth
Varda Space Industries, a California-based space startup, has raised $187 million in its latest funding round—bringing its total funding to $329 million—to develop pharmaceuticals in microgravity conditions that are impossible to produce on Earth. The round was led by Natural Capital and Shrug Capital, with participation from notable investors including Peter Thiel, Lux Capital, and the Founders Fund. Varda aims to leverage the unique environment of space, where active pharmaceutical ingredients crystallize differently due to microgravity, to create novel drug formulations with enhanced stability and efficacy. For example, prior research aboard the International Space Station demonstrated that microgravity can produce more stable versions of cancer drug ingredients like pembrolizumab. Varda Space has conducted three successful launch and return missions, with a fourth currently in orbit and a fifth planned for later in the year. Their orbital laboratories are the first to process materials outside the International Space Station, marking a significant step toward commercial manufacturing in low Earth orbit. The company’s technology allows for
materialsspace-manufacturingmicrogravitypharmaceuticalsdrug-developmentVarda-Spacespace-technologyTesla rival robot builder bids to buy wind blade giant in bold deal
China’s humanoid robot maker AgiBot, backed by Tencent and other major investors, has announced plans to acquire a controlling stake (at least 63.62%) in Swancor Advanced Materials, a Shanghai-listed company specializing in corrosion-resistant materials and wind turbine blade components. The proposed deal, valued at about 2 billion yuan (US$279 million), could serve as a back-door listing for AgiBot on the Shanghai Stock Exchange, potentially making it the first Chinese humanoid robot company to go public in Shanghai. Swancor’s stock surged 20% following the announcement, reflecting market optimism about the synergy between robotics and advanced materials sectors. However, AgiBot has denied intentions of executing a back-door listing, and the transaction still requires approval from Swancor’s shareholders and regulatory authorities. The acquisition move highlights the intense competition among China’s humanoid robot startups to scale production and secure funding. AgiBot, founded in early 2023, aims to ramp up shipments
robotenergymaterialswind-turbine-bladeshumanoid-robotsacquisitionsChina-tech-industryNasal mucus-inspired air filter lasts longer and traps more dust
Researchers at Chung-Ang University in South Korea have developed a novel air filtration system inspired by the mucus layer in the human nose, which naturally traps dust, allergens, and harmful particles. This bioinspired filter, called the particle-removing oil-coated filter (PRO), uses a thin, stable film of biocompatible oil (200 to 500 nanometers thick) applied to standard filter fibers. This coating mimics the sticky mucus barrier and enhances particle capture through capillary adhesion, significantly improving retention compared to conventional filters that rely on weaker van der Waals forces. Field tests conducted in various indoor environments in Seoul, including offices, exhibition centers, and stadiums, demonstrated that the PRO filter not only traps more airborne pollutants but also lasts twice as long as traditional filters. Additionally, its sticky oil layer prevents particles from being dislodged by strong winds, making it suitable for high-airflow locations such as construction sites and metro stations. The filter is compatible with existing HVAC and air purifier systems
materialsair-filtrationbioinspired-designpollution-controlnanotechnologyenvironmental-engineeringsustainable-materialsCodalunga Speedster brings Pagani’s V12 legacy to an open-top form
Pagani has unveiled the Huayra Codalunga Speedster, an open-top evolution of its 14-year-old Huayra Codalunga model, maintaining the signature 5.98-liter twin-turbo V12 engine developed with Mercedes-AMG. Producing 864 horsepower and 1,100 Nm of torque, the car offers a choice between a 7-speed automated manual transmission and a pure manual gearbox, emphasizing driver engagement. The Speedster’s design draws inspiration from 1950s and ’60s racing cars, blending performance with aesthetic elegance through features like a new monocoque structure, integrated headlights, a lower-profile windshield, and a panoramic hardtop that seamlessly connects the windshield to the tail. The vehicle’s exterior incorporates stylistic cues from post-war racing prototypes, including distinctive side windows with rounded rear edges and a rear end featuring a six-outlet exhaust system and suspended taillights. Internally, the cabin channels a 1960s vibe with semi-matte
materialsautomotive-materialscarbon-fiberenergy-efficiencyadvanced-materialslightweight-structuresautomotive-engineeringNvidia reportedly plans to release new AI chip designed for China
Nvidia is reportedly planning to release a new AI chip tailored specifically for the Chinese market, aiming to navigate around U.S. export restrictions on advanced semiconductor technology. The chip, expected as early as September, will be based on Nvidia’s Blackwell RTX Pro 6000 processor but modified to comply with current regulations. Notably, these China-specific chips will exclude high-bandwidth memory and NVLink, Nvidia’s proprietary high-speed communication interface, which are key features in its more advanced AI chips. This move reflects Nvidia’s determination to maintain its presence and sales in China despite tightening export controls. Nvidia CEO Jensen Huang recently indicated a potential impact on the company’s revenue and profit forecasts due to these restrictions, though this new product launch might mitigate some of those effects. Additional details from Nvidia were not provided at the time of reporting.
materialsAI-chipsemiconductorNvidiatechnologyprocessorhardwareEuropean quantum scientists flip excitons like light switches
Researchers from the University of Innsbruck, in collaboration with universities in Dortmund, Bayreuth, and Linz, have developed a novel technique to control dark excitons in semiconductor quantum dots using chirped laser pulses and magnetic fields. Excitons are quasiparticles formed when an electron is excited to a higher energy state, leaving behind a positively charged hole; the electron and hole pair orbit each other due to Coulomb attraction. Excitons are categorized as bright or dark based on their interaction with light: bright excitons can absorb or emit photons, while dark excitons, likely due to differing spin configurations, do not interact optically and thus have longer lifetimes, making them promising for energy storage and quantum information applications. The team demonstrated the ability to switch bright excitons into dark excitons and vice versa, effectively using dark excitons as a quantum memory by storing quantum states in a non-radiative form and reactivating them later with laser pulses. This controlled manipulation opens new avenues
materialsquantum-dotsexcitonssemiconductorenergy-storageoptoelectronicsquantum-entanglementCloning Came to Polo. Then Things Got Truly Uncivilized
The article centers on Adolfo Cambiaso, widely regarded as the greatest polo player alive, who is revolutionizing the sport through biotechnology by using cloned horses. During the 2016 Argentine Open final, Cambiaso strategically selects Cuartetera B06, the sixth clone of a prized mare, to help secure victory. This marked the first time a polo final was played—and won—using six genetically identical horses, highlighting the growing acceptance and impact of cloning in polo. Cambiaso’s approach leverages cloning to maintain superior horse bloodlines, giving him a significant competitive advantage in a sport where the quality of the horse often outweighs that of the rider. Beyond the match itself, Cambiaso’s vision extends to building a lasting polo dynasty by combining his expertise in horse breeding with cutting-edge cloning technology. His son, Adolfo Jr. (Poroto), already a promising young player, is part of this long-term strategy. The article suggests that Cambiaso’s success and innovation could
materialsbiotechnologycloninggenetic-engineeringsports-technologyanimal-breedingpoloScientists develop algae-based concrete that captures 142% more carbon
Researchers at the University of Pennsylvania have developed an innovative algae-based concrete that significantly reduces environmental impact while maintaining structural integrity. By incorporating diatomaceous earth—powder made from fossilized silica shells of microscopic algae—into a 3D-printed concrete mix, the team created a lightweight material that uses 68% less cement and absorbs 142% more CO₂ compared to traditional concrete. This breakthrough leverages the natural carbon-trapping abilities of diatoms and a mathematically optimized internal geometry inspired by coral reefs and sea stars, known as triply periodic minimal surfaces (TPMS), which maximize surface area and stiffness with minimal material. The new concrete not only captures more carbon dioxide but also grows stronger over time during curing, retaining 90% of the strength of conventional solid concrete blocks despite its high porosity. The design incorporates post-tensioning cables and advanced force-balancing geometries to ensure durability and buildability at architectural scales. The researchers are currently scaling up the technology for larger applications such
materialsconcretecarbon-capturesustainable-construction3D-printingdiatomaceous-earthcarbon-dioxide-absorptionLet's Consider A Couple Of Workable Solutions To The Plastic Crisis - CleanTechnica
The article from CleanTechnica addresses the ongoing global plastic crisis, focusing particularly on plastic bag pollution and microplastics. It highlights how plastic bags, due to their lightweight and widespread use, pose significant environmental threats by harming wildlife and eventually breaking down into microplastics that enter ecosystems and human bodies. The article references a June 2025 Science study that analyzed data from over 45,000 shoreline cleanups to evaluate the effectiveness of plastic bag policies worldwide. The study found that full bans and fees on plastic bags lead to a substantial reduction—between 25% and 47%—in plastic bag litter on beaches compared to areas without such policies. State-level policies were especially effective, and these measures also correlated with a 30-37% decrease in wildlife entanglement incidents. Beyond plastic bags, the article touches on the pervasive issue of microplastic pollution across various environments, including aquatic, terrestrial, and atmospheric habitats. Microplastics are closely tied to human activity and pose increasing health risks
materialsplastic-pollutionenvironmental-policymicroplasticswaste-reductionsustainabilityplastic-bag-bansChina builds super-soft runway material that crumbles to save planes
Chinese scientists have developed an innovative ultra-light foam concrete, dubbed “marshmallow” concrete, designed to enhance runway safety by absorbing the energy of aircraft during emergency landings. Weighing only 12.5 lb/ft³ (about one-tenth the weight of standard concrete), this material crumbles in a controlled manner upon impact, effectively decelerating even large aircraft like the Boeing 747. Developed by the China Building Materials Academy (CBMA) in collaboration with the China Academy of Civil Aviation Science and Technology, the foam concrete is already implemented at 14 airports across China and has won a prestigious innovation award. This new material addresses limitations of traditional Runway End Safety Areas (RESAs), which often use sand, soil, grass, or water pools—each with environmental or operational drawbacks such as freezing, animal attraction, or instability. The foam concrete’s strength is carefully controlled within a narrow range (0.30 to 0.35 MPa) to ensure it crushes
materialsconstruction-materialsfoam-concreterunway-safetyaviation-safetyimpact-absorptionlightweight-concreteNew test uses coffee stains for 100x boost in disease detection
Researchers at the University of California, Berkeley have developed a novel, low-cost diagnostic test that leverages the "coffee-ring effect" to significantly enhance the sensitivity of at-home disease detection. This effect, commonly seen in coffee or wine stains where particles concentrate along the edges as a droplet evaporates, is used to pre-concentrate disease biomarkers into a ring pattern on a test membrane. By combining this natural phenomenon with plasmonic nanoparticles and an AI-powered smartphone app, the test can detect trace amounts of proteins associated with diseases such as COVID-19, sepsis, and prostate cancer within just 12 minutes—offering up to a 100-fold increase in sensitivity compared to current rapid tests. The testing process involves placing a droplet of a biological sample (e.g., nasal or cheek swab) on a membrane, where the coffee-ring effect concentrates disease markers at the edge as the droplet dries. A second droplet containing engineered nanoparticles is then added; these bind to the biomarkers
materialsnanoparticlesdiagnostic-technologyplasmonicscoffee-ring-effectdisease-detectionrapid-testingUS engineer spins bacteria into strong plastic-like eco-sheets
A team led by Maksud Rahman, assistant professor at the University of Houston, has developed a novel single-step method to grow biodegradable bacterial cellulose sheets that are strong enough to rival conventional plastics. By using a custom rotational culture device that guides bacterial motion through controlled fluid flow, the researchers produced aligned cellulose nanofibers, resulting in flexible, strong, and multifunctional sheets. These sheets have potential applications ranging from packaging and medical dressings to textiles and green electronics, offering an eco-friendly alternative to petroleum-based plastics. The innovation also includes enhancing the bacterial cellulose by incorporating boron nitride nanosheets into the nutrient solution, creating hybrid composites with significantly improved properties such as tensile strength up to 553 MPa and thermal conductivity three times higher than untreated samples. Published in Nature Communications, this scalable, bottom-up biosynthesis approach leverages biological processes combined with mechanical design, avoiding energy-intensive manufacturing typical of traditional bioplastics. The team envisions widespread adoption of this sustainable material across various industries aiming to
materialsbiodegradable-plasticsbacterial-cellulosenanofiberseco-friendly-materialscomposite-materialsthermal-conductivityNew clay membrane tech can extract lithium straight from water
Researchers at the U.S. Department of Energy’s Argonne National Laboratory and the University of Chicago have developed a novel, low-cost membrane technology capable of efficiently extracting lithium directly from saltwater. This membrane is made from vermiculite, a naturally abundant and inexpensive clay, which is processed into ultrathin two-dimensional sheets. To stabilize these sheets in water, the team introduced microscopic aluminum oxide pillars that maintain the membrane’s structure and enable selective ion filtration based on size and charge. By doping the membrane with sodium ions, it gains a positive surface charge that repels magnesium ions more strongly than lithium ions, allowing for effective separation of lithium from chemically similar elements. This breakthrough offers a scalable alternative to traditional lithium mining, which is costly, slow, and geographically concentrated, by tapping into the vast lithium reserves dissolved in seawater, underground brines, and wastewater. The membrane’s ability to selectively filter lithium with high precision could reduce dependence on foreign lithium suppliers and unlock new domestic sources. Beyond lithium, the
materialsenergylithium-extractionmembrane-technology2D-materialssustainable-miningwater-filtrationWaxworms can eat plastic, poop profit and possibly save the planet
A recent study from Brandon University, led by Dr. Bryan Cassone, reveals that waxworms—the caterpillars of the greater wax moth—can rapidly degrade polyethylene, the most common plastic worldwide. Remarkably, about 2,000 waxworms can consume an entire polyethylene bag within 24 hours, a process that normally takes decades or centuries in the environment. The research shows that waxworms metabolize the plastic into lipids stored as body fat, similar to how humans store fat from food. However, an all-plastic diet is lethal to the caterpillars, causing mass loss and death within days. Cassone suggests that co-supplementing their diet with other food sources could sustain and even enhance their health, enabling mass rearing. The implications of this discovery are twofold: waxworms could be farmed on a supplemented polyethylene diet to help reduce plastic waste as part of a circular economy, or scientists could isolate and replicate the enzymes responsible for plastic degradation in laboratory or industrial settings
materialsplastic-degradationpolyethyleneenvironmental-sciencebiodegradationwaste-managementsustainable-materials2,000-year-old steel acupuncture needles unearthed in Chinese tomb
Archaeologists in China have uncovered the world’s oldest known steel acupuncture needles, dating back approximately 2,000 years, in the tomb of Emperor Liu He (Marquis of Haihun) from the Western Han Dynasty. The discovery was made in Jiangxi Province, where five heavily corroded needles were found inside a broken jade tube within a gilded lacquer box. Advanced testing revealed the needles were made using an early steel-making technique called the “frying” process, which combines cast iron and wrought iron through melting. Remarkably, these needles are extremely thin—0.3 to 0.5 millimeters in diameter—comparable to modern acupuncture needles, demonstrating the high level of metallurgical skill and craftsmanship achieved during that era. The identification of these artifacts as medical tools was confirmed by a nearby wooden label inscribed with “Nine Needles Complete,” linking them to descriptions in ancient Chinese medical texts such as the Huangdi Neijing. This find sheds new light on the evolution of
materialssteelmetallurgyancient-technologyacupuncturetraditional-medicineChinese-historyPhysicists double qubit coherence, opening door to faster quantum computing
Researchers at Aalto University in Finland have achieved a breakthrough in quantum computing by doubling the coherence time of transmon qubits, reaching an echo coherence time of 1 millisecond—significantly surpassing the previous record of approximately 0.6 milliseconds. Coherence time measures how long a qubit can maintain its quantum state without errors caused by environmental noise, which is critical for performing complex quantum operations with high fidelity. Longer coherence times reduce the reliance on extensive quantum error correction, a major hurdle in scaling quantum computers to practical, fault-tolerant devices. The team fabricated high-quality transmon qubits using superconducting materials sourced from Finland’s national research institute, VTT, and utilized advanced cleanroom facilities at Aalto University. This advancement not only marks a significant scientific milestone but also strengthens Finland’s position as a global leader in quantum technology. Supported by initiatives like the Finnish Quantum Flagship and the Academy of Finland’s Centre of Excellence in Quantum Technology, the researchers anticipate that industrial and commercial
materialsquantum-computingqubitssuperconducting-materialscoherence-timequantum-technologyquantum-error-correctionIs the Ekranoplan back? China might be reviving a Soviet-era legend
Leaked images suggest that China is developing a modern version of the Soviet-era Ekranoplan, a wing-in-ground effect (WIG) vehicle designed to fly just above the water’s surface by using a cushion of compressed air for efficient low-altitude flight. Nicknamed the “Bohai Sea Monster,” this craft was spotted near the Bohai Sea and appears similar in size to China’s AG600 flying boat. The original Soviet Ekranoplans were high-speed amphibious vehicles used for troop transport, anti-ship warfare, and could reach speeds up to 310 mph. The Chinese version may employ composite materials for stealth and weight advantages and could serve roles such as search and rescue, personnel recovery, light cargo transport, anti-submarine operations, and sea control in coastal zones. The U.S. is reportedly developing a comparable WIG aircraft called the “Liberty Lifter,” aimed at rapid logistics across the Pacific while remaining below radar detection. Although details about China’s WIG
materialsaerospace-technologycomposite-materialsmilitary-technologywing-in-ground-effectstealth-technologyaviation-innovationPhotos: 1000-pound 'Spaceshop' propels interstellar product delivery
Vollebak, in collaboration with SAGA Space Architects and Bang & Olufsen, has unveiled the "Spaceshop," a 1000-pound interstellar delivery vehicle that combines the functions of a spaceship and a mobile retail unit. Designed to envision the future of retail, the Spaceshop aims to bring products directly to consumers regardless of location, whether on Earth or in space. Constructed from aerospace-grade materials such as carbon, stainless steel, and anodized aluminum, the vehicle features durable exterior panels designed for global display tours. The design was led by Denmark-based SAGA Space Architects, known for their expertise in modular habitats for extreme environments, with aluminum panels processed at Bang & Olufsen’s Danish facility. The Spaceshop integrates high-fidelity audio technology from Bang & Olufsen, including eight powerful speakers capable of producing sound levels up to 120 decibels, enhancing its futuristic appeal. It serves as a unique platform to showcase innovative products like Vollebak’s Martian Aerogel
materialsaerospace-materialsanodized-aluminumcarbon-compositesarchitectural-engineeringinterstellar-deliveryadvanced-materialsSoft probes unlock nondestructive testing of micro LED wafers
Researchers at Tianjin University have developed the world’s first soft probe for non-destructive testing of micro-LED wafers, addressing a critical challenge in the production of next-generation micro-LED displays. Micro-LED technology promises ultra-bright, energy-efficient screens for applications ranging from high-end TVs to flexible wearables, but ensuring high manufacturing yields requires rigorous quality testing. Traditional contact-based probes risk damaging the delicate wafer surfaces, while non-contact methods often lack precision. The new soft-touch system uses a flexible 3D probe array that applies a minimal pressure of just 0.9 MPa—comparable to a gentle breath—significantly reducing the risk of scratches and extending probe lifespan even after one million contact cycles. This innovation enables high-throughput electrical testing crucial for mass production without compromising wafer integrity, effectively overcoming a major bottleneck in scaling micro-LED manufacturing. Led by Professor Huang Xian, the team’s technology integrates custom measurement systems with the flexible probes, offering a scalable,
materialsmicro-LEDnon-destructive-testingflexible-probeswafer-fabricationdisplay-technologyquality-controlAI-designed material captures 90% of toxic iodine from nuclear waste
A research team from the Korea Advanced Institute of Science and Technology (KAIST), in collaboration with the Korea Research Institute of Chemical Technology (KRICT), has developed a novel material capable of capturing over 90% of radioactive iodine, specifically isotope I-129, from nuclear waste. I-129 is a highly persistent and hazardous byproduct of nuclear energy with a half-life of 15.7 million years, making its removal from contaminated water a significant environmental challenge. The new material belongs to the class of Layered Double Hydroxides (LDHs), compounds known for their structural flexibility and ability to adsorb negatively charged particles like iodate (IO₃⁻), the common aqueous form of radioactive iodine. The breakthrough was achieved by employing artificial intelligence to efficiently screen and identify optimal LDH compositions from a vast pool of possible metal combinations. Using machine learning trained on experimental data from 24 binary and 96 ternary LDH compositions, the team pinpointed a quinary compound composed of copper
materialsartificial-intelligencenuclear-waste-cleanupradioactive-iodine-removallayered-double-hydroxidesmachine-learningenvironmental-technologyNickel catalyst can replace expensive palladium in industrial chemistry
US Department of Energy scientists have revealed how nickel-based catalysts, activated by light, can effectively replace expensive palladium catalysts in industrial chemistry. Unlike palladium, which requires high heat, nickel’s reactivity can be driven by light, enabling milder reaction conditions and expanding the range of possible chemical reactions. This breakthrough is significant because nickel is abundant and much cheaper—costing about 50 cents per ounce compared to palladium’s nearly $1,000 per ounce—making it a promising alternative for large-scale chemical manufacturing in pharmaceuticals, agriculture, and electronics. The research focused on nickel dihalides, where light exposure breaks the bond between nickel and halide ions, lowering nickel’s oxidation state and activating it for catalysis. A key discovery was that the freed halide ion interacts with the solvent to form a stable intermediate, preventing deactivation of the nickel catalyst by stopping nickel atoms from directly interacting. This insight into the light-driven catalytic mechanism was achieved using advanced spectroscopic techniques at national laboratories, including
materialsnickel-catalystpalladium-replacementindustrial-chemistrylight-driven-catalysischemical-reactionsenergy-efficient-processesFlexible new polymer may replace toxic plastics in smart devices
Scientists at Case Western Reserve University have developed a novel fluorine-free ferroelectric polymer that promises to replace environmentally harmful plastics commonly used in electronics, such as poly(vinylidene fluoride) (PVDF), a persistent “forever chemical.” Led by Professor Lei Zhu, the team created a flexible, rubber-like material that generates electric properties without requiring crystallization, unlike traditional ferroelectric materials. This innovation offers tunable electrical characteristics, improved manufacturability into thin films or coatings, and acoustic compatibility with biological tissue, making it particularly suitable for wearable medical sensors, virtual and augmented reality devices, and other smart electronics. The new polymer addresses key limitations of existing ferroelectric materials, which are often brittle ceramics, by combining flexibility, lightness, and environmental safety. Although still in the development phase with small-scale synthesis underway, the material’s potential to reduce toxicity and waste in electronics is significant. The research, initially funded by a U.S. Department of Energy grant from 2017
materialspolymerferroelectricflexible-electronicseco-friendlysensorswearable-technologyNew loofah-like polymer kills viruses, stronger than plastic
Researchers at the University of Tokyo have developed a novel synthetic polymer inspired by the natural loofah sponge, featuring a porous, loofah-like structure that is stronger than typical plastics yet lighter than foam. This innovative material exhibits remarkable mechanical properties, achieving a stiffness of up to 11 gigapascals at a low density of 0.5 grams per cubic centimeter—about four times stronger than conventional polymers. The polymer is pH-responsive, becoming more rigid or flexible depending on acidity, and its fine pore network (around 70 nm) allows fluids to pass while filtering and killing bacteria and viruses, making it highly suitable for filtration, structural applications, and potentially medical devices. The polymer is synthesized simply using water, applied voltage, and a mixture of resorcinol and an aldehyde, producing an ultrathin porous membrane without requiring post-processing. This process is scalable and compatible with roll-to-roll manufacturing, enhancing its industrial viability. Made from a lignin-like base, the material
materialspolymersustainable-materialsvirus-killing-polymerlightweight-polymerpH-responsive-materialsynthetic-polymerOrgan-on-a-chip tech is (almost) ready to replace animal models
Organ-on-a-chip (OoC) technology is emerging as a promising alternative to traditional animal models in drug testing and biomedical research. These microfluidic devices, engineered with human cells, replicate the structure and function of human organs on a miniature scale, allowing precise simulation of biological processes such as blood flow, cellular communication, and mechanical stresses. Unlike animal models, which often fail to accurately predict human responses—evidenced by nearly 90% of drug candidates failing in human trials despite success in animals—OoC systems offer more relevant human-specific insights. By incorporating cells from diverse donors, these chips can reflect variations in age, sex, and genetics, enabling personalized and predictive assessments of drug efficacy and disease mechanisms. The construction of organ-on-a-chip devices involves materials like polydimethylsiloxane (PDMS), thermoplastics, hydrogels, and glass, each chosen for specific properties such as flexibility, biocompatibility, and transparency. PDMS is currently favored due to
materialsmicrofluidicsorgan-on-a-chipbiomedical-engineeringdrug-testinghuman-cell-modelslab-on-a-chipScientists grow algae in Mars-like conditions inside bioplastic pods
Researchers at Harvard’s John A. Paulson School of Engineering and Applied Sciences have successfully grown green algae (Dunaliella tertiolecta) inside bioplastic pods designed to simulate Mars-like conditions. The team recreated Mars’ thin atmosphere, with pressure over 100 times lower than Earth’s, and used 3D-printed chambers made from polylactic acid bioplastic. These chambers effectively blocked harmful UV radiation while allowing enough light for photosynthesis. Despite the low atmospheric pressure that typically prevents liquid water from existing, the pods maintained a pressure gradient stabilizing water, enabling algae survival in a harsh, carbon dioxide-rich environment. This breakthrough suggests the potential for creating self-sustaining, closed-loop habitats on Mars, where bioplastic shelters could grow algae that in turn produce more bioplastic, enabling habitats to maintain and expand themselves over time. This biomaterial approach contrasts with traditional, resource-intensive construction methods by mimicking natural growth processes. Combined with previous innovations like silica aerogels to address
materialsbioplasticsalgaeMars-habitatsustainable-materialsspace-colonizationenvironmental-engineeringTerra CO2 cements $124M Series B to slash concrete’s carbon footprint
Terra CO2, a Golden, Colorado-based startup, has secured $124.5 million in a Series B funding round to advance its low-carbon cement alternative aimed at reducing the environmental impact of concrete production. Cement manufacturing, particularly Portland cement, is responsible for about 8% of global carbon emissions due to the chemical processes and fossil fuel use involved. Terra CO2’s approach involves producing supplementary cementitious materials (SCM) by melting silicate-containing rocks into glassy powders that mimic the properties of traditional cement but with significantly lower emissions. The new funding, co-led by prominent investors including Bill Gates’s Breakthrough Energy Ventures and Al Gore’s Just Climate, will support the construction of a large-scale facility near Dallas capable of producing 240,000 tons of SCM annually. Currently, Terra CO2’s SCM can replace up to 40% of Portland cement in concrete mixtures, reducing carbon dioxide emissions by 70% compared to conventional cement. The company is also developing a next-generation product intended
energymaterialslow-carbon-cementsustainable-constructioncarbon-footprint-reductionsupplementary-cementitious-materialsclimate-technologyAI-crafted coating cools buildings by 36°F, slashes AC use, bills
Researchers from the University of Texas at Austin, Shanghai Jiao Tong University, the National University of Singapore, and Umea University have developed advanced thermal meta-emitters using machine learning to create over 1,500 novel materials capable of precise heat emission. By automating the design process and exploring complex three-dimensional structures, these materials achieve superior cooling performance previously unattainable through traditional trial-and-error methods. Testing showed that coating a model building with one such material reduced roof temperatures by 5 to 20°C (37 to 68°F) under direct sunlight, potentially saving about 15,800 kilowatt-hours annually in hot climates—significantly cutting air conditioning energy use and costs. Beyond energy savings, the researchers have designed seven classes of meta-emitters with diverse applications, including mitigating urban heat island effects by reflecting sunlight and emitting heat at specific wavelengths, and managing spacecraft temperatures in space. These materials also hold promise for everyday uses such as cooling fabrics, outdoor gear, and vehicle surfaces
energymaterialsthermal-coatingenergy-efficiencyAI-designed-materialscooling-technologymeta-emittersUS chipmakers could see bigger tax credits if Trump’s spending bill passes
The Trump administration’s current spending bill, known as the “Big, Beautiful Bill,” includes a provision that could significantly increase tax credits for semiconductor manufacturers building plants in the U.S. The bill, which has already passed the Senate, proposes raising the tax credit from 25% to 35%. This enhanced credit aims to incentivize companies like Intel, TSMC, and Micron Technology to expand their domestic manufacturing capabilities. This potential tax boost comes at a critical time for the semiconductor industry, which has faced challenges due to recent export restrictions on advanced AI chips to China. The increased tax credit could help offset some of the difficulties caused by these trade limitations and support the growth of U.S.-based chip production. However, the final impact depends on whether the spending bill passes in its current form.
materialssemiconductorchip-manufacturingtax-creditsUS-manufacturingtechnology-industryIntelMIT student’s pocket-sized 3D printer can craft objects in seconds
Researchers at MIT, led by PhD candidate Sabrina Corsetti and Professor Jelena Notaros, have developed a groundbreaking pocket-sized 3D printer based on a single millimeter-scale photonic chip. This chip uses light to create solid objects within seconds by emitting reconfigurable visible-light holograms into a stationary resin well, enabling non-mechanical 3D printing without any moving parts. The innovation combines silicon photonics and photochemistry to achieve rapid fabrication of customized, low-cost objects, marking the first demonstration of chip-based 3D printing. This compact and portable system addresses many limitations of traditional 3D printers, which rely on large mechanical setups that restrict speed, resolution, and form factor. Beyond 3D printing, the team also created a miniature “tractor beam” using light to manipulate biological particles, offering new possibilities for contamination-free biological research. The researchers anticipate that their chip-based technology could revolutionize manufacturing across diverse fields such as military, medical, engineering, and consumer applications
materials3D-printingphotonicssilicon-photonicsphotochemistryoptical-tweezersmanufacturing-technologyEurope unveils 5th-gen battle tank plan to boost defense technology
Europe has initiated Project MARTE (Main ARmoured Tank of Europe), a multinational effort to develop the continent’s first fifth-generation Main Battle Tank (MBT). Supported by a €20 million grant from the European Defence Fund, MARTE aims to create a modular, highly digitalized armored platform designed for high-intensity, multi-domain combat environments. Coordinated by MARTE ARGE GbR—a joint venture between Germany’s KNDS Deutschland and Rheinmetall Landsysteme—the consortium includes 51 entities from 12 countries, encompassing major defense firms, tech companies, SMEs, and research institutions. The project is structured into five technical work packages led by key European defense companies, focusing on critical subsystems of the future tank. Central to MARTE’s design is a networked combat vehicle architecture featuring an open digital backbone that enables real-time data fusion, AI-assisted targeting, and secure, high-bandwidth communication compatible with NATO standards. The tank will incorporate AI-driven decision support to reduce crew workload and
robotenergymaterialshybrid-electric-propulsionAI-assisted-targetingmodular-armorautonomous-systemsHow Siemens and Spinnova are reinventing the future of textiles
The article highlights the innovative collaboration between Finnish startup Spinnova and Siemens in revolutionizing the textile industry through sustainable fiber production. Spinnova has developed a groundbreaking technology that mechanically transforms cellulose-rich raw materials, primarily FSC-certified wood pulp, into textile fibers without the use of harmful chemicals and with minimal water consumption. Inspired by the structure of spider silk, this process produces soft, durable fibers resembling cotton and linen, significantly reducing CO2 emissions and environmental impact compared to traditional textile manufacturing. Major fashion brands like H&M, Bestseller, and Adidas have already incorporated SPINNOVA® fibers into their collections, marking a shift toward circular and eco-conscious fashion. Siemens plays a crucial role in accelerating Spinnova’s innovation by providing digital solutions through its Siemens Xcelerator portfolio, which integrates hardware, software, and digital services. This partnership enables real-time data capture and analysis—covering fiber consistency, energy use, moisture levels, and machine efficiency—helping Spinnova optimize production quality and sustainability
materialssustainable-textilesSpinnovacellulose-fibereco-friendly-fashionnanocellulosetextile-innovationSun-powered sponge turns saltwater fresh, no electricity needed
Researchers at The Hong Kong Polytechnic University have developed a novel 3D-printed aerogel material that can desalinate seawater using only sunlight, without requiring electricity. This sponge-like aerogel, made from carbon nanotubes and cellulose nanofibers, contains microscopic air pockets and uniform vertical pores about 20 micrometers wide, which efficiently facilitate water evaporation while leaving salt behind. The material’s desalination efficiency remains consistent regardless of its size, making it scalable for larger applications. In practical outdoor tests, the aerogel was placed in seawater under a curved plastic cover, where sunlight heated the material to evaporate water. The vapor condensed on the plastic lid and was collected as fresh water, producing approximately three tablespoons of drinkable water after six hours of natural sunlight. This low-energy, sustainable desalination method offers a promising solution to global water scarcity, especially as conventional desalination plants typically require significant energy input. The research, published in ACS Energy Letters, highlights the potential for scalable, energy
energymaterialsdesalinationaerogelsustainable-technologynanomaterialssolar-energyCRISPR-powered home test detects cancer, HIV; costs less than $1
MIT researchers have developed an inexpensive, durable DNA-based sensor that uses CRISPR technology to detect diseases such as cancer and HIV at home for under $1. The sensor operates by employing a CRISPR-associated enzyme, Cas12, which, upon recognizing a target genetic sequence like a cancer biomarker or viral DNA, activates and cleaves nearby DNA strands on the sensor’s electrode. This cleavage alters the electrical signal, allowing disease detection via a handheld device. A key innovation is a polymer coating made from polyvinyl alcohol (PVA) that protects the DNA on the sensor, enabling it to remain stable and functional for up to two months even under high temperatures (up to 150°F), overcoming previous limitations that required refrigeration and fresh preparation. The sensor consists of a gold leaf electrode laminated onto plastic, with DNA anchored by a sulfur-based molecule, and can analyze various sample types including urine, saliva, and nasal swabs. The technology has successfully detected PCA3, a prostate cancer biomarker
materialsCRISPRDNA-sensorelectrochemical-sensorpolymer-coatingdiagnosticsmedical-technologyMiniature chip mimics marrow to reshape blood cancer treatment
Researchers at NYU Tandon School of Engineering, led by Weiqiang Chen, have developed a credit-card-sized “leukemia-on-a-chip” device that replicates the bone marrow environment and a functioning human immune response. This miniature chip mimics the three key regions of bone marrow—blood vessels, marrow cavity, and bone lining—and supports patient-derived bone marrow cells to self-assemble and sustain immune activity. Using high-resolution imaging, the team observed immune cells, including engineered CAR T-cells, actively hunting and killing cancer cells in real time, providing unprecedented insights into immunotherapy dynamics and revealing phenomena like the “bystander effect,” where immune cells activate others beyond their direct targets. This chip-based platform addresses major limitations of current testing methods, such as slow, imprecise animal models and standard lab tests that fail to capture the complex cellular environment of cancer-immune interactions. It enables rapid, controlled experiments simulating clinical outcomes like remission, resistance, and relapse, and demonstrated that
materialsbiomedical-engineeringmicrochip-technologyimmunotherapycancer-treatmentlab-on-a-chipbiotechnologyNext-gen coating mimics clouds to manage heat, evade detection
Researchers at Finland’s Aalto University have developed an innovative wafer-thin “cloud” metasurface coating that can dynamically switch between bright white and deep grey states, enabling surfaces to either cool by reflecting sunlight or heat by absorbing it, all while remaining nearly invisible to infrared (thermal) cameras. This dual-function coating mimics the behavior of cumulus clouds, adapting its optical properties to manage heat passively and without energy input. Unlike traditional white paints that cool by scattering sunlight but become conspicuous in thermal imaging, or black surfaces that absorb heat but emit strong infrared signals, this metasurface maintains very low mid-infrared emissivity (8–13 microns), effectively camouflaging heat signatures in both modes. The coating’s unique performance arises from a disordered array of metallic nanostructures that manipulate light through multiple scattering and “polarizonic reflection.” In the white state, solar photons are reflected back into space, providing radiative cooling under full sun, while in the grey state,
materialsnanotechnologysmart-coatingsthermal-managementinfrared-camouflageenergy-efficiencymetasurfaces5th force of nature: Scientists to hunt dark matter with new physics
Scientists at ETH Zurich are conducting highly precise ion trap experiments to search for a hypothetical fifth fundamental force of nature that could help explain dark matter, an elusive form of matter known only through its gravitational effects. Unlike the four established forces—gravity, electromagnetism, and the strong and weak nuclear forces—this proposed fifth force is theorized to act between neutrons in an atomic nucleus and orbiting electrons, mediated by a new, unknown particle. The team uses precision atomic spectroscopy on different calcium isotopes, which have the same number of protons but varying neutrons, to detect tiny shifts in energy levels that would indicate the presence of this force. The experiment involves trapping single charged calcium isotopes with electromagnetic fields and measuring the frequency of light emitted during energy transitions with unprecedented accuracy—100 times more precise than previous attempts. Complementary studies in Germany involving highly charged calcium ions and nuclear mass ratio measurements support the findings. While the observed deviations in energy shifts cannot be fully explained by known nuclear effects, alternative
materialsion-trapatomic-physicsdark-matterisotopesparticle-physicsspectroscopyPlastics Recycling With Enzymes Takes a Leap Forward - CleanTechnica
A collaborative research effort involving the National Renewable Energy Laboratory (NREL), the University of Massachusetts Lowell, and the University of Portsmouth has advanced enzymatic recycling of polyethylene terephthalate (PET), a common plastic used in packaging and textiles. Building on prior work engineering improved PETase enzymes capable of breaking down PET, the team integrated chemical engineering, process development, and techno-economic analysis to create a scalable, economically viable recycling process. This approach addresses limitations of current PET recycling methods, particularly their incompatibility with low-quality, contaminated, or colored plastic waste, by using enzymes that selectively depolymerize PET into monomers that can be reused or upcycled into higher-value materials. Key innovations in the process include optimized reaction conditions and separation technologies that drastically reduce the need for costly acid and base additives by over 99%, cut annual operating costs by 74%, and lower energy consumption by 65%. These improvements have brought the modeled cost of enzymatically recycled PET down to $1.51 per kilogram
materialsrecyclingenzymesenergy-efficiencyPETchemical-engineeringsustainable-materialsDIY Cybertruck lookalike built on Prius frame auctioned for charity
Utah resident Johnny Lange transformed a 2004 Toyota Prius into a Cybertruck-inspired parody police car called the "Cybercop" over four months, using steel tubing and aluminum panels attached with industrial tape and rivets. The project, completed in his Salt Lake Valley garage, features a brushed metal wrap, LED police-style lighting, "Space Patrol" decals, and a disclaimer stating it is not a real police vehicle. Despite its futuristic and law enforcement-inspired appearance, the Cybercop remains street-legal under a standard Utah title and is built on the original Prius frame. Lange’s motivation was to satirize the cultural prominence of Tesla’s Cybertruck while raising funds for a charitable cause. The Cybercop was auctioned for $4,550, with all proceeds donated to the Utah 10-33 Foundation, which supports families of fallen police officers. Since completion, the vehicle has appeared at local shows and charity events, drawing attention for its unique design, craftsmanship, and philanthropic purpose. The
materialsautomotive-engineeringDIY-fabricationmetalworkingvehicle-modificationsteel-framealuminum-panelsWeek in Review: Meta’s AI recruiting blitz
The article "Week in Review: Meta’s AI recruiting blitz" summarizes key technology and business developments from the past week. Meta is aggressively expanding its AI superintelligence team by recruiting top talent, including Trapit Bansal, who previously contributed to OpenAI’s reasoning models. This move highlights Meta’s commitment to advancing AI capabilities by poaching experts from rival labs. Meanwhile, Travis Kalanick, co-founder of Uber, is reportedly attempting a return to autonomous vehicles by trying to acquire Pony AI’s U.S. operations with Uber’s support, signaling his renewed interest in self-driving technology after years focused on ghost kitchens. Other notable news includes a federal court ruling favoring AI companies’ ability to train on copyrighted books without permission, though legal battles continue over alleged unauthorized use by Anthropic. Google launched Doppl, an experimental app that uses a single photo to generate and animate fashion outfits, showcasing AI’s creative applications. JB Straubel’s Redwood Materials is innovating by repurposing retired EV
robotenergymaterialsautonomous-vehiclesEV-batteriesAI-data-centerclean-energyEggshell waste turned into sustainable ceramic glaze by Yale team
Yale scientists, in collaboration with New Haven ceramic artist Kiara Matos, have developed a sustainable ceramic glaze made from eggshell waste, addressing the global issue of approximately 80 million metric tons of eggshells discarded annually. Eggshells, which are about 95% calcium carbonate, were processed by burning at 800°F to remove organic material, then ground into a fine powder to create ceramic glazes. These eggshell-based glazes were tested against traditional glazes made from mined calcium carbonate and found to have comparable, if not superior, qualities in appearance, durability, and resistance to wear and dishwasher cycles. The eggshell glaze demonstrated a smoother texture and vibrant color, prompting Matos to transition her pottery business entirely to this sustainable material. This innovation not only offers a practical reuse for eggshell waste—which can be hazardous and malodorous if untreated—but also promotes environmental sustainability by replacing mined materials with a renewable waste product. Matos sources eggshells from local bakeries and restaurants
materialssustainable-materialsceramic-glazewaste-recyclingcalcium-carbonateYale-Universityeggshell-reuseGraphene’s strange twist is a boon for true superconductivity: Study
The article discusses recent research on magic-angle twisted trilayer graphene (MATG), a novel form of graphene composed of three atom-thick layers twisted at specific angles, which exhibits unconventional superconductivity. Unlike traditional superconductors, MATG’s superconducting behavior defies established theories, making it a subject of intense scientific investigation. Researchers constructed Josephson junctions incorporating MATG to probe its superconducting properties beyond simple resistance measurements, confirming true superconductivity through observations such as magnetic field expulsion and Cooper pair formation. A key finding of the study is MATG’s exceptionally high kinetic inductance—about 50 times greater than most known superconductors—indicating that Cooper pairs in MATG respond very slowly to changing currents. This property is highly desirable for quantum technologies, including ultra-sensitive photon detectors and superconducting qubits for quantum computing. Additionally, the researchers identified an inverse relationship between kinetic inductance and critical current, shedding light on the coherence length of the superconducting electron pairs. Although MATG is not
materialsgraphenesuperconductivityquantum-devicestwisted-trilayer-graphenemagic-angle-graphenequantum-materialsBiodegradable memory chip dissolves in water, survives 3,000 bends
Researchers at the Korea Institute of Science and Technology (KIST) have developed a biodegradable memory device that can reliably store data, endure over 3,000 bending cycles, and dissolve completely in water within three days. The device is based on a novel polymer called PCL-TEMPO, which combines polycaprolactone (a biodegradable material) with TEMPO, an organic molecule capable of electrical data storage. This innovation addresses the environmental challenge of electronic waste by offering a sustainable alternative that maintains strong data retention—distinguishing ON and OFF signals over one million cycles and retaining data for over 10,000 seconds—while also being fully biodegradable. A key feature of this technology is its biocompatibility and controlled degradation, making it suitable for medical implants that safely dissolve in the body after their function is complete, potentially eliminating the need for surgical removal and reducing healthcare costs. The device’s durability and performance under mechanical stress also open possibilities for disposable wearables, health monitors, and temporary military
materialsbiodegradable-electronicsmemory-deviceeco-friendly-technologyorganic-polymerssustainable-materialselectronic-waste-reductionStartups Weekly: Tech and the law
The latest edition of Startups Weekly highlights a busy week in the startup ecosystem, featuring notable lawsuit developments, mergers and acquisitions, and significant funding rounds. Key startup stories include Rubrik’s push to accelerate AI agent adoption with substantial but undisclosed funding, German fintech startup Kadmos’ $38 million raise linked to Japanese shipping expansion, and ongoing copyright lawsuits involving AI music startup Suno and Getty Images’ AI image generator Stable Diffusion. Despite challenges, Bill Gates-backed Airloom Energy continues its operations in Wyoming. On the venture capital front, several high-profile funding events stood out. Harvey AI, an AI-enabled legal tech startup, raised $300 million at a $5 billion valuation just months after a previous $300 million round at $3 billion. Abridge, an AI medical note automation startup, secured funding at a $5.3 billion valuation, while blockchain prediction market Kalshi and its rival Polymarket are also raising significant capital. Other notable raises include European challenger bank Finom, Indian
energystartupsAIfundingdronesblockchainmaterialsSquid-inspired camo may help US troops vanish from sight and sensors
Researchers at the University of California, Irvine, in collaboration with the Marine Biological Laboratory, have uncovered the detailed cellular architecture behind the longfin inshore squid’s ability to rapidly shift its skin from transparent to vividly colored. Using holotomography, a 3-D imaging technique, they visualized the iridophores—specialized cells containing coiled protein columns called reflectin—that act as natural Bragg reflectors to finely control light reflection and scattering. This discovery provides the most detailed explanation yet of how squid achieve dynamic color modulation by twisting and packing these nano-scale reflectin columns. Building on these biological insights, the team engineered a bio-inspired, stretchable composite material that mimics and even extends the squid’s optical capabilities. This flexible film integrates nanocolumnar Bragg reflectors with ultrathin metal layers to enable tunable camouflage across visible and infrared wavelengths. The material dynamically adjusts its appearance in response to mechanical deformation or environmental changes, making it promising for adaptive military camouflage, multispectral
materialsbiomimicrycamouflage-technologynanomaterialsoptical-materialsdefense-technologysmart-materialsThe Next Acetaminophen Tablet You Take Could Be Made From PET
Researchers at the University of Edinburgh have developed a novel method to convert plastic waste, specifically PET (polyethylene terephthalate), into acetaminophen using engineered E. coli bacteria. The team, led by Stephen Wallace, discovered that E. coli naturally contains phosphate, which catalyzes a chemical reaction called Lossen rearrangement. By leveraging synthetic biology, they redirected the bacteria’s metabolism to transform terephthalic acid—a molecule derived from PET—into the active ingredient of acetaminophen through a fermentation process completed in under 24 hours. Remarkably, this conversion occurs at room temperature with minimal carbon emissions, highlighting a more sustainable approach to drug production. This breakthrough is significant because it utilizes microbial cells’ inherent capabilities without requiring external catalysts, thereby reducing reliance on fossil fuels traditionally used in pharmaceutical manufacturing. Although the study demonstrates about 90% yield of acetaminophen, the researchers note that further work is needed to scale the process industrially and to assess the safety and efficacy of the drug
materialssynthetic-biologyplastic-waste-recyclingsustainable-drug-productionbiocatalysisgreen-chemistryPET-recyclingBreakthrough turns carbon dioxide into high-strength plastics using clean power
Caltech researchers have developed an innovative system that converts carbon dioxide (CO₂) from the air into durable, industrial-grade plastics using only electricity and chemistry. This breakthrough mimics natural photosynthesis but employs machines instead of plants, utilizing renewable electricity to first transform CO₂ into simple building blocks such as ethylene and carbon monoxide. These compounds are then fed into a second catalytic loop where they are converted into polyketones—high-strength plastics valued for their durability and thermal stability, commonly used in adhesives, automotive parts, sports equipment, and industrial piping. Unlike previous methods relying on fossil-derived ethylene, this process uses sustainably sourced CO₂, water, and electricity, potentially reducing emissions and dependence on petroleum-based feedstocks. The system operates via two separate loops optimized for different reaction conditions. The first loop uses gas diffusion electrode cells with copper-coated hydrophobic polymers to electrochemically reduce CO₂ into ethylene and carbon monoxide at relatively high concentrations (11% and 14%, respectively). These gases
energymaterialscarbon-capturerenewable-energyplastics-productionsustainable-materialscarbon-dioxide-conversionChina ditches calcium in nuclear fusion race to discover new elements
Researchers at Xi’an Jiaotong University in China have developed a novel method for synthesizing superheavy elements beyond uranium using argon-40 (⁴⁰Ar) beams instead of the conventionally used calcium-48 (⁴⁸Ca). Superheavy elements, which have atomic numbers greater than 104, are typically unstable and synthesized in laboratories through fusion reactions involving heavy target nuclei and lighter ion beams. The traditional use of ⁴⁸Ca beams, favored for their high neutron numbers and favorable reaction dynamics, is costly due to the rarity of ⁴⁸Ca, limiting the production of many superheavy nuclei. The new approach proposes bombarding synthetic radioactive berkelium (²⁴⁹Bk) with ⁴⁰Ar to produce isotopes like 286Mc, which is key to the alpha decay chain of the yet-undiscovered element 119. Theoretical models indicate that ⁴⁰Ar offers better fusion probabilities and favorable
materialsnuclear-fusionsuperheavy-elementselement-synthesisparticle-acceleratorsnuclear-stabilityfusion-evaporationKoenigsegg’s 46,000 rpm hypercar unleashes jet energy on four wheels
Koenigsegg has unveiled the Sadair’s Spear, a limited-edition hypercar priced at $5.2 million, built on the Jesko platform and designed for extreme track performance while remaining street-legal. This model pays tribute to founder Christian von Koenigsegg’s father, Jesko von Koenigsegg, named after his father’s favorite racehorse. The car features advanced aerodynamic enhancements such as a lightweight double-blade active rear wing, elongated rear design, expanded front canards, and reengineered hood vents, all contributing to superior cooling and increased downforce for optimal handling. At its heart lies Koenigsegg’s twin-turbo V8 engine paired with the innovative flywheel-free Light Speed Transmission (LST), capable of revving up to 46,000 rpm. The engine produces 1,300 hp on regular fuel and an extraordinary 1,625 hp on E85 fuel. The Sadair’s Spear also emphasizes weight reduction
energymaterialsautomotive-technologyhigh-performance-enginescarbon-fiberaerodynamicsfuel-efficiencyNew toxin-free method extracts precious metal from ore, e-waste
Researchers at Flinders University, led by Professor Justin Chalker, have developed an innovative, toxin-free method to extract high-purity gold from ore and electronic waste. This new approach uses a low-cost, environmentally benign compound called trichloroisocyanuric acid—commonly used in water treatment—that, when activated by saltwater, dissolves gold effectively. The dissolved gold is then selectively captured by a specially designed sulfur-rich polymer, which is synthesized using a sustainable UV light-initiated process. Importantly, the polymer can be recycled after gold recovery, enhancing the method’s environmental credentials and reducing waste. This technique addresses the significant environmental and health hazards posed by traditional gold extraction methods that rely on toxic chemicals like cyanide and mercury. By providing a safer alternative, especially for small-scale mining operations that often use mercury, the new method has the potential to reduce mercury pollution globally. Additionally, it offers a promising solution to the growing challenge of electronic waste, which contains valuable metals but
materialsgold-extractione-waste-recyclingsustainable-materialspolymer-sorbentgreen-technologyprecious-metals-recoveryNew stamp-like hard drive made from novel molecule can hold 3 TB data
Researchers from the Australian National University (ANU) and the University of Manchester have developed a novel single-molecule magnet capable of storing exceptionally large amounts of data in an ultra-compact form factor. This new molecule enables the creation of hard drives about the size of a postage stamp that can hold up to 3 terabytes of data—equivalent to roughly 500,000 TikTok videos or 40,000 copies of Pink Floyd’s "The Dark Side of the Moon" album. Unlike conventional magnetic materials that rely on clusters of atoms, these single-molecule magnets operate individually, allowing for ultra-high-density data storage in a fraction of the space. A key advancement in this research is the molecule’s ability to retain magnetic memory at temperatures around 100 Kelvin (-173°C), which is warmer than previous single-molecule magnets requiring about 80 Kelvin (-193°C). This improvement was achieved by arranging three atoms in a straight line stabilized by an alkene chemical group, enhancing storage capacity and stability.
materialsdata-storagesingle-molecule-magnetsmagnetic-materialsnanotechnologymolecular-electronicsadvanced-materialsLockheed's new long-range radar tracks live ballistic missile in test
Lockheed Martin and the Missile Defense Agency (MDA) successfully tested the Long Range Discrimination Radar (LRDR), demonstrating its capability to detect, track, and discriminate a live intercontinental ballistic missile (ICBM) target amid complex conditions. Conducted on June 23, 2025, at Clear Space Force Station, Alaska, the test involved tracking a missile launched over the northern Pacific Ocean, flying more than 1,242 miles off Alaska’s coast. The LRDR provided critical tracking data to the Command and Control Battle Management and Communications (C2BMC) system, supporting a simulated Ground-Based Midcourse Defense engagement. This test validated LRDR’s extended-range detection and discrimination capabilities, crucial for homeland defense. The LRDR is a solid-state, gallium nitride (GaN)-based radar developed under Lockheed Martin’s Open GaN Foundry model, designed to enhance the US layered missile defense strategy by improving precision in distinguishing real threats from decoys. The radar also
materialsradar-technologygallium-nitridemissile-defenseLockheed-Martinlong-range-radarhomeland-securityNREL Publishes Method for Recycling All Components in Carbon Fiber Composites - CleanTechnica
The National Renewable Energy Laboratory (NREL) has developed a novel, scalable, and cost-effective method to recycle all components of carbon fiber composites (CFCs), materials widely used in high-value products like aircraft, bicycles, and automobiles. CFCs consist of carbon fibers embedded in epoxy-amine resins, which are strong, lightweight, and expensive, but difficult to recycle due to the chemically interlocked and complex nature of the resin. Traditional recycling methods have been limited by the inability to dissolve or break down these resins without degrading the valuable fibers or wasting the resin’s chemical components. NREL’s breakthrough involves using hot acetic acid—essentially vinegar—to cleave the key bonds in the epoxy resins, solubilizing the polymer networks while preserving the chemical building blocks for reuse. This method was optimized to handle diverse resin formulations from various industries and was shown to recover carbon fibers without compromising their strength. In a demonstration, recycled fibers extracted from a scrap mountain-bike frame were used to
materialscarbon-fiber-compositesrecycling-technologyepoxy-resinssustainable-materialsNRELcomposite-materials-recyclingScientists mimic young tissue to reverse ageing in the heart
Researchers at the National University of Singapore, led by Assistant Professor Jennifer Young, have developed a novel lab-grown biomaterial called DECIPHER that mimics the heart’s extracellular matrix (ECM) to reverse ageing effects in heart tissue. Instead of targeting heart cells directly, the team focused on the ECM—a protein-rich scaffold that supports cells and regulates their behavior but stiffens and malfunctions with age, contributing to heart decline. DECIPHER combines natural heart tissue with a synthetic hydrogel, allowing independent control of the ECM’s stiffness and biochemical signals, which was previously difficult to achieve. Using DECIPHER, the researchers demonstrated that aged heart cells cultured on scaffolds replicating youthful biochemical cues exhibited rejuvenation, even when the scaffold remained stiff. Conversely, young heart cells exposed to aged ECM biochemical signals showed early dysfunction regardless of stiffness, highlighting that biochemical environment plays a more critical role than stiffness in aged cell decline. These findings suggest that restoring youthful biochemical signals in the ECM could reverse heart ageing, while controlling stiffness might
materialsbiomaterialstissue-engineeringextracellular-matrixhydrogelheart-regenerationanti-aging-researchUS scientists turn contaminated water into 92% pure fertilizer, fuel
Yale researchers have developed a novel electrochemical method to convert nitrate—a common and harmful water pollutant—into ammonia with a remarkable 92% efficiency. This breakthrough addresses two critical challenges in nitrate conversion: achieving high selectivity (minimizing unwanted byproducts) and high activity (speed of conversion). The team combined an ionophore, which binds and retains nitrite (a problematic intermediate), with an electrified membrane made of copper and carbon nanotubes. This combination allows nitrite to be fully converted into ammonia before it escapes, enabling rapid conversion in just six seconds—significantly faster than traditional methods that take hours. The system was tested successfully on real water samples from a lake and a wastewater treatment plant, demonstrating stability and practical applicability. This technology not only promises cleaner water by removing nitrate pollutants but also produces ammonia, a valuable resource for fertilizers and carbon-free fuels. The researchers believe their approach, detailed in Nature Chemical Engineering, could be scaled up for conventional water treatment, offering a
energymaterialselectrochemical-conversionwater-purificationammonia-productionelectrocatalystssustainable-technologySynthetic lichen could 3D print homes on Mars using Martian soil
Researchers led by Dr. Congrui Grace Jin at Texas A&M University have developed a synthetic lichen system that could autonomously create building materials on Mars using only Martian soil simulant, air, light, and an inorganic liquid medium. This bio-manufacturing approach mimics natural lichens, which are symbiotic communities of fungi and cyanobacteria. The cyanobacteria fix carbon dioxide and nitrogen from the Martian atmosphere, producing oxygen and nutrients, while the fungi bind metal ions and help form biominerals. Together, they secrete biopolymers that glue Martian regolith particles into solid structures, enabling the creation of building materials without human intervention or external nutrient supplies. This innovation addresses major challenges in extraterrestrial construction by eliminating the need to transport heavy materials from Earth or rely on continuous human assistance. Funded by NASA’s Innovative Advanced Concepts program, the technology promises to facilitate autonomous 3D printing of habitats, furniture, and other structures on Mars. The team is currently
materials3D-printingsynthetic-lichenMartian-soilbio-manufacturingspace-constructionbiomaterialsPutin escalates hypersonic missile production amid US-Iran-Israel war
Russian President Vladimir Putin has ordered the serial production of the Oreshnik hypersonic intermediate-range ballistic missile (IRBM) amid escalating tensions linked to the US-Iran-Israel conflict. The Oreshnik, unveiled in November 2024 and operationally tested in Ukraine, is a road-mobile, solid-fueled missile with an estimated range of 5,500 km (3,415 miles) and speeds exceeding Mach 10. It can carry both conventional and nuclear warheads, including multiple or maneuverable reentry vehicles designed to penetrate missile defenses, and boasts high precision with a circular error probable of 10 to 20 meters. This missile expands Russia’s strike capabilities following its 2019 withdrawal from the INF Treaty and is seen as a counter to US long-range precision fire deployments in Europe and Asia. Putin framed the missile’s production as part of Russia’s 2027–2036 State Armament Program, emphasizing modernization across all military branches, including upgrades to the nuclear
materialsenergymilitary-technologyhypersonic-missilesmissile-guidance-systemsdefense-technologystrategic-weaponsNovoloop is making tons of upcycled plastic
Novoloop, a California-based startup, is addressing the plastic recycling challenge by continuously upcycling waste plastic into thermoplastic polyurethane (TPU) at its demonstration plant, producing up to 70 metric tons annually. This upcycled TPU, branded as Lifecycled TPU, is created by breaking down polyethylene into monomers and synthesizing new, more valuable polymers suitable for products like sneakers and car seats. Demand for Novoloop’s material has been strong, prompting plans for a larger commercial-scale facility. The company recently raised $21 million in a Series B funding round led by Taranis, with participation from Valo Ventures and Shop Limited, to finalize the design and begin construction of this plant. Novoloop aims to build the commercial plant alongside an existing chemical facility, leveraging available land and utilities while providing technology and marketing expertise. The startup also explores mechanically recycling TPU scraps from factory floors, enhancing performance to rival virgin materials. For cost efficiency, Novoloop chose to build its demonstration plant
materialsrecyclingupcyclingthermoplastic-polyurethanesustainable-materialschemical-manufacturingplastic-wasteOwl’s silent flight inspires material that tames harsh engine sounds
Researchers at China’s Tiangong University have developed a novel two-layer aerogel inspired by the silent flight of owls, which naturally dampen sound through their specialized feathers and soft skin. This new material mimics owl feathers’ serrated edges and skin’s porous structure to absorb a broad range of sound frequencies, achieving a 58% reduction in noise. Unlike traditional felt fiber soundproofing that typically targets either high- or low-frequency sounds, this lightweight aerogel effectively reduces both, making it superior for noise control applications. The aerogel’s bottom layer features a honeycomb pattern that cancels low-frequency noise, while the top layer consists of silicon nanofibers that dampen high-frequency sounds. In practical tests, it reduced automobile engine noise from 87.5 decibels to 78.6 decibels, outperforming many existing commercial noise absorbers. Additionally, the material is durable, maintaining its structure after repeated compression cycles. This innovation holds promise for reducing noise pollution
materialssoundproofingaerogelnoise-reductionbiomimicrysilicon-nanofibersautomotive-engineeringWaste to painkiller? Bacteria convert plastic into paracetamol
Researchers at the University of Edinburgh’s Wallace Lab have developed a novel method to convert plastic waste into paracetamol (acetaminophen) using genetically engineered E. coli bacteria. This innovative process transforms terephthalic acid, a compound derived from polyethylene terephthalate (PET) plastic bottles, into paracetamol within 24 hours through a fermentation technique similar to beer brewing. Unlike traditional paracetamol production, which relies on fossil fuels and energy-intensive processes that emit significant carbon emissions, this biological method operates at room temperature and produces minimal emissions, offering a more sustainable and cost-effective alternative. The breakthrough hinges on a previously unobserved chemical reaction called the Lossen rearrangement occurring naturally inside living cells, enabling the bacteria to convert PET-based intermediates into para-aminobenzoic acid (PABA), a precursor molecule. By further inserting genes from mushrooms and soil bacteria, the researchers enabled E. coli to complete the conversion to paracetamol. This approach not only presents a promising
materialsbiotechnologyplastic-recyclingsynthetic-biologysustainable-manufacturingbioconversionpharmaceuticalsRevolutionary 3D magnet setup could slash MRI costs and boost access
German physicists from the University of Bayreuth and Johannes Gutenberg University Mainz have developed a novel magnetic field design that surpasses the traditional Halbach array by delivering stronger, cheaper, and more uniform magnetic fields in a compact setup. Their innovation involves arranging 16 tiny neodymium (FeNdB) magnet cuboids in optimized three-dimensional orientations on 3D-printed supports, forming single or stacked double rings. This focused design maintains magnetic field strength and uniformity not only within the magnet plane but also above it, addressing a key limitation of the Halbach array, which struggles to produce uniform fields in finite-sized, practical applications. This breakthrough holds significant promise for technologies requiring stable, homogeneous magnetic fields, particularly medical imaging. Conventional MRI machines rely on costly, complex superconducting magnets that require cryogenic cooling, limiting access in rural and underserved regions. The new permanent magnet configuration offers a low-cost, energy-efficient alternative that could make MRI technology more accessible in remote clinics, mobile health units, and
materialsmagnet-design3D-printingneodymium-magnetsMRI-technologymagnetic-fieldsmedical-imagingInlaid gold patterns found on 1,100-year-old Japan's spear stun experts
Japanese researchers have uncovered a remarkably ornate spear blade dating back 1,100 to 1,300 years on Okinoshima Island, a sacred site recognized as a UNESCO World Heritage location. The spear, found inside a gold sheath among 80,000 artifacts, was revealed through advanced X-ray and CT scanning techniques to be an intricately decorated iron blade measuring about 11-12 inches. Crafted during the Yamato Dynasty, the blade features unique inlaid gold patterns depicting tortoise shells, phoenixes, flowers, and arabesque motifs, created using the kinzōgan technique of embedding gold into carved metal recesses. This spear is considered one of the finest examples of ritual weaponry from East Asia and is now designated a national treasure. The spear was not intended for practical combat use but rather served a significant spiritual and ceremonial role, likely in maritime rituals performed on Okinoshima, which was a spiritual epicenter of early Japanese statehood. Its elaborate craftsmanship and symbolic motifs, such
materialsarchaeologygold-inlayancient-weaponsmetal-craftsmanshipcultural-heritagepreservation-technologyChina finds a clever way to measure extreme heat drops at nanoscale
Chinese researchers from Peking University have developed a novel method to measure heat flow at the atomic scale, overcoming longstanding challenges in observing interfacial thermal resistance between different materials. Using an advanced electron microscopy technique, they tracked how electrons lose energy when interacting with vibrating atoms (phonons), enabling them to visualize heat transfer across material boundaries with sub-nanometer resolution. Their custom device created a controlled heat flow between aluminum nitride (AlN) and silicon carbide (SiC), materials commonly used in high-power electronics, applying a steep temperature gradient of 180 K/μm. The team discovered a sharp temperature drop of 10–20 K occurring over just two nanometers at the interface, indicating thermal resistance 30 to 70 times greater than in the bulk materials. They also found that phonons near the interface were in a nonequilibrium state and did not follow the usual Bose-Einstein distribution, revealing that heat is not merely slowed but scattered and reshaped at these junctions.
materialsnanotechnologythermal-resistanceheat-managementelectron-microscopyhigh-power-electronicsphononsGlass bottles leak 50x more microplastics than plastic: study
A recent French study conducted by ANSES has revealed that drinks sold in glass bottles contain significantly higher levels of microplastics—5 to 50 times more—compared to those in plastic bottles or metal cans. The research, published in the Journal of Food Composition and Analysis, analyzed various beverages including beer, soda, lemonade, water, and wine sold in France. Beer showed the highest contamination, averaging 60 microplastic particles per liter, followed by lemonade and soft drinks. In contrast, water and wine had much lower levels of microplastics. Surprisingly, the source of microplastics in glass bottles was traced not to the glass itself but to the paint on the bottle caps, which sheds particles due to microscopic scratches from friction during storage. While the health risks of microplastic ingestion remain uncertain, the study highlights growing concerns as microplastics have been found in human tissues, including the brain, with some research linking higher plastic accumulation to dementia. ANSES noted there is no established safe threshold
materialsmicroplasticsglass-bottlespackaging-contaminationfood-safetypolymer-analysisenvironmental-pollutionScientists 3D-print thermal insulation fibres from wheat straw
Researchers led by Dr. Chi Zhou at the University at Buffalo have developed a sustainable thermal insulation material by 3D-printing fibers derived from wheat straw, an agricultural byproduct typically burned after harvest. Wheat straw’s natural fibrous and porous structure provides effective thermal insulation, high mechanical strength, and enhanced flame retardancy compared to other organic materials. The process involves pulping wheat straw into a slurry, drying it into a thick ink, and cross-linking the fibers with an organic binder to ensure material integrity before 3D printing. This innovation offers a renewable, biodegradable alternative to conventional insulation materials like glass and rock wool, which rely heavily on fossil fuels and contribute to greenhouse gas emissions. To address the slow printing speed of early methods, Zhou’s team redesigned the 3D printer with a slot-die nozzle and multiple nozzles for faster, more uniform material deposition, making the process scalable for industrial production. Using wheat straw not only reduces environmental impact by lowering emissions and decreasing agricultural waste but
materials3D-printingthermal-insulationsustainable-materialswheat-strawbiomasseco-friendly-materialsLive bacteria-infused sustainable building material traps CO2 from air
Researchers at ETH Zurich have developed an innovative, sustainable building material infused with live cyanobacteria that actively captures atmospheric carbon dioxide through photosynthesis and biocementation. This 3D-printed hydrogel-based material houses photosynthetic bacteria within a polymer network designed to optimize light, CO2, water, and nutrient flow, enabling the bacteria to remain productive for over a year. The material sequesters CO2 both biologically and by forming stable mineral carbonates, which strengthen the initially soft gel into a robust, hardened structure over time. Laboratory tests demonstrated that the material can bind approximately 26 milligrams of CO2 per gram, outperforming typical biological methods and rivaling chemical mineralization in recycled concrete. The technology has moved beyond the lab, with large-scale installations such as the "Picoplanktonics" exhibit at the Architecture Biennale in Venice, featuring three-meter-high structures capable of capturing up to 18 kilograms of CO2 annually—comparable to a mature pine tree.
materialssustainable-buildingcarbon-captureliving-materialscyanobacteria3D-printingbiocementationOkra and fenugreek extracts remove 90% of microplastics from water
Researchers at Tarleton State University, led by Rajani Srinivasan, have discovered that extracts from okra and fenugreek plants can remove up to 90% of microplastics from water, outperforming synthetic chemicals currently used in wastewater treatment. The team developed a simple method by soaking okra pods and fenugreek seeds to produce powders rich in natural polysaccharides, which effectively trap microplastic particles. Fenugreek powder removed 93% of microplastics within an hour, okra removed 67%, and a blend of both achieved 70% removal in just 30 minutes. This plant-based approach offers a low-cost, biodegradable alternative that avoids the harmful residues associated with synthetic polymers like polyacrylamide. Testing in real-world water samples from oceans, groundwater, and freshwater around Texas showed varying but consistently high removal efficiencies: okra was most effective in ocean water (about 80%), fenugreek excelled in groundwater (80-90%), and the blend
materialsmicroplasticswater-treatmentnatural-polymersenvironmental-technologybiodegradable-materialspollution-controlPlant chemical repels bugs but worsens air quality, study shows
A recent study by Michigan State University researchers has uncovered that isoprene, a natural chemical emitted by certain plants, serves as an insect-repellent defense mechanism. Through greenhouse experiments with genetically modified tobacco plants, scientists observed that insects like whiteflies and hornworms avoided or were weakened by plants emitting isoprene. The chemical itself does not directly harm the insects; rather, it triggers an increase in the plant’s jasmonic acid, a hormone that disrupts insect digestion and growth. Additionally, soybeans—previously thought to have lost the ability to produce isoprene—were found to release it in small amounts when their leaves are damaged, indicating a stress-activated defense mechanism. While isoprene helps protect plants from pests, it also contributes to air pollution. Isoprene is a volatile hydrocarbon that reacts with sunlight and nitrogen oxides from human activities, leading to the formation of ozone and other pollutants that degrade air quality. This dual role presents a dilemma for agriculture and environmental
materialsplant-chemistryair-pollutionisopreneinsect-repellentenvironmental-scienceplant-defense-mechanismsCleaner, stronger cement recipes designed in record time by AI
Researchers at the Paul Scherrer Institute (PSI) have developed an AI-driven approach to design low-carbon cement recipes up to 1,000 times faster than traditional methods. Cement production is a major source of CO₂ emissions, primarily due to the chemical release of CO₂ from limestone during clinker formation. To address this, the PSI team, led by mathematician Romana Boiger, combined thermodynamic modeling software (GEMS) with experimental data to train a neural network that rapidly predicts the mineral composition and mechanical properties of various cement formulations. This AI model enables quick simulation and optimization of cement recipes that reduce carbon emissions while maintaining strength and quality. Beyond speeding up calculations, the researchers employed genetic algorithms to identify optimal cement compositions that balance CO₂ reduction with practical production feasibility. While these AI-designed formulations show promise, extensive laboratory testing and validation remain necessary before widespread adoption. This study serves as a proof of concept, demonstrating that AI can revolutionize the search for sustainable building materials by efficiently navigating complex chemical
materialscementartificial-intelligencemachine-learninglow-carbonsustainable-materialsconstruction-materialsPerovskite image sensor triples light capture, sharpens resolution
Researchers at ETH Zurich and Empa in Switzerland have developed a novel perovskite-based image sensor that significantly outperforms traditional silicon sensors in light sensitivity, resolution, and color accuracy. Unlike conventional sensors that rely on color filters—resulting in substantial light loss by capturing only about one-third of incoming photons per pixel—the new sensor uses stacked layers of lead halide perovskite crystals. Each layer is chemically tuned to absorb a specific wavelength (red, green, or blue) without filters, enabling each pixel to capture the full spectrum of light. This design allows the sensor to capture up to three times more light and achieve three times greater spatial resolution than current silicon-based sensors. The perovskite sensor’s tunability comes from adjusting the chemical composition of the crystals, specifically the ratios of iodine, bromine, and chlorine ions, to target different colors. This approach not only enhances image clarity and color precision but also reduces digital artifacts. The researchers have successfully miniaturized the technology
materialsperovskiteimage-sensorlight-capturesemiconductormachine-visiondigital-photographyA timeline of the US semiconductor market in 2025
The U.S. semiconductor market in the first half of 2025 has experienced significant turbulence amid the ongoing AI technology race. Intel underwent major leadership changes with Lip-Bu Tan appointed CEO, who quickly initiated organizational restructuring including planned layoffs of 15-20% in certain units and efforts to spin off non-core businesses such as its telecom chip division. Meanwhile, AMD aggressively expanded its AI hardware capabilities through acquisitions, including the teams behind Untether AI and Enosemi, a silicon photonics startup, positioning itself to challenge Nvidia’s dominance in AI chip technology. Nvidia faced considerable challenges due to U.S. government-imposed AI chip export restrictions, particularly on its H20 AI chips, which led to a projected $8 billion revenue loss in Q2 and a decision to exclude China-related revenue forecasts going forward. The U.S. government’s AI chip export policies have been contentious, with the Biden administration’s proposed AI Diffusion Rule ultimately abandoned in May, and the Trump administration signaling a different regulatory
materialssemiconductor-industryAI-chipsIntelNvidiaAMDchip-export-restrictionsFattah: Iran's Mach 15 speeding solid-fueled missiles hit Israel
Iran has launched a new hypersonic ballistic missile named Fattah, capable of reaching speeds up to Mach 15, which successfully penetrated Israel’s air defense systems during the eleventh phase of Operation True Promise III on June 18, 2025. The Fattah is a two-stage, solid-fueled missile equipped with a movable nozzle and an advanced guidance system, enabling high-precision maneuvers both inside and beyond the atmosphere. With a range of approximately 870 miles (1,400 kilometers), the missile’s speed and maneuverability make it difficult for existing anti-missile defenses to intercept. The Iranian Revolutionary Guard Corps (IRGC) described this deployment as a “turning point” that effectively ends Israel’s air defense capabilities, causing fires and structural damage across central Israel. In response to the missile attack, Israel conducted airstrikes targeting multiple Iranian military facilities, including helicopter bases, missile production sites, and centrifuge manufacturing locations, aiming to disrupt Iran’s
materialssolid-fueled-missileshypersonic-technologyaerospace-innovationsmissile-guidance-systemsdefense-technologypropulsion-systemsColor-changing skins created for robots to react without wires, screens
Researchers at the University of Nebraska–Lincoln have developed stretchable, synthetic skins that mimic the color-changing abilities of cephalopods like squids and octopuses. These skins replicate chromatophores—pigment-filled sacs in cephalopod skin that change appearance when muscles spread the pigment—allowing the materials to dynamically alter color in response to environmental stimuli such as heat, light, pH, and humidity. Unlike traditional electronic displays, these autonomous materials operate without wires, rigid electronics, or user input, enabling soft, flexible devices that sense and react to their surroundings in real time. The technology holds significant promise for applications in soft robotics and wearable devices, where flexibility, adaptability, and water resistance are critical. By tuning the chemical composition, the skins can be programmed to respond to specific environmental triggers, potentially allowing a single wearable to monitor multiple parameters simultaneously. This innovation could replace conventional LED screens or fixed components in certain contexts, offering a new class of human-machine interfaces that display information through
robotmaterialssoft-roboticssynthetic-skinscolor-changing-materialswearable-technologystimuli-responsive-materialsUS labs build low-cost gallium nitride chips for next-gen radars
Researchers at MIT and partner institutions have developed a novel, low-cost fabrication process that integrates high-performance gallium nitride (GaN) transistors onto standard silicon CMOS chips. This breakthrough addresses previous challenges related to GaN’s high cost and specialized integration needs by using a scalable method compatible with existing semiconductor manufacturing. The process involves creating many tiny GaN transistor "dielets," which are bonded onto silicon chips using a low-temperature copper-to-copper bonding technique. This approach maintains material functionality, reduces system temperature, and significantly enhances performance while keeping costs low. The team demonstrated the effectiveness of this hybrid chip technology by building a power amplifier that outperformed traditional silicon-based devices in signal strength and efficiency, indicating potential improvements in wireless communication such as better call quality, increased bandwidth, and longer battery life. The integration method avoids expensive materials and high temperatures, making it compatible with standard semiconductor foundries and promising broad applicability in commercial electronics. Additionally, the researchers suggest that this technology could support quantum computing applications due to
materialsgallium-nitridesemiconductorCMOSchip-fabricationpower-electronicsradar-systemsA New Wave Of Algae Is Perking Up The Vertical Farming Industry - CleanTechnica
The article discusses the emerging role of microalgae, particularly Spirulina, in revolutionizing vertical farming and addressing critical global challenges related to land use, biodiversity loss, and food scarcity. Spirulina, a nutrient-rich blue-green algae, can be cultivated indoors in bioreactors, making it suitable for vertical farming and reuse of existing infrastructure. Researchers at the University of Arizona are enhancing Spirulina’s nutritional profile and developing affordable DIY bioreactors to enable local production, aiming to reduce costs and deploy Spirulina as a sustainable food source in regions facing famine and food insecurity. Despite its nutritional benefits—including providing all nine essential amino acids and vital fatty acids—Spirulina’s widespread adoption has been hindered by its strong, often unpleasant taste when consumed as powder. This taste barrier has limited its commercial use mainly to dietary supplements rather than mainstream food markets. However, Icelandic company VAXA Technologies is tackling this challenge by producing fresh Spirulina with a neutral taste directly from bioreactors, as demonstrated
materialsvertical-farmingalgaeSpirulinabioreactorssustainable-agriculturefood-technologyBreakthrough tech makes bone and dental implants from human urine
Scientists from the University of California, Irvine, in collaboration with U.S. and Japanese researchers, have developed a synthetic yeast system that converts human urine into hydroxyapatite (HAp), a biocompatible calcium phosphate mineral widely used in bone and dental implants. This innovative process addresses two significant challenges simultaneously: it helps mitigate environmental pollution caused by excess nutrients in wastewater and produces a valuable medical material projected to reach a $3.5 billion market by 2030. The engineered yeast, dubbed “osteoyeast,” mimics natural bone-forming cells by breaking down urea to increase pH, facilitating the crystallization and secretion of HAp outside the cell, yielding up to 1 gram per liter of urine. The process is scalable, cost-effective, and accessible globally, as it uses yeast fermentation techniques similar to those in beer production, requiring relatively low temperatures and minimal infrastructure. This makes it particularly suitable for deployment in developing regions lacking advanced manufacturing capabilities, potentially broadening access to advanced
materialsbiotechnologysynthetic-yeasthydroxyapatitebone-implantsdental-implantssustainable-materialsIntel to lay off up to 20% of Intel Foundry workers
Intel plans to lay off 15% to 20% of its Intel Foundry division workforce starting in July 2025, according to an internal memo reported by The Oregonian. The Intel Foundry division, which designs, manufactures, and packages semiconductors for external clients, will see significant job cuts, although the exact number of affected employees has not been disclosed. With Intel's total workforce at approximately 108,900 as of December 2024, this reduction represents a substantial downsizing within the division. These layoffs align with strategic changes initiated by Intel’s CEO Lip-Bu Tan, who took over in March 2025 and has focused on streamlining the company’s core business units, flattening organizational structure, and reinforcing an engineering-first approach. The move follows previous layoffs of around 15,000 employees in August 2024 and was foreshadowed by Tan’s statements at the Intel Vision conference earlier in the year. Intel has not provided further details beyond the internal memo
materialssemiconductorsIntel-Foundrysemiconductor-manufacturingchip-productionworkforce-reductiontech-industrySweden turns oat and wheat waste into clothes for green fashion
Researchers at Chalmers University of Technology in Sweden have developed a sustainable method to produce textile pulp from agricultural waste such as oat husks and wheat straw, offering an eco-friendly alternative to cotton and wood-based cellulose. Their process uses soda pulping, which involves boiling raw materials in lye—a non-toxic substance—to extract cellulose. This technique is simpler and requires fewer chemicals than traditional wood-based methods, as it avoids steps like chipping and debarking. The approach not only reduces environmental impact but also adds economic value to agricultural byproducts that would otherwise be discarded. The study highlights that oat husks and wheat straw are particularly effective for creating dissolving pulp used in textile manufacturing. Ongoing research has also shown promise with other agricultural residues, such as grass press-cake, moving closer to real-world fiber production. The researchers suggest that existing pulp-and-paper industry infrastructure could be adapted to process these materials, potentially accelerating the adoption of sustainable textiles without the need for entirely new facilities. This innovation represents a
materialssustainable-fashioncelluloseagricultural-wastetextile-innovationeco-friendly-textilessoda-pulpingNew diaper transforms poop and plastic into soil in less than a year
Hiro Technologies, a Texas-based startup, has developed MycoDigestible Diapers, an innovative sustainable diaper that uses fungi to transform baby poop and plastic components into nutrient-rich soil within nine months. Disposable diapers, which typically take around 500 years to decompose, contribute significantly to landfill waste and environmental pollution. The company’s approach leverages fungi’s natural ability to break down complex carbon materials, including plastics, by releasing enzymes that degrade the strong carbon bonds in petroleum-based diaper plastics. Each diaper includes a packet of fungi that activates upon exposure to moisture from the diaper’s contents and environment, initiating the biodegradation process. The diapers are made from unbleached cotton and softwood fluff pulp sourced from sustainably managed forests, ensuring they are gentle on babies’ skin and environmentally friendly. Lab tests demonstrated that within nine months, the treated diapers fully decomposed into black soil. Hiro Technologies currently sells diaper bundles online and plans to expand the fungi technology to other plastic-containing products such as adult incontinence and
materialssustainabilitybiodegradable-plasticsfungi-technologywaste-managementenvironmental-innovationdecompositionThe Moment to Make Automotive Steel More Circular Is Now - CleanTechnica
The article from CleanTechnica highlights the urgent need for the European Union to enhance circularity in automotive steel production. Despite the automotive sector being the EU’s second-largest steel consumer, only 6% of the steel used in cars comes from recycled scrap, far below the 56% average across all sectors. This low recycling rate is primarily due to contamination—especially copper from parts like wire harnesses—that occurs when old vehicles are shredded, rendering the steel unsuitable for reuse in new cars. The upcoming revision of the EU’s End-of-Life Vehicles (ELV) Regulation presents a critical opportunity to address this issue by introducing mandatory recycled steel content targets and quality standards. To unlock a market for higher-quality recycled steel, the article argues that EU policymakers should set a target of 30% recycled steel content in new cars by 2030, coupled with local content requirements to support European recyclers and reduce reliance on imported raw materials. Additionally, quality standards must be established to limit copper contamination in shredded scrap
energymaterialsautomotive-steelrecyclingcircular-economyEU-policysustainable-manufacturingTank-grade 30,000-pound off-road bus crushes volcano climbs with ease
The Torsus Praetorian is a formidable 30,000-pound off-road bus engineered in Slovakia on a MAN TGM 4×4 chassis, designed to tackle extreme terrains such as volcano climbs with ease. Measuring nearly 29 feet long and powered by a 6.9L six-cylinder diesel engine producing 285 horsepower and 848 lb-ft of torque, it features advanced off-road capabilities including front and rear differential locks and 15.74 inches of ground clearance. Its rugged yet refined Line-X-coated fiberglass composite body balances durability with drivability, making it almost as easy to handle as a large van. Building on this robust platform, Torsus and camper specialist Dämmler developed the Praetorian Liberra, a luxury off-road motorhome tailored for four occupants. The Liberra offers a compact 28-foot profile with a refined interior featuring solid wood finishes, modular furniture, a kitchen, wet bath, and sleeping arrangements including a double or king-size bed. Designed for
materialsoff-road-vehiclesdiesel-enginefiberglass-compositeautomotive-engineeringrugged-designmotorhomeChina's new heat shield can beat thermal limit for hypersonic flights
Chinese scientists have developed a new carbide ceramic heat shield material capable of withstanding temperatures up to 3,600 degrees Celsius (6,512 degrees Fahrenheit) in oxidizing environments, surpassing the previous thermal limits for hypersonic flight materials. This breakthrough, detailed in the journal Advanced Materials, marks the first time a base material has reached such a high service temperature, breaking the longstanding 3,000-degree Celsius barrier. The ceramic is composed of elements including hafnium, tantalum, zirconium, and tungsten, and features a unique oxide layer structure that protects the tungsten skeleton from oxidation, enhancing its thermal resistance. The new material’s exceptional heat tolerance is critical for hypersonic aircraft and weapons, which require components that maintain structural integrity under extreme thermal stress. Unlike traditional metal alloys and heat shield tiles—such as those used on SpaceX’s Starship, which withstand around 1,371 degrees Celsius—this carbide ceramic can endure much higher temperatures, making it suitable for aerospace, weapons protection
materialscarbide-ceramichypersonic-flightheat-shieldhigh-temperature-resistanceaerospace-materialsthermal-protectionWorld-first aerospace-grade recycled aluminum procured from jet junk
Constellium, a French-based aluminum manufacturer, has achieved a world-first by producing aerospace-grade aluminum ingots made entirely from recycled end-of-life aircraft. Unveiled at the 55th Paris Air Show in June 2025, this breakthrough was developed in collaboration with TARMAC Aerosave and Airbus, demonstrating that high-performance aluminum alloys can be fully recycled without compromising structural integrity or performance. The recycled aluminum meets the stringent mechanical and metallurgical standards required for next-generation aircraft manufacturing, validating the feasibility of a circular economy model in aviation metals. TARMAC Aerosave, specializing in eco-friendly aircraft dismantling and recycling, supplies the raw material and boasts a recycling rate exceeding 92 percent. The partnership with Constellium and Airbus aligns with global decarbonization goals, as recycling aluminum consumes only 5 percent of the energy needed for primary production and cuts carbon emissions by 95 percent. Alongside the recycled ingot, Constellium showcased its Airware aluminum-lithium alloy
materialsrecycled-aluminumaerospace-grade-alloyssustainable-aviationcircular-economyaluminum-lithium-alloysaircraft-recyclingTaiwan places export controls on Huawei and SMIC
Taiwan has imposed export controls on Chinese technology companies Huawei and SMIC, restricting their access to critical resources needed for AI chip production. The Taiwanese International Trade Administration has classified certain high-tech commodities as strategic, requiring government approval for any shipments to these companies. This move effectively limits Huawei and SMIC’s ability to obtain Taiwanese plant construction technologies, materials, and equipment. The export controls are part of a broader effort by Taiwan to address national security concerns and combat arms proliferation. On June 10, the administration added over 600 entities from countries including Russia, Pakistan, Iran, Myanmar, and mainland China—among them Huawei and SMIC—to its restricted entity list. This development could significantly hinder China’s progress in developing advanced AI semiconductors.
materialssemiconductorsexport-controlsAI-chipshigh-tech-commoditiesTaiwan-tradesupply-chain-securityChina advances next-gen lighting with more stable perovskite LEDs
Chinese researchers led by Professor Xiao Zhengguo at the University of Science and Technology of China have developed an innovative all-inorganic perovskite film that significantly enhances LED performance. By introducing specially selected compounds and applying a high-temperature annealing process, the team engineered perovskite films with larger crystal grains and fewer defects. This structural improvement facilitates better charge transport, resulting in LEDs with unprecedented brightness of 1.16 million nits and an extended operational lifespan exceeding 180,000 hours. These advancements overcome previous limitations where perovskite LEDs had short lifespans and low brightness, making them unsuitable for practical applications. The new perovskite LEDs also demonstrate a luminous efficiency surpassing 22%, comparable to current commercial display technologies, and brightness levels far exceeding typical OLED and LED screens, which usually peak at a few thousand nits. Such high brightness and durability make these LEDs promising for outdoor displays and specialized lighting requiring strong visibility. When operated at a standard brightness of 100
materialsperovskiteLED-technologyadvanced-materialsenergy-efficient-lightingnanomaterialsdisplay-technologyNot frozen accidents, quasicrystals change how we define atomic order
The article discusses a significant advancement in understanding quasicrystals—materials whose atomic arrangements are ordered but non-repeating, defying traditional definitions of crystal structures. Discovered in the 1980s, quasicrystals initially faced skepticism, with many scientists believing they were merely accidental, unstable formations resulting from rapid cooling of molten materials. The key unresolved question was whether quasicrystals are thermodynamically stable or just frozen irregularities. Traditional computational methods like density functional theory (DFT), which rely on repeating units, could not effectively model quasicrystals due to their aperiodic nature. Researchers at the University of Michigan addressed this challenge by simulating small nanoparticles of quasicrystals and extrapolating their energies to estimate the stability of the bulk material. They applied this approach to two known quasicrystals—scandium-zinc and ytterbium-cadmium alloys—and demonstrated that these structures have the lowest possible energy configurations, proving their intrinsic stability rather than
materialsquasicrystalsatomic-ordercrystal-structurestabilityphysicsnanomaterialsAluminum alloys with 40% higher strength can lead to safer components
Researchers at the Max Planck Institute have developed novel aluminum alloys that exhibit a 40% increase in strength alongside a fivefold improvement in resistance to hydrogen embrittlement, without sacrificing ductility. By adding scandium to aluminum-magnesium alloys and employing a complex size-sieved precipitation strategy with two-step heat treatment, they engineered dual nanoprecipitates: fine Al3Sc particles that enhance strength, and core-shell Al3(Mg,Sc)2/Al3Sc nanophases that trap hydrogen and prevent embrittlement. This innovative alloy design overcomes the traditional trade-off between strength and hydrogen resistance. The method was validated across various aluminum alloy systems and demonstrated scalability using industrially relevant casting and thermomechanical processing techniques. Advanced characterization methods, including atom probe tomography and electron microscopy, confirmed the atomic-level hydrogen trapping mechanism. Published in Nature, this research addresses a critical limitation in aluminum alloys for the hydrogen economy by enabling safer, stronger, and more durable components suitable for large-scale industrial production
materialsaluminum-alloyshydrogen-embrittlementscandiumnanoprecipitateshydrogen-economyhigh-strength-materialsIn a 1st, China pulls 99.9% ultra-pure rubidium from salt lake brine
Chinese scientists at the Qinghai Institute of Salt Lakes (ISL), part of the Chinese Academy of Sciences, have developed a novel method to extract ultra-pure rubidium chloride (99.9% purity) from brine containing extremely low rubidium concentrations (0.001%). This breakthrough enables China to tap into its abundant but previously commercially unviable rubidium resources found primarily in salt lake brines of Qinghai province and Tibet. The new process involves a comprehensive approach including ore washing, leaching, enrichment, solvent extraction, and purification, and was successfully tested on potassium chloride from the Qarhan Salt Lake. This advancement significantly reduces China’s reliance on foreign rubidium imports, which currently stand at over 66%, mainly from Canada and Zimbabwe. Rubidium is a strategically important alkali metal used in atomic clocks, aerospace systems, perovskite solar cells, specialized glass, and medical imaging. China’s previous challenge was that over 97% of its rubidium reserves are locked in
materialsrubidium-extractioncritical-mineralsultra-pure-metalsChina-technologystrategic-metalsresource-securityWorld’s first art-painted rocket launched into outer space by China
In a groundbreaking collaboration, contemporary artist Jacky Tsai and Chinese aerospace company LandSpace launched the world’s first fully art-painted orbital rocket, the Zhuque-2 Enhanced (ZQ-2E Y2). Standing nearly 50 meters tall, the rocket was entirely covered with vibrant aerospace-grade paints depicting the ancient Chinese legend of Chang’e flying to the moon. The artwork, which flows continuously from nose to base, integrates traditional Eastern storytelling with bold, modern visual techniques, transforming the rocket into a unified visual narrative rather than mere surface decoration. This project required innovative materials and close cooperation between artists and engineers to ensure the paint could withstand extreme launch conditions without compromising the rocket’s performance. The successful launch and orbit insertion of the ZQ-2E Y2 validated this pioneering fusion of art and aerospace engineering, proving that complex visual art can be integrated into space vehicles without affecting functionality. Painted segments recovered after stage separation serve as tangible artifacts symbolizing the intersection of science and storytelling. This initiative redefines
energyaerospacematerialsrocket-technologyaerospace-engineeringaerospace-paintsspace-launchHow Minor Metals Could Cause Major Electrification Bottlenecks - CleanTechnica
The article from CleanTechnica highlights a critical but often overlooked challenge in the global electrification transition: the supply constraints of minor or by-product metals such as indium, gallium, germanium, tellurium, selenium, and certain rare earth elements. Unlike primary metals like lithium and cobalt, whose production can be scaled more directly in response to demand, these by-product metals are produced only incidentally during the mining and refining of major metals like copper, zinc, nickel, and aluminum. This dependency means their supply is inherently tied to the extraction rates and market dynamics of unrelated primary metals, leading to unpredictable availability and price volatility that complicates strategic planning for industries reliant on these materials. Economically, the recovery of by-product metals is marginal and highly sensitive to market prices. For example, zinc refiners will only recover indium if its market price justifies the cost; otherwise, it remains in waste streams, causing intermittent shortages. This contrasts with primary metals, where steady demand typically supports sustained
energyelectrificationminor-metalssupply-chainrare-earth-elementsminingmaterialsDreamliner’s first fatal crash renews doubts over Boeing safety
The recent fatal crash of an Air India Boeing 787-8 Dreamliner near Ahmedabad marks the first deadly incident involving this widely used aircraft model and has reignited global concerns about Boeing’s manufacturing practices and overall safety. Flight AI171, carrying 242 passengers and crew, crashed shortly after takeoff, prompting an official investigation by India’s Aircraft Accident Investigation Bureau (AAIB) and the formation of a high-level committee to review aviation safety protocols. While no mechanical failure has been officially confirmed, attention has turned to prior whistleblower warnings from former Boeing engineer Sam Salehpour, who in 2024 alleged that Boeing took manufacturing shortcuts on the 787 and 777 models. Salehpour claimed that improperly filled gaps in the fuselage assembly and misaligned parts—sometimes temporarily forced into place by workers physically jumping on components—could compromise structural integrity and increase the risk of catastrophic failure over time. Boeing has denied these allegations, maintaining the Dreamliner’s safety, but the FAA investigated Salehp
materialsaerospace-engineeringstructural-integrityBoeing-787aircraft-manufacturingaviation-safetywhistleblowerVolvo Cars to Use Recycled Steel in Next EV - CleanTechnica
Volvo Cars is advancing its sustainability efforts by committing to use high-quality, recycled, and near zero-emissions steel supplied by SSAB starting in 2025. This makes Volvo the first automaker to secure such a deal for mass-produced vehicles. The recycled steel will initially be incorporated into the upcoming fully electric Volvo EX60 SUV and future SPA3 architecture models. Volvo emphasizes that this recycled steel meets the same stringent safety and durability standards as traditional steel, aligning with its reputation for safety and environmental responsibility. The move is part of Volvo’s broader strategy to reduce its carbon footprint, as steel production accounts for about 25% of material-related emissions in its cars. The company aims to cut average CO2 emissions of its vehicles by 65–75% by 2030 compared to 2018 levels and achieve net-zero greenhouse gas emissions by 2040. Volvo also plans for an average of 30% recycled content across its fleet by 2030, with new models from that year containing
energymaterialsrecycled-steelelectric-vehiclessustainabilitycircular-economyVolvo-CarsMIT scientists make hydrogel to pull water from air with zero power
MIT scientists have developed an innovative, origami-inspired hydrogel device that passively harvests clean drinking water from atmospheric moisture without requiring any external power source. The black, window-sized panel, made from a water-absorbent hydrogel enclosed in a glass chamber with a cooling polymer coating, exploits natural temperature fluctuations between night and day to absorb and then release water vapor. Tested in California’s Death Valley, one of the driest places on Earth, the prototype successfully extracted up to 160 milliliters of water daily even at low humidity levels (around 21%), demonstrating its effectiveness in arid environments. The hydrogel’s unique composition, stabilized with glycerol to prevent salt leakage, ensures the collected water remains safe to drink without the need for additional filtration. Its dome-shaped, bubble wrap–like surface design increases absorption efficiency by maximizing surface area. Unlike previous technologies that depend on electricity, batteries, or solar panels, this device operates autonomously, making it particularly suitable for resource-limited
materialshydrogelwater-harvestingclean-water-technologyenergy-free-devicesustainable-materialsMIT-innovationNew dual-layer coating achieves 99.6% iron corrosion protection
Researchers at the Hebrew University of Jerusalem have developed a new dual-layer coating that provides 99.6% protection against iron corrosion, addressing a longstanding challenge in preserving iron’s structural integrity. The innovative coating combines an ultra-thin molecular primer made of N-Heterocyclic Carbene (NHC), which chemically bonds tightly to the iron surface, with a durable polymer layer that adheres strongly to the primer. This combination forms a robust, long-lasting barrier that remains effective even under harsh conditions such as prolonged exposure to corrosive saltwater, outperforming existing protective solutions that often degrade or flake off over time. This advancement promises significant benefits for industries relying on iron-based materials, including construction, transportation, and manufacturing, by extending the lifespan of infrastructure like bridges, pipelines, and ships while reducing maintenance costs. The researchers emphasize that widespread adoption of this coating could lead to more sustainable and cost-effective use of iron, mitigating the global economic impact of corrosion, which currently costs an estimated $2.5
materialscorrosion-protectioniron-coatingdual-layer-coatingpolymer-primerrust-preventioninfrastructure-durabilityWorld's first metal-free motor could supercharge EVs and spacecraft
Researchers at the Korea Institute of Science and Technology (KIST) have developed the world’s first fully functional electric motor made entirely without metal components, using carbon nanotubes (CNTs) instead of traditional copper coils. This metal-free motor demonstrates a 133% increase in electrical conductivity and is 80% lighter than conventional copper-based motors. The innovation addresses a critical challenge in transportation—lightweighting—which can significantly improve energy efficiency, battery performance, and range in electric vehicles, drones, and spacecraft. The motor was successfully tested by powering a scale model car on asphalt roads, achieving speeds over half a meter per second and continuous operation for 60 minutes under varying loads. A key breakthrough enabling this development was a novel purification technique called the LAST (Lyotropic Liquid Crystal-Assisted Surface Texturing) process. This method removes metal catalyst impurities embedded in CNTs during production, reducing contamination from 12.7% to less than 0.8%, while preserving the nanotubes’ electrical properties. The process involves dissolving CNTs in chlorosulfonic acid to form a liquid crystal state that self-aligns the tubes; exposure to water then generates hydrochloric acid that eliminates iron impurities. The purified CNT cables achieved an electrical conductivity of 7.7 megasiemens per meter, comparable to copper but at a fraction of the weight (1.7 g/cm³ vs. copper’s 8.9 g/cm³). This advancement holds promise for significantly reducing motor weight across various applications without compromising performance.
materialscarbon-nanotubeselectric-motorlightweight-technologyelectric-vehiclesspacecraftenergy-efficiencyReassessing Steel: How Falling Cement Use Alters Future Projections - CleanTechnica
The article "Reassessing Steel: How Falling Cement Use Alters Future Projections" explores a revised outlook on global steel demand, prompted by insights from Scott Norris, a structural steel expert. Initially, the author anticipated steady steel demand growth driven by ongoing infrastructure expansion in developing countries. However, after examining cement industry trends and their close link to steel consumption—since about half of steel demand is tied to construction—the author now believes previous steel growth projections were overly optimistic. The World Cement Association’s forecast that global cement demand will peak and then decline by mid-century, due to completed urbanization in developed economies and changing building methods, significantly impacts steel demand expectations. China’s massive past infrastructure build-out, which accounted for half of global steel and cement demand, is winding down, and other regions like India and Southeast Asia are unlikely to replicate China’s scale of growth. Despite this, Norris highlights that developing regions, particularly India and parts of Southeast Asia, will see near-term steel demand increases due to ongoing infrastructure projects and new blast furnace steel plants, which have long operational lifespans extending into the late 21st century. India aims to double steel production by 2030, with potential further growth by mid-century, while Southeast Asian countries like Vietnam and Indonesia also anticipate rising demand. Nonetheless, the author remains skeptical that these regional increases will offset the broader global decline driven by cement displacement and decarbonization trends, suggesting a more cautious long-term outlook for steel demand than previously assumed.
materialssteel-industrycement-demandconstruction-materialsinfrastructure-developmentdecarbonizationglobal-steel-demandQualcomm to acquire semiconductor firm Alphawave Semi for $2.4B
Qualcomm has announced its agreement to acquire Alphawave Semi, a U.K.-based semiconductor firm specializing in high-speed data center connectivity, for approximately $2.4 billion. Qualcomm CEO Cristiano Amon highlighted that this acquisition aims to expand Qualcomm’s presence in the data center market by combining advanced technology solutions to enhance connected computing performance across various high-growth sectors, particularly data center infrastructure. Alphawave Semi develops a range of wired connectivity and compute technologies, complementing Qualcomm’s existing portfolio. This acquisition follows a recent larger deal by Qualcomm in the semiconductor space, signaling the company’s strategic focus on strengthening its data center capabilities. The transaction is anticipated to be completed in the first quarter of 2026.
materialssemiconductorsdata-centerconnectivityQualcommtechnology-acquisitionhigh-speed-data-transferBiodegradable microplastics could pose diabetes threat, harm gut
A recent study highlights potential health risks posed by biodegradable microplastics, specifically polylactic acid (PLA), widely used in eco-friendly food packaging and disposable tableware. Unlike conventional plastics, PLA is derived from renewable resources like corn starch and sugar cane and has been considered a sustainable alternative. However, the study reveals that PLA microplastics do not merely pass through the digestive system but enter the metabolic cycle of gut bacteria and intestinal cells. Using mouse models, researchers found that certain gut bacteria secrete enzymes that break down PLA microplastics, turning them into carbon sources that may contribute to metabolic disorders such as diabetes and hyperuricemia, which can lead to gout and kidney stones. Additionally, PLA microplastic fragments in gut epithelial cells reduce the production of linear short-chain fatty acids, essential energy sources for these cells, resulting in decreased appetite and weight loss in mice. The study also suggests that PLA microplastics may promote harmful bacteria like Helicobacter muridarum, potentially disrupting the gut microbiome balance by displacing beneficial microbes. While the exact mechanisms remain unclear, the researchers propose that frequent plastic consumption may have conditioned gut microbiota to recognize and metabolize these particles. Importantly, the study notes that the adverse effects might be reversible if exposure to PLA microplastics ceases for six to twelve months. This research raises concerns about the hidden health impacts of biodegradable plastics previously regarded as safe alternatives to conventional plastics.
materialsbiodegradable-plasticsmicroplasticspolylactic-acideco-friendly-materialshealth-impactgut-bacteriaChina's scientists use rare mineral tellurium to restore vision in mice
Chinese scientists at Fudan University in Shanghai have developed an innovative artificial retina implant using tellurium nanowires that can restore vision in blind mice and improve vision in monkeys. Tellurium, a rare element with excellent photoelectric properties, mimics the function of photoreceptor cells by converting light—including infrared radiation—into electrical signals that the brain can interpret as images. The researchers created a mesh-like network of tellurium nanowires, called tellurium nanowire networks (TeNWNs), which when implanted into the retinas of blind animals, restored pupillary responses and activated the visual cortex. Blind mice implanted with the device performed nearly as well as sighted mice in pattern recognition tasks, and monkeys showed improved vision, including the ability to see infrared light, which is normally invisible to mammals. This breakthrough represents a potential first step toward bionic eyes with enhanced capabilities such as infrared “super sight.” While human trials are not imminent due to regulatory hurdles, the tellurium-based technology may lead to a new generation of artificial retinas that restore and augment vision. The research intersects nanotechnology, neuroscience, and materials science, with implications for medicine, military applications, and human enhancement. The study was published in the journal Science, highlighting tellurium’s strategic importance as China controls most of its production and its expanding use in solar panels, semiconductors, thermoelectric devices, and now neural vision implants.
materialsnanotechnologytelluriumartificial-retinaphotoreceptor-cellsinfrared-visionbionic-eyesWorld Environment Day Calls On You To #BeatPlasticPollution - CleanTechnica
The article highlights the urgent call by the United Nations Environment Program (UNEP) for global action to #BeatPlasticPollution, the theme of World Environment Day 2025. It emphasizes the critical importance of addressing the full lifecycle of plastics—from production to disposal—rather than relying solely on recycling. With over 460 million tons of plastic produced annually, plastics and microplastics have become pervasive pollutants, infiltrating terrestrial and marine ecosystems, soils, the atmosphere, and even human bodies, including lungs, blood, and fetuses. This widespread contamination poses serious threats to human health, planetary ecosystems, and economic stability. The article also notes that plastics contribute significantly to carbon emissions and are filling oceans, harming marine life and coastal communities. South Korea, the 2025 World Environment Day host, is identified as the fourth largest producer of plastic polymers globally, underscoring the challenge of plastic pollution even among environmentally engaged nations. The article draws attention to the prevalence of polyethylene terephthalate (PET) plastics, which constitute about 50% of microplastics in wastewater and 12% of global solid waste, highlighting ongoing research into biodegradation methods. Looking ahead, plastic production is projected to triple by 2060 unless decisive global measures are taken. A key upcoming event is the August 2025 vote in Geneva on a global plastics treaty aimed at banning certain plastics, though progress faces resistance from petrochemical-producing countries. Advocates stress the need to “turn off the plastics tap” and implement systemic changes to reduce plastic pollution worldwide.
materialsplastic-pollutionmicroplasticscircular-economysustainable-materialsenvironmental-impactpolymer-productionQuantum tunneling observed in heavy fluorine atoms for first time
A recent study has, for the first time, observed quantum tunneling in heavy fluorine atoms, breaking the long-held "fluoro wall" belief that such heavy atoms cannot tunnel. Quantum tunneling is a phenomenon where particles pass through energy barriers they classically shouldn’t overcome. Previously, tunneling had been mostly seen in very light atoms like hydrogen, oxygen, and nitrogen. Researchers discovered this effect by trapping fluorine atoms in a frozen neon matrix at –270°C and using infrared spectroscopy to analyze unusual signals from a negatively charged ion composed of five fluorine atoms (F₅⁻). The central fluorine atom in this ion was found to tunnel between two equivalent positions, a behavior confirmed by quantum mechanical simulations. This breakthrough challenges existing views in quantum chemistry, suggesting that tunneling may occur more widely, even in heavier atoms under certain conditions. The finding has significant implications for understanding fluorinated compounds, which are important in pharmaceuticals, battery technology, and environmental science. For instance, fluorinated groups enhance drug absorption and battery efficiency, while fluorine-rich pollutants like PFAS are notoriously persistent in the environment. Understanding and potentially controlling fluorine tunneling could lead to new methods for breaking down such pollutants or designing advanced materials and medicines.
materialsquantum-tunnelingfluorinechemical-reactionsspectroscopyquantum-mechanicsatomic-physicsQuantum tunneling time cracked: Electrons barely pause before escaping
A recent study has resolved the long-standing question of how long quantum tunneling takes by introducing a novel phase-resolved attoclock technique. Quantum tunneling, where electrons pass through energy barriers they normally couldn't cross, occurs on attosecond timescales, making direct measurement extremely challenging. Traditional attoclock methods, which use rotating elliptical laser fields to infer tunneling times from electron emission angles, have produced inconsistent results due to complex interpretations and distortions. The new approach employs perfectly circularly polarized laser light combined with precise control of the carrier-envelope phase (CEP), allowing researchers to track the exact peak of the electric field that triggers electron escape, thereby eliminating non-time-dependent distortions and improving measurement reliability. Using this refined method, the researchers found that electrons do not experience any measurable delay during tunneling; they essentially "barely pause" before escaping the atom. Instead, the key factor influencing electron emission is the strength of the atom’s hold on the electron prior to tunneling, not the tunneling duration itself. This finding challenges previous assumptions about tunneling dynamics and has significant implications for modeling ultrafast atomic and molecular processes. Additionally, the study suggests that the phase-resolved attoclock technique is stable and precise enough to be adapted for real-time chemical analysis, potentially advancing applications in ultrafast spectroscopy and quantum technologies.
materialsquantum-tunnelingattoclock-techniqueelectron-dynamicslaser-physicsquantum-physicsultrafast-measurementInsects help scientists create powerful new materials from nanocarbons
Researchers at Japan’s RIKEN Pioneering Research Institute and Center for Sustainable Resource Science have developed an innovative technique called “in-insect synthesis,” which uses insects as living chemical reactors to create and modify complex nanocarbon molecules. Led by Kenichiro Itami, the team focused on tobacco cutworm caterpillars, leveraging their powerful digestive enzymes to perform precise chemical modifications that are difficult or inefficient in traditional laboratory settings. By feeding the caterpillars a nanocarbon molecule known as [6]MCPP, the insects converted it into a fluorescent derivative, [6]MCPP-oxylene, through an oxidation reaction catalyzed by two specific enzymes, CYP X2 and CYP X3. This enzymatic process was confirmed through advanced analytical techniques and genetic analysis, demonstrating a level of chemical precision not achievable by current lab methods. This breakthrough highlights the potential of using biological systems, such as insects, enzymes, and microbes, to manufacture advanced materials with high efficiency and specificity. The discovery that caterpillar enzymes can insert oxygen atoms into carbon–carbon bonds in nanocarbons opens new avenues for producing functional molecules for applications in aerospace, electronics, and battery technology. The research team envisions further optimization of this approach through genetic tools like CRISPR and directed evolution, enabling the programming of insects to synthesize a wide range of valuable compounds, from glowing sensors to pharmaceuticals. This novel strategy represents a paradigm shift in materials science, moving away from traditional chemical synthesis toward bioengineered production platforms.
materialsnanocarbonsinsect-enzymeschemical-synthesisadvanced-materialsnanotechnologybiotechnologySilicon-free transistors with high electron mobility built in Japan
materialstransistorsgallium-doped-indium-oxideelectron-mobilitysemiconductor-technologyminiaturizationfield-effect-transistorScientists build €8 underwater data hubs from old smartphones
robotIoTenergymaterialsdata-centerssustainabilitymarine-technologyBreakthrough: Scientists spot hidden quantum states after 60-year hunt
materialsquantum-statessuperconductorssemiconductorenergy-scalesnanowiresvortex-statesUS turns recycled scrap into 3D-printed rocket parts with AI boost
robotmaterials3D-printingAIadditive-manufacturingrecycled-materialssustainable-manufacturingCheapest carbon fix? Common clay may help capture CO₂ from the air
materialsCO2-captureclimate-technologyclay-mineralsenvironmental-solutionscarbon-dioxidenanomaterialsUS Army creates 3D-printed skin to heal combat wounds, fight bugs
materialsbioprintingbiomaterialsbiomedical-technologies3D-printingmilitary-technologytissue-engineeringNew form of magnetism discovered promises faster, denser memory tech
materialsmagnetismenergy-efficientmemory-devicesspintronicselectronic-spinsultrafast-technologyLow-grade clay turned into powerful cement for green construction
materialscementsustainable-constructionenvironmental-impactclayconcreteengineeringAtom-level imaging breakthrough paves the way for smarter gas sensors
materialsgas-sensorsatomic-precisiondefect-engineeringcatalysisplatinum-atomsultrathin-materialsPhysicists create world’s smallest violin that’s thinner than hair
materialsnanotechnologynanolithographyelectronicsenergy-harvestingprecision-engineeringmicrofabricationNREL & Crysalis Biosciences Collaborate To Scale Up Domestic Biomanufacturing Technologies - CleanTechnica
energybiomanufacturingbiofuelsbiomassrenewable-energychemicalsmaterialsScalable lithium sulfide tech sets stage for solid-state battery boom
energymaterialssolid-state-batterieslithium-sulfidebattery-technologyproduction-processenergy-efficiencyAI sorts 1 million rock samples to find cement substitutes in waste
materialsAIcement-substituteseco-friendly-materialsconcrete-sustainabilitymachine-learningalternative-materialsNovel self-healing circuit board could solve world's e-waste crisis
materialse-wasterecyclingself-healingcircuit-boardsustainable-technologyliquid-metalHidden layer in solid-state batteries could unlock faster, safer power storage
energymaterialssolid-state-batteriesbattery-technologyion-transportsafer-batterieselectrochemistrySwiss scientists makes make infrared light visible with tiny lens
materialslithium-niobatenanotechnologyoptical-componentsinfrared-technologyphotonicsnanoscale-patternsNew laser crystals boost quantum tech and cut rare earth reliance
materialslaser-technologyquantum-computingrare-earth-elementsoptical-materialsfiber-opticsenvironmental-monitoringBattery-free magic: US team creates jumping shells for seed dispersal
robotenergymaterialsseed-dispersalautonomous-structuresmetashellspolyethylene-terephthalateBreakneck data center growth challenges Microsoft’s sustainability goals
energysustainabilitycarbon-emissionsdata-centersmaterialsMicrosoftclean-energySpace Forge raises $30M Series A to make chip materials in space
materialsenergysemiconductorsspace-technologycrystal-growthmanufacturingaerospaceMagnetic fields supercharge catalysts for cleaner water and cheaper ammonia
energymaterialscatalystsammonia-productionwastewater-treatmentmagnetic-fieldselectrochemistryNew 2D material could be used in electrochemical energy storage
materialsenergyelectrochemical2D-materialsboroncopper-boridenanomaterialsChina’s capacitor-free coil gun can fire 3,000 projectiles a minute, outpacing rivals
energymaterialsroboticslithium-ion-batterieselectromagnetic-coilscoil-gundirected-energy-weaponUK fusion device gets heating components to withstand extreme temperature
fusionenergyplasma-heatingtokamakmaterialselectromagnetic-wavesnuclear-fusionFirst-ever liquid carbon created with lasers to boost fusion research
materialsnuclear-fusionliquid-carbonhigh-performance-laserscooling-agentsneutron-moderationextreme-conditionsRare graphite flakes behave as both superconductor and magnet at 300 K
materialssuperconductivitygraphenemagnetismenergyquantum-computingresearchUS scientists make rubber 10x tougher, more resistant to cracking
materialsrubberdurabilitysustainabilitypolymerengineeringresearchPhotos: Saudi Arabia's new museum is made from mud, adapting to desert
materialssustainable-constructionenergy-efficiencycultural-heritagemud-brick-architecturedesert-climatetraditional-building-techniquesNew silicone glows in vibrant colors while conducting electricity
materialssemiconductorelectrical-conductivityflexible-electronicssiliconecopolymerinnovative-materialsLondon-New York in 45 mins: New hypersonic jet could fly 7x speed of sound
materialsenergyhypersonicaviationhydrogenaerospacetechnologyScientists simulate how tens of thousands of electrons move in real time
materialsenergyquantum-mechanicselectron-dynamicsphotovoltaic-cellssimulationnanostructuresScientists accidentally create material that harvests water from air
materialsnanomaterialswater-harvestingcapillary-condensationenvironmental-technologysustainable-materialsenergy-efficient-solutionsEV makers can cut rare earth use by 15% with new design tool: Study
energymaterialselectric-vehiclescircular-economyrare-earth-elementsremanufacturingsustainabilityUS accelerator slashes power use by 80%, boosts beam brightness by 100x
energymaterialsaccelerator-technologybeam-brightnesspower-consumptionpermanent-magnetsresearch-innovationLiving tattoos for buildings might turn urban walls into air purifiers
materialsenergypollutioncarbon-capturesustainable-architecturebioactive-surfacesurban-innovation3x boost: US scientists increase bridge lifespan with corrosion-resistant steel
materialscorrosion-resistantinfrastructurestainless-steelrebarconstructionengineeringGrain-sized cooling tech cuts energy use by 70%, doubles efficiency
energymaterialsthermoelectric-coolingrefrigeration-technologynanoengineeringefficiencysustainable-technologyWorld-first: Gene-edited spider produces glowing red silk threads
materialsgene-editingspider-silkCRISPR-Cas9biotechnologyadvanced-textilessustainable-materialsDrones could fly 30% farther with golf ball-style shape-shifting skin
robotIoTenergymaterialsdronesdrag-reductionmaneuverabilityScientists turn simple clay into base for quantum computer in Norway
materialsquantum-computingclaysemiconductor-propertiesenvironmental-sustainabilitysuperconductorsresearch-collaborationWorld’s fastest quantum switch built by US team for ultra-fast AI
materialsquantum-computinggrapheneultrafast-computingAI-hardwaretransistorslaser-technologySouth America find 13 million tons in copper, gold, silver deposits
materialscoppergoldsilverminingresourcesgeologyCanada firm's eVTOL becomes first to achieve full wing transition
robotIoTenergymaterialseVTOLhybrid-electricaviationNew DirectDrive plasma etching tech to help build ultra-precise chips
materialssemiconductorplasma-etchingchip-manufacturingprecision-technologyelectronicsRF-energyChina's new fibre-optic gyroscope can withstand temperatures changes
materialsnavigationgyroscopeoptical-fiberstechnologyaerospacedeep-sea-explorationPower of pyrazinacene: This crystal turns violet to expose a pollutant
materialscrystal-technologychemical-sensorscharge-transferenvironmental-monitoringpollution-detectionpyrazinaceneGM’s new ‘manganese rich’ battery promises cheaper EVs in 2028
energymaterialselectric-vehiclesbattery-technologyGeneral-Motorslithium-manganese-richcost-reductionPhòng thí nghiệm Anh tạo ra chất làm lạnh mới trong điều hòa
energymaterialscooling-technologybarocaloric-materialsgreenhouse-gas-reductionenergy-efficiencysustainable-coolingInventWood is about to mass produce wood that’s stronger than steel
materialsSuperwoodcelluloseligninconstructioncarbon-impacttensile-strengthThe Future of Manufacturing Might Be in Space
materialsmanufacturingspace-technologycrystal-growthsemiconductorin-space-manufacturingaerospaceUS Defense Department Launches Bioeconomy Plan Against Fossil Fuels
energybioeconomymaterialsindustrial-competitivenessadvanced-materialsbio-based-productsDefense-DepartmentPhân tử mới có thể cách mạng hóa ngành sản xuất chip
materialssemiconductororganic-moleculeselectrical-conductivitychip-productionnanotechnologyenergy-efficiencyMáy bay Anh lập kỷ lục bay liên tục lâu nhất thế giới
robotIoTenergymaterialsdronesolar-powercommunicationInterview with Amina Mević: Machine learning applied to semiconductor manufacturing
robotIoTenergymaterialsmachine-learningsemiconductor-manufacturingvirtual-metrologyPure Lithium Announces Engagement with Kingston Process Metallurgy to Scale Lithium Metal Anode Production
lithiumbattery-technologyenergymaterialselectroplatingproductionmetallurgy