Articles tagged with "clean-technology"
New York Build Expo: Heat Pumps Take Center Stage - CleanTechnica
At the New York Build Expo held at the Javits Center, heat pumps emerged as the central technology trend, akin to the prominence of AI at CES. Major industry players such as Midea, GE/Haier, Gree, Daikin, and Bosch showcased a wide variety of heat pump systems designed to meet diverse building needs, from window units and interior-only systems to residential outdoor units and industrial-scale solutions for high rises. These products addressed challenges like the lack of ductwork in older buildings, aesthetic considerations, and replacing traditional radiators. Complementary technologies focused on upgrading air handlers, plumbing, and building insulation to optimize heat pump efficiency, particularly given their lower temperature output compared to steam or combustion heating. A significant driver behind the heat pump emphasis is New York City’s Local Law 97, which imposes strict carbon emission limits on large buildings and levies substantial fines for non-compliance, incentivizing building owners to adopt cleaner heating technologies. The law’s impact is expected to influence other regions
energyheat-pumpsclean-technologyHVACbuilding-insulationrenewable-energyenergy-efficiencyCan Leapmotor Bust Its Way into the European Auto Market With the A05? - CleanTechnica
Leapmotor, a rapidly rising electric vehicle (EV) manufacturer, is preparing to enter the European market with its A05 model, aiming to challenge established local brands by offering competitive pricing and solid value. The A05, a compact EV measuring 4.2 meters long, 1.8 meters wide, and 1.6 meters tall, will compete with popular models like the Cupra Born, Renault Megane, and MG 4 EV. Leapmotor plans to price the A05 starting at around £25,000 in the UK, significantly undercutting its European rivals while maintaining quality and specifications. The company’s strategy focuses on rapid model rollout with a clear market positioning—offering one trim level per model to target specific segments and emphasizing affordability without compromising features. Leapmotor UK Managing Director Damien Dally highlights the brand’s identity as a “non-materialistic” choice backed by Stellantis, the world’s fourth-largest automaker, which lends credibility and support. This backing aims to
electric-vehiclesEV-marketLeapmotorautomotive-industryenergy-transitionclean-technologyEuropean-auto-marketAnother EV Bites the Dust in USA - CleanTechnica
The article from CleanTechnica highlights the negative impact of recent Republican policy decisions on the US electric vehicle (EV) market. The elimination of EV incentives and the rollback of automaker fuel economy and CO2 emission standards have led to a decline in EV sales, the cancellation of major production investments, and the withdrawal of several EV models from the US market. Notably, Volvo has canceled the US release of its EX30 model, joining other manufacturers like Ford, Hyundai, and Honda, who have also pulled or canceled EV models in the US. A key factor contributing to the EX30’s failure in the US is the 100% tariff on EVs manufactured in China, which pushed the vehicle’s price to an uncompetitive level—starting around $50,000 and later dropping to $40,000—making it unattractive to American consumers. Despite this setback, Volvo plans to continue selling larger electric vehicles in the US market, such as the EX60 and EX90, aligning with American preferences
energyelectric-vehiclesEV-marketautomotive-industryrenewable-energyUS-marketclean-technologyBrazil Fuels BYD Growth in the Americas, Mexico & Argentina Place 100,000 Orders - CleanTechnica
The article highlights BYD's significant growth in the Americas, particularly fueled by strong sales in Brazil, Mexico, and Argentina. In Brazil, the BYD Dolphin Mini (also known as Seagull) became the top-selling vehicle in February 2025, marking the first time an electric vehicle (EV) or Chinese brand achieved this milestone in the country. BYD sold approximately 112,900 vehicles in Brazil in 2025 and aims to reach 250,000 sales this year. The company is producing several models at its Bahia plant, including the Seagull, Sealion 05, and Atto 3, and is expanding production capacity with a goal of 600,000 units, potentially accelerating faster than expected. BYD's growth strategy also involves leveraging Mercosur trade agreements to bypass import quotas on Chinese vehicles, enabling broader market penetration in South America. Despite political and regulatory challenges in some regions—such as EU restrictions on imported batteries affecting corporate fleet sales—BYD continues
energyelectric-vehiclesBYDautomotive-industryclean-technologybattery-technologyEV-market-growthCUPRA Tavascan EV Exempted from EU Tariffs on Chinese EVs - CleanTechnica
The European Union has granted an exemption from its tariffs on Chinese electric vehicles (EVs) for the CUPRA Tavascan, a model produced in China but branded by the European Volkswagen Group. This exemption is notable because the EU generally imposes tariffs on Chinese EV imports to protect its domestic automotive industry. Volkswagen Group successfully argued that the Tavascan’s pricing strategy would not harm European manufacturers, leading to the exemption under strict conditions. These include a minimum pricing threshold (undisclosed), a cap on the number of units sold within the EU, and a restriction preventing Volkswagen Anhui from exporting other EV or plug-in hybrid models from China to the EU under the same exemption. The CUPRA Tavascan is positioned as a niche, low-volume model rather than a mass-market vehicle, with global sales totaling 1,685 units since launch and 1,407 sold in 2025 alone. The exemption helps avoid tariff-related price increases that could have negatively impacted sales and jobs within the brand
energyelectric-vehiclesEU-tariffsCUPRA-TavascanVolkswagenautomotive-industryclean-technologyWhy Is The Tesla Semi Still In Pilot Program Stage? - CleanTechnica
The Tesla Semi, an electric semi truck first revealed nearly a decade ago, remains in the pilot program stage rather than advancing to large-scale production and widespread deployment. Despite initial expectations for a swift market launch, Tesla has continued to test the vehicle through pilot programs, with companies like Mone Transport currently engaged in such trials. While the pilot results appear positive, the prolonged testing phase has raised questions about why Tesla has not yet moved to fulfill large orders and scale production. The article highlights the surprising length of time—almost ten years—that the Tesla Semi has spent in pilot programs, suggesting that the slow progress contrasts with the rapid development often associated with Tesla’s other products. The author expresses a sense of impatience and curiosity about when the Semi will transition from pilot testing to broader commercial availability. Overall, the piece underscores the gap between initial expectations for the Tesla Semi and the reality of its extended development timeline.
energyelectric-vehiclesTesla-Semipilot-programrenewable-energytransportationclean-technologyThe Offshore Floating Wind Industry Floats Away From The US
The article discusses the contrasting development of offshore wind energy along the US Atlantic and Pacific coasts, highlighting the challenges and technological innovations in floating offshore wind. While Atlantic coast states such as Rhode Island, Massachusetts, New York, and Virginia have advanced with traditional fixed-bottom offshore wind turbines due to their shallow waters, Pacific coast states like California, Oregon, and Washington face difficulties because their deeper waters make monopile foundations impractical. The solution for the Pacific involves newer floating wind turbine technology, which anchors turbines on floating platforms tethered to the seabed, but this technology is still emerging and presents engineering challenges. The article also addresses political and economic factors affecting the US offshore wind industry. It notes that former President Donald Trump’s administration hindered progress, particularly for floating wind projects on the Pacific coast, causing US innovators to relocate their technology abroad. A key example is the Spanish startup X1 Wind, co-founded by MIT alumnus Carlos Casanovas, which developed a cost-effective floating platform called PivotBuoy
energyoffshore-windfloating-wind-turbinesrenewable-energyclean-technologywind-powersustainable-energyPlugin Vehicles Achieve 19% Penetration in Australian Auto Market in February - CleanTechnica
In February 2026, plugin electric vehicles (EVs) achieved a significant milestone in the Australian auto market, reaching a 19% penetration rate. This comprised 11,100 battery electric vehicles (BEVs) and 5,854 plugin hybrid EVs (PHEVs), totaling nearly 17,000 new EV owners—almost double the number from February 2025. Out of over 91,000 light vehicles sold that month, the growth in plugin vehicle sales came primarily at the expense of petrol-only internal combustion engine vehicles, while diesel vehicle shares remained steady. The Australian EV market continues to evolve with new model introductions, such as the upcoming Tesla Model Y Long Range and NIO’s budget-friendly Firefly sub-brand, alongside MG’s stripped-down urban MG 4. The top-selling EV models in Australia for February 2026 highlight BYD’s strong market presence, with six of the top 20 models from the Chinese automaker, including the BYD Sealion
energyelectric-vehiclesEV-salesautomotive-marketclean-technologybattery-electric-vehiclesplugin-hybridsAnother Electric Vehicle Benefit: No Catalytic Converters To Be Stolen - CleanTechnica
The article highlights a lesser-known benefit of fully electric vehicles (EVs): they do not have catalytic converters, which are common targets for theft in gasoline-powered cars. Catalytic converter theft has become a significant problem in the U.S., with estimates suggesting between 600,000 to 700,000 thefts annually. The average replacement cost ranges from $2,000 to over $2,500, leading to an estimated public repair cost exceeding $1.5 billion per year. This theft rate affects roughly 2% to 2.5% of the active vehicle population in the country. Many thefts go unreported due to lack of insurance coverage, making accurate data collection difficult. In contrast, fully electric vehicles lack catalytic converters and many other components prone to theft, such as mufflers and spark plugs, offering owners protection from this costly issue. Hybrids and extended-range electric vehicles (EREVs) still contain catalytic converters and remain vulnerable to theft. The article underscores that beyond environmental
energyelectric-vehiclescatalytic-convertersvehicle-thefthybrid-vehiclesemissions-reductionclean-technologyTop Selling Electric Cars in World, Cybertruck Order Frenzy, Solar Trumps Trump in Texas — Top Stories of the Week - CleanTechnica
The article from CleanTechnica provides a weekly roundup of the top stories related to electric vehicles, renewable energy, and clean technology trends. Although the specific details of the top-selling electric cars, the Cybertruck order surge, and the solar energy developments in Texas are not fully elaborated in the provided content, the piece emphasizes the ongoing public interest and dynamic discussions around these topics. The author, Zachary Shahan, highlights the importance of these stories in the broader context of the global transition to clean technologies aimed at combating climate change. Additionally, the article mentions the author's intent to resume regular weekly summaries of popular clean tech news, inviting reader feedback on the preferred format and length of these roundups. Zachary Shahan, a recognized expert in electric vehicles and renewable energy, also encourages readers to support CleanTechnica’s work through subscriptions and engagement, underscoring the platform’s role in informing and advancing the clean energy movement worldwide.
electric-vehiclessolar-energyrenewable-energyenergy-storageclean-technologyelectric-carssustainable-transportationTesla Sales in Germany Actually Still Down Enormously - CleanTechnica
The article from CleanTechnica examines recent Tesla sales figures in Germany, highlighting that despite some reports of rising sales, Tesla’s overall performance in the German electric vehicle (EV) market remains significantly down compared to two years ago. While Tesla sold 2,276 vehicles in February 2026, up from 1,429 in February 2025, this is still a 62% decrease from the 6,038 units sold in February 2024. The article notes that the German battery electric vehicle (BEV) market grew by 29% year-over-year in February, making Tesla’s decline more pronounced given the market’s expansion. The temporary pause in Model Y production in early 2025, due to a production line update, partly explains the low sales in February 2025, but the broader trend remains a steep decline. When combining January and February sales data, Tesla’s sales dropped from 9,190 units in 2024 to 3,577 units in
energyelectric-vehiclesTeslaautomotive-industryclean-technologyrenewable-energybattery-technologyIAA Will Ensure Most EVs Sold in Europe Will Have Batteries Made in the EU, but Loopholes Threaten Its Impact - CleanTechnica
The proposed EU Industrial Accelerator Act (IAA) aims to ensure that by 2027, nearly two-thirds of electric vehicles (EVs) sold in Europe will have batteries produced within the EU. The legislation sets local content rules requiring EV batteries to include key components such as cells, cathode active materials (CAM), and battery management systems (BMS) made in Europe, with increasing requirements by 2030. Additionally, EVs will need to incorporate green steel and have 70% of their non-battery components produced domestically. This move is intended to bolster Europe’s battery industry, enhance supply chain resilience, and reduce dependency on foreign suppliers. While Transport & Environment (T&E) welcomed the IAA as a positive step toward supporting local battery manufacturing and securing clean technology supply chains, it also highlighted significant loopholes that could undermine the law’s effectiveness. Notably, the inclusion of EVs from free trade agreement (FTA) countries for purchase subsidies and the extension of local content requirements to
energyelectric-vehiclesbatterieslithium-ionEuropean-Unionbattery-manufacturingclean-technologyCan Shipping's Greenhouse Gas Emissions Be Captured At The Funnel? - CleanTechnica
The article from CleanTechnica examines the potential of Onboard Carbon Capture and Storage (OCCS) as a solution to reduce greenhouse gas emissions from fossil-fueled ships amid the shipping industry's slow transition to green fuels. While OCCS is technically feasible, its practical deployment faces significant challenges related to the additional energy consumption, space, weight, and operational reliability required onboard vessels during normal voyages and maintenance. The technology's scalability also depends heavily on downstream infrastructure, including the ability to measure, offload, store, and transfer captured CO2 to verified permanent storage sites—facilities that are currently scarce. Furthermore, the article highlights substantial data gaps regarding OCCS’s real-world technical performance, costs, and operational constraints, which raise doubts about optimistic claims of its effectiveness as a transitional decarbonization technology. The report commissioned by Transport & Environment (T&E) and conducted by Pre-Scouter underscores that without robust measurement, reporting, and verification (MRV) frameworks and adequate storage infrastructure,
energycarbon-capturemaritime-decarbonizationonboard-carbon-captureshipping-emissionsclean-technologysustainable-shippingA Pseudo Book Review: Solvable: How We Healed The Earth, And How We Can Do It Again - CleanTechnica
The article presents a reflective and personal account of meeting Susan Solomon, a pioneering atmospheric scientist renowned for her critical role in linking chlorofluorocarbons (CFCs) to ozone layer depletion. Solomon’s research was instrumental in the creation of the 1987 Montreal Protocol, which is celebrated as one of the most successful environmental treaties, leading to the ongoing recovery of the ozone layer. The author highlights Solomon’s unique ability to translate complex scientific data into accessible, actionable knowledge that bridged the gap between science, public awareness, and international policy. Her visit to Hanoi, where she received a Special Prize for Female Innovators, symbolized the potential for global scientific collaboration to address pressing environmental challenges. Central to Solomon’s message, as elaborated in her book "Solvable: How We Healed The Earth, And How We Can Do It Again," is a framework based on the "three Ps": environmental threats must be personal, perceptible, and practical to spur effective action. The
energyrenewable-energyclimate-changeenvironmental-scienceozone-layersustainabilityclean-technologyNew Electric Boat To Banish Emissions From Offshore Wind Farms
The article discusses a significant development in the offshore wind industry aimed at eliminating emissions from the vessels that support offshore wind farms. While the electricity generated by offshore turbines is clean, the workboats used for construction and maintenance typically run on marine gasoil, a fossil fuel. Liverpool-based Bibby Marine is addressing this issue by introducing hybrid-electric Commissioning Service Operational Vessels (eCSOVs) designed to reduce operational costs and carbon emissions. These vessels use dual fuel generator sets to charge onboard batteries, enabling electric propulsion that can cut operational costs by up to 40% and save as much as $1 million annually. When offshore charging stations are available, these vessels can operate fully on electric power, potentially reducing costs by 70% and saving $1.8 million per year. Bibby Marine highlights that as electrification technology matures, capital costs for these vessels are becoming competitive, and shore power infrastructure is expanding. Offshore charging systems can be integrated into upcoming wind farm projects, offering operators a
energyoffshore-windelectric-boatsmarine-electrificationrenewable-energyhybrid-electric-vesselsclean-technologyOver 3,000 One-Megawatt EV Charging Stations Planned By BYD For Europe - CleanTechnica
BYD plans to install over 3,000 ultrafast electric vehicle (EV) charging stations across Europe by the end of the year, each capable of delivering one megawatt (1,000 kW) of power. These chargers far exceed the typical ultrafast chargers currently available, which usually range between 180 kW and 350 kW. Theoretically, this could allow compatible EVs—primarily BYD, Zeekr, and Xpeng models, all Chinese brands—to gain over 200 miles of range in about five minutes. BYD’s strategy appears to be focused on outpacing competitors by offering extreme charging speeds combined with low-cost EV production to dominate the market. However, the article questions the practical necessity of such high charging speeds for most drivers, noting that even 250 kW chargers can feel too fast for some users who prefer longer breaks during charging stops. The move by BYD may be more about business strategy and market positioning than immediate
energyelectric-vehiclesEV-charging-stationsultrafast-chargersBYDrenewable-energyclean-technologyBLUETTI Elite 400 — Goldilocks of Portable Power Stations? - CleanTechnica
The BLUETTI Elite 400 portable power station is reviewed as a well-balanced, "Goldilocks" option—not too big or small—offering substantial energy storage and power capacity suitable for a variety of needs. Key specifications include a 3,840 Wh energy storage capacity, 2,600 W continuous power, 3,900 W surge power, and rapid charging from 0–80% in 70 minutes at 2,800 W. It features multiple output ports (4 AC outlets, USB-A, USB-C, and a cigarette lighter port) and weighs 86 pounds, making it the lightest 3.8 kWh power station available. Its design includes a suitcase-style handle and wheels for portability, and its discreet, speaker-like appearance allows it to blend into home environments comfortably. In practical use, the reviewer found the Elite 400 effective for powering multiple devices simultaneously, such as laptops, phones, and an Apple Watch, without issues. Battery drain was
energyportable-power-stationbattery-storagerenewable-energyclean-technologypower-capacityenergy-efficiencyPockets of the Future: How Clean Tech Is Already Outrunning Fossil Fuels - CleanTechnica
The article "Pockets of the Future: How Clean Tech Is Already Outrunning Fossil Fuels" by Michael Barnard discusses the global acceleration of clean technologies and decarbonized solutions, focusing on how proven innovations can be scaled and diffused to new regions without reinventing them. Barnard emphasizes the concept that "the future is already here, it’s just unevenly distributed," highlighting his approach of identifying successful clean tech "pockets of the future" worldwide and applying those solutions where conditions allow. This method helps overcome local resistance such as the "not-invented-here" syndrome and NIMBYism, facilitating faster adoption of clean technologies. A key example Barnard presents is the use of mass timber construction in Canada, particularly a new 12-story, 500-bed student residence at BCIT. Mass timber, a highly engineered wood product, offers significant advantages over traditional concrete, including greater strength-to-weight ratio, factory precision, and the ability to add floors on existing buildings
energyclean-technologydecarbonizationmass-timbersustainable-materialsconstruction-innovationgreen-buildingDid Tesla Just Pull in a Year's Worth of Orders for the Cybertruck? - CleanTechnica
The article from CleanTechnica discusses a recent surge in Tesla Cybertruck orders following a temporary price reduction on the base all-wheel-drive (AWD) model. Originally unveiled seven years ago with a starting price of $49,990, the Cybertruck's base price was briefly lowered to about $59,990 before rising again. This short-term discount appears to have triggered a significant influx of orders, pushing the estimated delivery date from June 2016 to April 2017, effectively filling roughly a year’s worth of production capacity. Despite this surge, the actual volume of orders is relatively modest in the context of Tesla’s broader goals. Assuming Tesla produces about 2,000 Cybertrucks per month—based on last year’s sales of approximately 20,000 units—the backlog likely represents around 20,000 to 30,000 vehicles. This figure falls far short of Elon Musk’s ambitious annual sales target of 150,000 to 250,000 units. Moreover, with the
energyelectric-vehiclesTeslaCybertruckclean-technologysustainable-transportationautomotive-energy-storage100% Electric Vehicles = 20% Of New Car Sales In Europe In January - CleanTechnica
In January 2026, electric vehicles (EVs) continued to gain significant traction in Europe, with battery electric vehicles (BEVs) accounting for 20% of new car sales—a notable increase from 17% in 2025 and 12% in January 2024. The overall passenger plugin vehicle market grew 22% year-over-year (YoY) to 298,000 registrations, driven by a 16% YoY rise in BEVs to 195,000 units and a 33% YoY surge in plugin hybrids (PHEVs) to 102,000 units, marking the highest January growth for PHEVs since 2021. Meanwhile, traditional petrol and diesel vehicles saw steep declines of 26% and 22% respectively, while plugless hybrids increased their market share from 35% to 39%. Overall, 69% of new passenger vehicles sold were electrified in some form, up from 59% a year earlier, suggesting
energyelectric-vehiclesBEVplug-in-hybridsautomotive-marketclean-technologyEuropeWorld Models, Free Energy, and a Plastic Dinosaur - CleanTechnica
The article revisits a 2020 project involving a meter-high robotic Plastic Dinosaur wrapped in smart fabric, originally used as a narrative device to explore machine learning and neural networks. While the dinosaur was not truly conscious then, the author returns to the topic in 2026 to delve deeper into cognition and consciousness, inspired partly by recent statements from AI leader Dario Amodei. Amodei suggested that artificial general intelligence (AGI) might already exist in limited or intermittent forms, based on large models demonstrating broad reasoning across domains, though he did not claim these systems possess consciousness or subjective experience. The article also touches on ethical concerns, noting Amodei’s refusal to allow AI models for domestic surveillance or autonomous weapons without human oversight, while permitting foreign surveillance and human-in-the-loop weapons use. The discussion extends to the current hype around bipedal robots, such as Elon Musk’s Optimus and various advanced robots from China, highlighting a fundamental challenge: unlike vision and sound, tactile sensing and
robotartificial-intelligencemachine-learningbipedal-robotsroboticsembodied-intelligenceclean-technology4 Takeaways From The Nation’s Biggest Heat Pump Expo - CleanTechnica
The article summarizes key insights from the nation’s largest heat pump expo held in Las Vegas, focusing on innovations in heat pump water heaters (HPWHs) for residential and commercial use. A wide range of residential HPWHs were showcased by numerous manufacturers including GE, Bradford White, LG, Navien, Rheem, and others, with many companies emphasizing their strong commitment to the technology. While few entirely new models debuted, several brands introduced significant updates or recently entered the market, such as Navien’s dual fuel heat pump with gas backup and Noritz’s new tankless HPWH. Commercial heat pump water heaters also featured prominently, with many boiler manufacturers unveiling various central HPWH configurations, refrigerants, and sizes tailored to different building needs. Notable innovations included cascading central HPWH systems and smaller capacity units slated for release. Additionally, air-to-water heat pumps, which can provide both space heating and hot water, were highlighted as a growing trend, with companies like Mitsubishi, Daikin, Samsung
energyheat-pumpswater-heatersHVACrenewable-energyenergy-efficiencyclean-technologyWhy Is Hong Kong Ending EV Tax Breaks? Does It Make Sense? - CleanTechnica
Hong Kong is ending its substantial electric vehicle (EV) tax breaks by March 31, 2026, a policy shift justified by the government’s view that the local EV market has matured sufficiently. The current incentives offer up to HK$172,500 (about US$22,047) for EV purchases with trade-ins, but with EVs now accounting for 70% of new vehicle sales and 16% of all registered vehicles, Financial Secretary Paul Chan Mo-po argues that the market no longer requires such subsidies. This decision has sparked a surge in EV purchases as buyers rush to take advantage of the expiring tax breaks, with some dealers reporting a 17-fold increase in sales. Despite Hong Kong’s leadership in EV adoption—boasting one of the highest EV market shares globally, second only to Norway—critics worry that ending the tax breaks could slow the transition away from fossil-fueled vehicles. Some, including taxi drivers, have expressed dissatisfaction, fearing reduced incentives to switch to
energyelectric-vehiclesEV-tax-breaksclean-technologyHong-Kongfossil-fuel-phaseoutsustainable-transportationFrom Mine to Recovery: The Case for Nickel Recycling in Europe - CleanTechnica
The article from CleanTechnica highlights the critical importance of scaling nickel recycling in Europe to support a resilient and low-carbon supply chain for clean technologies, particularly electric vehicle batteries. A recent study shows that recycling nickel from batteries generally results in a significantly lower carbon footprint compared to mining and refining primary nickel. For example, using recycled nickel in a typical VW ID4 battery can reduce CO2 emissions by approximately 1200 kg compared to conventional nickel sources. Hydrometallurgical recycling processes in Europe can cut carbon intensity by up to 70% relative to primary production, with emissions further reduced by Europe's cleaner electricity grid compared to countries like China. Despite this potential, Europe's current battery recycling capacity is far below what is needed to meet demand by 2030, and nearly half of planned recycling projects are at risk. To address this gap and foster a truly circular economy, Transport & Environment (T&E) recommends mainstreaming recycling in policy and funding, banning or restricting the export of waste materials outside the EU
energymaterialsbattery-recyclingnickel-recyclingclean-technologycarbon-footprintEuropeBiden's Green New Deal Supercharged Manufacturing Construction in USA, Trump Killing It - CleanTechnica
The article highlights the significant positive impact of the Green New Deal, specifically the Inflation Reduction Act of 2022, on U.S. manufacturing construction and blue-collar jobs. It credits this legislation with sparking the largest reshoring effort in U.S. history, leading to a near tripling of manufacturing construction from 2021 to 2024. Key sectors benefiting included electric vehicle (EV) battery factories, solar manufacturing, battery mineral mining and refining, and other clean technology industries. The Bipartisan Infrastructure Law, although not truly bipartisan in Congress, also played a role in stimulating growth in core 21st-century energy and tech manufacturing. However, the article argues that this progress is now being reversed under the Trump administration, which it describes as actively undermining cleantech projects by halting funding, raiding factories, and detaining workers. This shift has already led to a decline in manufacturing construction spending, signaling an end to the boom initiated under Biden’s policies. The author expresses frustration
energyclean-technologymanufacturingEV-batteriessolar-energyInflation-Reduction-ActGreen-New-DealAI Search is Rewriting the Cleantech Buyer’s Journey — and Many Brands Aren’t Ready - CleanTechnica
The article from CleanTechnica highlights a significant shift in the cleantech buyer’s journey driven by the rapid adoption of AI-powered search tools like ChatGPT, Gemini, and Claude. Traditionally, cleantech marketing focused on Google rankings, website traffic, and event presence, but now up to 95% of B2B buyer interactions occur within AI tools before any direct website visit. This shift means that cleantech companies must adapt their marketing strategies to ensure accurate and favorable representation within AI models, which rely on both pre-trained memory and live web searches to provide information. A study conducted with SEO agency Rampiq analyzed AI visibility across 100 leading cleantech firms, revealing critical gaps and opportunities. The research found that AI’s pre-trained memory often provides vague or inaccurate company descriptions, while live search yields more precise and current information. However, many cleantech companies lack sufficient third-party citations, especially from high-authority media, which AI heavily favors over company-owned content. Additionally,
energycleantechAI-searchlarge-language-modelsB2B-marketingclean-technologyAI-visibilityHegseth’s Blacklists Target Academia & Cleantech, Not National Security Threats - CleanTechnica
The article discusses controversial blacklists reportedly issued by the US Military, which target elite academic institutions and Chinese clean technology companies rather than genuine national security threats. These blacklists, which were posted, retracted, and leaked multiple times, appear to be less about protecting national security and more about undermining top US universities and the emerging private sector in China. The universities targeted include many Ivy League and top engineering schools, which are critical for educating future military and economic leaders. Revoking tuition assistance for service members attending these schools could exacerbate existing education and engineering talent gaps, posing a risk to US economic and military competitiveness. On the corporate side, the expanded list of "Chinese Military Companies" includes major private-sector clean technology firms like BYD, NIO, and leading battery producers such as CATL and CALB, none of which are state-run or primarily military-focused. Notably absent from the list are large state-owned automakers and companies with clearer military ties, suggesting the blacklist targets China’s private
energycleantechclean-technologyUS-militaryacademiaengineering-schoolsnational-securityFrom Courtroom to Capital Markets: Why US Tariff Instability Matters - CleanTechnica
The article discusses the implications of the U.S. Supreme Court’s recent decision limiting presidential authority to impose broad tariffs under a specific emergency statute. While this ruling might seem to reduce tariff-related uncertainty, it has instead introduced new layers of risk and volatility in capital markets. The administration’s immediate response to continue tariffs under alternative legal authorities, combined with a refusal to refund previously collected tariffs, creates substitution and retroactivity risks. These risks complicate market pricing, affecting procurement contracts, lender conditions, and investor expectations, particularly in capital-intensive sectors like clean technology. Clean energy infrastructure—comprising steel, copper, lithium, transformers, and other long-lead components—is highly sensitive to tariff volatility because of its reliance on large upfront investments and long asset lifetimes. Increased uncertainty in trade policy raises the weighted average cost of capital (WACC), which in turn increases the levelized cost of energy (LCOE). Even small increases in WACC can make marginal clean energy projects economically unviable, slowing deployment
energyclean-energytariffscapital-marketssupply-chainclean-technologyinfrastructureLocked Out of Green Finance: What’s Holding Truckmakers Back? - CleanTechnica
The article "Locked Out of Green Finance: What’s Holding Truckmakers Back?" from CleanTechnica examines why European truck manufacturers, despite pledging a zero-emission future, have yet to secure significant green finance to support their transition to electric vehicles (EVs). While Chinese competitors rapidly scale up electric truck production, European makers lag behind, partly because they rely heavily on conventional financing methods like bank loans and standard bonds that lack climate-related conditions. Green bonds, which could theoretically support sustainable investments, remain unattractive due to strict earmarking, additional reporting requirements, and no guaranteed financial benefits such as a "greenium"—a consistent lower borrowing cost for green debt. Regulatory uncertainty around EU truck CO₂ standards and alignment with EU Taxonomy criteria further dampens investor confidence, limiting demand for green financial instruments in the sector. The article recommends several measures to overcome these barriers. Truck manufacturers should initiate pilot green finance projects to increase EV-related capital expenditure and improve transparency, especially regarding Scope 3 emissions and
energyelectric-vehiclesgreen-financebattery-electric-truckssustainable-transportationEU-regulationsclean-technologyThe Supreme Court Strikes Down Trump’s Tariffs - CleanTechnica
The U.S. Supreme Court has ruled that former President Trump’s imposition of tariffs under the International Emergency Economic Powers Act (IEEPA) was unlawful, significantly limiting presidential authority to unilaterally impose tariffs without congressional approval. This decision potentially opens the door for thousands of lawsuits seeking refunds and compensation for the estimated $175 billion in tariffs imposed during Trump’s administration. The ruling emphasizes that the power to tax and impose tariffs constitutionally rests with Congress, not the president, reinforcing the separation of powers and providing greater predictability for American businesses and consumers. The ruling was widely praised by industry leaders such as the Consumer Technology Association (CTA), which highlighted the importance of this decision for innovation and economic stability. However, the ruling does not completely end the possibility of tariffs, as the Trump administration has indicated intentions to explore other emergency authorities, though these have limitations and require congressional approval. The conservative Cato Institute welcomed the decision as a victory for constitutional governance but cautioned that the president still retains other statutory
energyclean-technologytariffstrade-policySupreme-Courteconomic-impactinnovation$100 Million In Funding Announced For New Public EV Chargers In Pennsylvania - CleanTechnica
Pennsylvania has announced $100 million in new funding to expand public electric vehicle (EV) charging infrastructure, aiming to reduce "range anxiety" and support EV drivers across the state. While previous efforts focused primarily on urban areas with higher EV ownership, this initiative emphasizes installing chargers in smaller communities and rural regions to better serve local residents and travelers passing through. The initial phase will allocate approximately $34 million to the southeastern region, including Bucks, Chester, Delaware, Montgomery, and Philadelphia counties, with local transportation agencies determining specific project locations. PennDOT Secretary Mike Carroll highlighted the program as a significant step toward making EV charging accessible statewide, reflecting the Shapiro Administration’s commitment to clean transportation infrastructure. Despite some federal political opposition to EV incentives and renewable energy, thousands of public EV chargers have been or are planned to be installed nationwide. Although federal EV purchase incentives are currently unavailable, some states continue to offer them, and future federal support for EVs and clean energy may increase depending on political changes.
energyelectric-vehiclesEV-charging-infrastructurepublic-charging-stationsrenewable-energyclean-technologyPennsylvania-energy-fundingPlant-derived nanotech separates heavy rare earths more cleanly
Researchers at Penn State have developed a novel plant-based nanomaterial derived from modified cellulose that can selectively recover dysprosium, a critical heavy rare earth element used in semiconductors, electric motors, and nuclear control rods. This material, called anionic hairy cellulose nanocrystals, features nanoscale crystalline structures with chain-like groups that interact uniquely with dysprosium ions, enabling its separation from chemically similar lighter rare earths like neodymium. The process is straightforward, involving simply adding the nanocellulose to a water-based mixture, and offers a cleaner, potentially more scalable alternative to conventional rare earth separation methods, which typically rely on energy-intensive and chemically harsh industrial processes. The significance of this development lies in addressing the growing demand for dysprosium, projected to increase by over 2,500% in the next 25 years due to its critical role in advanced technologies and renewable energy systems. Unlike previous approaches, the selectivity arises not just from chemical groups but also from their structural
materialsnanotechnologyrare-earth-elementscellulose-nanocrystalssustainable-materialsheavy-rare-earth-separationclean-technologyTo Chinese Clean Tech Companies: 恭喜發財 - CleanTechnica
The article from CleanTechnica marks the celebration of Chinese New Year (Lunar New Year) on February 17, highlighting its extended festivities, including public school closures and multiple events in New York City. It emphasizes the traditional greeting 恭喜發財 (Gong Xi Fa Cai), which wishes prosperity and happiness, reflecting a broader sentiment of inclusive goodwill. The article connects this cultural celebration to the clean technology sector, noting that the financial savings and improved user experience from electric vehicles (EVs) and clean tech contribute to greater prosperity and happiness for consumers. Additionally, the article references the Year of the Fire Horse, symbolizing energy, boldness, and accelerated progress, framing it as a time for breakthroughs and transformative change. This symbolism is used to inspire optimism for the clean technology industry, hoping for a year marked by bold advancements and increased adoption of sustainable solutions. The author also extends wishes for safe and cleaner travel during the holiday, aligning the themes of the celebration with the goals of environmental progress
energyclean-technologyEVsrenewable-energysustainabilityclean-tech-adoptionenergy-transformationTOPCon Solar Cells Are Busting A Key Anti-Solar Myth
The article addresses and counters a common anti-solar argument that solar energy production is not truly clean due to the carbon emissions involved in manufacturing solar panels. It highlights how the global solar industry is advancing with the adoption of tunnel oxide passivated contact (TOPCon) solar cells, a technology that improves efficiency in converting sunlight to electricity while also reducing the carbon footprint of solar cell manufacturing. This advancement directly challenges claims from groups like Citizens for Responsible Solar (CRS), which argue that solar energy is not free from CO2 emissions, by providing context that lifecycle emissions from solar projects remain significantly lower than those from fossil fuel plants. TOPCon technology, introduced by Germany’s Fraunhofer Institute in 2013, has been slower to penetrate the market compared to PERC cells but is now gaining rapid adoption. Research from the University of Warwick demonstrates that TOPCon cells have lower environmental impacts in 15 out of 16 categories compared to PERC technology, including a 6.5% reduction in climate
energysolar-energyTOPCon-solar-cellsrenewable-energycarbon-emissionsclean-technologysolar-power-innovationTesla Sales Down Tremendously in UK, Norway, Netherlands, Germany, Spain, Sweden, Denmark, Portugal, Switzerland - CleanTechnica
The article from CleanTechnica reports a significant decline in Tesla sales across multiple European countries between January 2024 and January 2026. Overall, Tesla’s sales dropped by 23% across 12 key markets, with some countries experiencing particularly steep decreases. For example, the UK saw a 55% decline, Germany a 59% drop compared to 2024 (and 69% compared to 2023), the Netherlands an 81% fall, and Norway the most dramatic decrease at 93%. Other countries like Denmark, Sweden, Portugal, Spain, and Switzerland also experienced notable sales reductions, though some showed mixed trends when comparing 2026 sales to 2023. Despite the widespread downturn, Italy was a notable exception, with Tesla sales rising by 82% from 2024 to 2026. Sweden and Portugal also showed some recovery when comparing 2026 figures to 2023, despite drops relative to 2024. The article hints at possible political factors
energyTeslaelectric-vehiclesautomotive-salesrenewable-energyclean-technologymarket-trendsCan the Rivian R2 Succeed & Propel Rivian to Prosperity? - CleanTechnica
The article from CleanTechnica discusses the potential impact of the upcoming Rivian R2 electric vehicle amid a challenging US EV market environment marked by declining sales, policy setbacks, and tariffs. Despite these headwinds, the Rivian R2 generates excitement as a mass-market, midsized electric SUV priced around $45,000, representing a significant opportunity for Rivian to expand its customer base. The company is seen as a fresh cleantech-focused alternative to legacy automakers pulling back on EV ambitions and to Tesla, whose leadership controversies have alienated some EV enthusiasts. However, the article expresses cautious skepticism about whether the R2 can truly stand out in a crowded segment filled with competitive models like the Ford Mustang Mach-E, Chevy Equinox EV, Audi Q4 e-tron, and others. Rivian’s future profitability and survival heavily depend on the R2’s success, but the author questions if it can achieve the high sales volumes needed to thrive given the intense competition and unfavorable policy climate. The
energyelectric-vehiclesRivianEV-marketclean-technologysustainable-transportationautomotive-industryCould BYD’s Manchester City Partnership Indicate A Scandinavian Sales Offensive? - CleanTechnica
The article discusses BYD’s recent partnership with Manchester City, highlighting the involvement of star player Erling Haaland, a prominent Norwegian forward known for his exceptional scoring ability and popularity in Scandinavia. Haaland’s stature and playing style challenge traditional soccer norms, making the sport more exciting and potentially increasing BYD’s brand visibility in the region through this high-profile association. The partnership appears to be part of BYD’s broader marketing strategy, possibly signaling an upcoming sales push in Scandinavian markets. Although some BYD vehicles featured in promotional materials, including those seen with the players, have not yet been launched in Europe, the company’s new product lineup combined with significant marketing efforts could drive growth if leveraged effectively. The article implies that while product quality remains crucial, the Manchester City collaboration could enhance BYD’s market presence and sales prospects in Scandinavia.
energyelectric-vehiclesBYDclean-technologyautomotive-industrysustainable-transportationmarketing-strategyXiaomi Targeting 550,000 Sales This Year - CleanTechnica
Xiaomi, traditionally known for its smartphones, has rapidly emerged as a significant player in the electric vehicle (EV) market since launching its first model 22 months ago. The company has already sold around 600,000 EVs, with its YU7 model becoming the top-selling vehicle in China in January 2026, accounting for nearly all of the 39,002 vehicles sold that month. The YU7 has achieved remarkable success, selling 150,000 units within six months—more than double the sales of Xiaomi’s initial SU7 model. In 2025, Xiaomi exceeded its internal delivery target by selling over 410,000 EVs, with December marking a record month of over 50,000 deliveries. Looking ahead, Xiaomi plans to continue its growth trajectory by launching an updated version of the SU7, which offers an impressive range of up to 902 km (560 miles) and is expected to be priced between 229,900 yuan ($33,315)
energyelectric-vehiclesXiaomiEV-salesclean-technologybattery-rangenew-energy-vehiclesTesla Down Dramatically in UK, Norway, Netherlands, Switzerland - CleanTechnica
The article from CleanTechnica analyzes Tesla’s vehicle sales performance across various European markets in January 2026 compared to January 2025. Overall, Tesla experienced a significant decline in several key countries, including the UK (51% drop), the Netherlands (67% drop), Norway (88% drop), and Switzerland (72% drop). These declines also corresponded with notable reductions in Tesla’s EV market share in these regions. Germany saw a slight increase in sales (2%) and market share, while Denmark and Ireland showed little to no change in sales but a decrease in market share. Conversely, Tesla’s sales surged in southern and northern European countries such as Italy (77% increase), Spain (70% increase), Sweden (30% increase), and Finland (286% increase), with corresponding gains in market share in these markets. Despite some localized growth, Tesla’s aggregate sales across the 12 analyzed European countries fell from 6,925 vehicles (5.5% market share) in
energyelectric-vehiclesTeslaEV-marketrenewable-energyautomotive-industryclean-technologyQuilt's Paul Lambert on Making Heat Pumps Cool (and Smart) - CleanTechnica
The article highlights an interview with Paul Lambert, CEO of Quilt, featured on CleanTechnica’s CleanTech Talk podcast. Lambert discusses Quilt’s innovative approach to making heat pumps more appealing and efficient, aiming to significantly accelerate their adoption in U.S. single-family homes. Quilt’s heat pumps boast sleek designs, over 25 SEER2 efficiency, and smart software that improves system performance over time. Lambert emphasizes the environmental impact potential, noting that widespread heat pump adoption could be equivalent to removing 32 million cars from the road, but stresses the need to increase the current adoption rate tenfold by 2030. Additionally, the article covers Quilt’s rapid growth strategy, including a recent $20 million Series B funding round and the introduction of a new 3-zone heat pump system. The conversation between Lambert and CleanTechnica’s Scott Cooney delves into the intersection of technology innovation and clean energy solutions, underscoring Quilt’s mission to make heat pumps both “cool” and smart. The article
energyheat-pumpsenergy-efficiencysmart-technologyHVACrenewable-energyclean-technologyTesla Buyer Loyalty Drops a Ton, But Still 3rd in USA - CleanTechnica
Tesla’s brand loyalty in the United States has significantly declined in recent years, dropping from its previous dominant position to third place among automakers with a loyalty rate of 55.9%. This means that just over half of Tesla owners intend to purchase another Tesla for their next vehicle. Among those planning to buy another electric vehicle (EV), 78% remain loyal to Tesla, but notably, over 20% of these buyers are considering non-Tesla EVs. This decline challenges the perception that Tesla owners are unwaveringly committed to the brand regardless of competitors or company leadership. Several factors appear to contribute to this drop in loyalty, including backlash against Elon Musk’s political activities, such as his support for Donald Trump and controversial decisions affecting cleantech policies. These political stances have coincided with reductions in federal support for EV incentives and cleantech adoption, which have slowed the overall transition to electric vehicles in the U.S. The article also notes a temporary resurgence in gasoline vehicle preference following the
energyelectric-vehiclesTeslabrand-loyaltyclean-technologyEV-marketfederal-subsidiesAltitude Partners With Alcom For +360.000t Carbon Removals - CleanTechnica
Altitude has secured a major carbon removal procurement deal, acquiring over 360,000 tonnes of CO₂ Removal Certificates (CORCs) from Alcom’s biochar-based carbon removal projects located in the Philippines and India. This agreement represents one of the largest individual off-take contracts in the carbon removal sector to date. The credits will be issued through Puro.earth, a platform that provides independent verification, traceability, and ensures the long-term permanence of the carbon removals. Alcom is recognized as a leading developer in biochar projects, with a strong track record of delivering on its growth targets. This partnership with Altitude significantly advances the scaling of large-scale carbon dioxide removal (CDR) efforts. Overall, the deal highlights the growing market for verified carbon removal certificates and the increasing role of biochar technology in global carbon mitigation strategies.
energycarbon-removalbiocharcarbon-creditsclimate-changesustainabilityclean-technologyWhich of the 132 Chinese EV Automakers Will Enter Canada? - CleanTechnica
The article from CleanTechnica discusses the potential entry of Chinese electric vehicle (EV) manufacturers into the Canadian market as a strategic gateway to North America. Canada is seen as an attractive entry point due to its stringent safety and environmental standards, a consumer base receptive to EVs, and comparatively more regulatory flexibility than the United States. While an initial quota of 49,000 Chinese EV units is set for Canada, this represents only about 3.77% of the Canadian light vehicle market, which is dominated by domestic assembly from major automakers like Ford, GM, Honda, Stellantis, and Toyota. The article emphasizes that the question is less about whether Chinese EV brands can succeed in Canada—BYD, for example, already holds about 18% of the global EV market and sold over 4 million new energy vehicles in 2024—but rather which other Chinese manufacturers have the institutional capacity and readiness to follow BYD’s lead. The analysis, based on insider industry sources and vetted by experienced
energyelectric-vehiclesEV-marketChinese-automakersautomotive-industryclean-technologyNorth-America-marketWhich Automakers Are Electrifying Fastest In USA? - CleanTechnica
The article from CleanTechnica analyzes the pace at which various automakers in the United States are transitioning to electric vehicles (EVs) based on 2025 sales data. Among legacy automakers, Cadillac leads the electrification effort with over 28% of its sales being electric vehicles, followed by Audi (18.2%) and Porsche (18%). Premium brands such as BMW, Acura, and Volvo also show notable EV sales shares, while mass-market, lower-cost brands lag significantly behind. Japanese automakers, in particular, have been slow to embrace EV sales in the US market. Fiat is noted as an exception, having ceased sales of non-electric vehicles, though its overall sales volume remains very low. When grouped by auto alliances, Volkswagen Group tops the list with 12.7% of its sales being electric, largely due to the strong EV sales of its premium brands Audi and Porsche. BMW Group follows with 10.7%, while GM and Hyundai-Kia lead among mass-market groups
energyelectric-vehiclesautomakersEV-salesUSAclean-technologyautomotive-industryThe Hidden Cost of Europe’s Hydrogen Bus Experiment - CleanTechnica
The article examines the economic and operational realities of hydrogen buses in Europe, focusing on Poland, the continent’s largest bus manufacturing hub and home to Solaris, a leading zero-emission bus supplier. Poland’s large-scale deployment of hydrogen buses in real urban settings with professional operators provides a critical test case. The experience in Poznań, where hydrogen and battery electric buses operate side-by-side under identical conditions, reveals that hydrogen buses face higher fuel costs, supply quality issues, and operational interruptions, resulting in lower availability compared to battery electric buses. This comparison is based on internal data rather than advocacy, highlighting the practical challenges of hydrogen technology in public transit. A detailed cost-benefit analysis from the Upper Silesian Zagłębie Metropolis further underscores these findings. Over a 10-year horizon, hydrogen buses have significantly higher purchase and energy costs (€750,000 and €0.74/km respectively) compared to battery electric buses (€610,000 and €0.21/km) and diesel (€235,
energyhydrogen-fuel-cellselectric-buseszero-emission-transportationpublic-transitrenewable-energyclean-technologyXPENG Sales Drop 34% in January - CleanTechnica
XPENG experienced a significant slowdown in sales growth at the start of 2026 after a period of rapid expansion. While January 2025 sales surged by 268% compared to the previous year, reaching 30,350 units, January 2026 saw a 34% decline to 20,011 units. This drop may reflect broader market conditions or a temporary pause following the unsustainably rapid growth in 2025. The Chinese electric vehicle (EV) market’s complexity and competitiveness add uncertainty to interpreting these trends. Despite the slow start, XPENG aims to increase its vehicle sales by 28% to 40% in 2026, targeting 550,000 to 600,000 units compared to 429,445 in 2025, supported by planned new model launches and market expansions. The company is emphasizing the environmental benefits of its recent sales, noting that January 2026 deliveries are expected to reduce life-cycle greenhouse gas emissions by over 300,000 tons,
energyelectric-vehiclesXPENGgreenhouse-gas-emissionsclimate-benefitautomotive-industryclean-technologyTesla, SpaceX, & xAI Merging? - CleanTechnica
The article discusses the possibility of mergers among Elon Musk’s companies Tesla, SpaceX, and xAI, highlighting a pattern of inter-company support and financial entanglements. Historically, Tesla acquired SolarCity during its financial struggles, though Tesla’s solar business has since declined. Similarly, SpaceX purchased unsold Tesla Cybertrucks, and Tesla engineers assisted Twitter (now X) after Musk’s acquisition. xAI, Musk’s AI startup competing with OpenAI, has raised $20 billion, including investments from Tesla and SpaceX, despite Tesla shareholders opposing the investment. Recent reports suggest early-stage talks about merging two or more of these companies, with potential scenarios including SpaceX merging with xAI or Tesla, or other combinations. xAI has already absorbed X (Twitter) in a deal valuing X at $33 billion and xAI at $80 billion. SpaceX is valued at approximately $800 billion, potentially planning an IPO, while Tesla’s market cap stands at $1.31 trillion,
energyTeslaSpaceXxAIclean-technologyrenewable-energyelectric-vehiclesWall Street's Failures on Tesla (TSLA) — Did It Simply Flip Flop? - CleanTechnica
The article from CleanTechnica examines Wall Street’s shifting perceptions and valuation challenges regarding Tesla (TSLA). It highlights a critical analysis from a Fortune article by Shawn Tully, which points out that Tesla’s reported earnings have been significantly bolstered by non-recurring income sources, particularly regulatory credit sales and Bitcoin transactions, rather than core automotive operations. In 2025, Tesla earned approximately $1.51 billion from these non-operating items, nearly 40% of its net earnings of $3.79 billion. Excluding these, Tesla’s “core” earnings were about $2.28 billion, leading to an adjusted price-to-earnings (P/E) ratio of 632, an extraordinarily high valuation compared to other high-profile companies like Palantir, which has a P/E of 353. The article also reflects on Tesla’s historical journey in the eyes of Wall Street and the auto industry. Initially, Tesla was widely dismissed and underestimated, with skepticism about its ability to achieve
energyTeslaregulatory-creditsclean-technologyelectric-vehiclesemissions-standardsfinancial-analysisSolar-Powered Boat Travels Into France - CleanTechnica
The article from CleanTechnica highlights the journey of a DIY-built solar-powered boat named True North, which traveled hundreds of miles into France using only electricity generated from its rooftop solar panels. The boat is equipped with an Epropulsion 6 kW electric motor and batteries to store excess solar energy, allowing it to operate quietly and without fossil fuels. Despite its modest speed, the vessel includes practical features such as a sleeping area, food storage, and space for video equipment, enabling the builder to document the trip. The builder emphasizes that he is not a professional boat maker but someone skilled with tools and materials, challenging the notion that one must purchase expensive conventional boats. The article underscores the environmental and economic benefits of the solar-powered boat, including zero emissions, no fuel costs, and reduced noise pollution compared to traditional gas or diesel engines. While the boat occasionally charges from shore power outlets, which may not always be renewable, its overall climate impact is significantly lower. Viewer comments reflect admiration for the sense of
energysolar-powerelectric-boatrenewable-energyclean-technologyelectric-motorbattery-storage100 Gigawatts Of CdTe Thin Film Solar Possible By 2030
The article discusses a recent study outlining a pathway for the United States to produce 100 gigawatts (DC) of cadmium telluride (CdTe) thin film solar panels annually by 2030. CdTe thin film solar technology differs from traditional silicon solar cells by using a solution-based process to deposit thin layers of cadmium telluride on glass sheets, offering advantages such as lower cost, higher production volume, and a smaller energy footprint. While CdTe solar panels currently make up a significant portion of the US utility-scale solar market, they represent only about 3% of global solar capacity due to their relatively lower conversion efficiency compared to silicon cells. The US Department of Energy, in partnership with industry leaders like First Solar, has been working for decades to improve CdTe technology and supply chains, culminating in a detailed roadmap published in the journal Joule. Two main challenges must be addressed to achieve the 100 GW annual production target: securing a reliable domestic supply of tellurium
energysolar-energyCdTe-thin-filmrenewable-energyphotovoltaicsenergy-policyclean-technologyCould Trade Routes That Once Oppressed Now Liberate The Atlantic From Fossil Fuels? (Skipping the US?) - CleanTechnica
The article discusses a significant realignment in global trade routes, particularly focusing on the Atlantic region and the potential for these routes to facilitate a transition away from fossil fuels. It highlights how historic trade routes, once associated with oppression and exploitation, especially in Africa, could now serve as conduits for clean technology and economic development. African countries, often overlooked on the global stage, are poised for major transitions due to improving education, low labor costs, mineral wealth, and growing capabilities in processing and adding value to resources. The continent's proximity to Latin America and existing trade agreements further enhance its strategic importance in this emerging trade landscape. A key example is the expansion of Chinese clean technology manufacturers like BYD, which is establishing factories in Europe, Turkey, and Brazil to produce affordable electric vehicles (EVs). These vehicles, while manufactured for different markets, have the potential to supply Latin America and Africa, where demand for reliable, affordable transportation is growing. The article also suggests innovative approaches such as factory-certified pre-owned
energyclean-technologyrenewable-energyelectric-vehiclesbattery-rangeglobal-tradefossil-fuel-transitionHow the West Lost the Automotive Industry - CleanTechnica
The article "How the West Lost the Automotive Industry" by David Waterworth and Paul Wildman argues that Western countries—particularly Japan, Germany, France, and the USA—have already lost their dominance in the global automotive industry, especially in electric vehicles (EVs). The authors attribute this decline to a combination of hubris, lack of customer commitment, and a profit-first mentality that underestimated China’s industrial and technological rise. Western automakers initially profited from the Chinese market through joint ventures, which facilitated technology transfer to China. Over time, China leveraged this knowledge to develop sophisticated EVs and manufacturing capabilities, now challenging and surpassing Western automakers in innovation and production scale. The article highlights China’s rapid progress, exemplified by companies like BYD, which plans to sell nearly 2 million battery electric vehicles (BEVs) in 2025—far outpacing Toyota’s 0.1 million BEVs despite Toyota’s much longer history in car manufacturing. Western responses have included protection
energyelectric-vehiclesautomotive-industryChinaclean-technologyEV-marketinnovationGogoro’s Reset: From Electric Scooter Brand to Energy Infrastructure Company - CleanTechnica
Gogoro, once known as the “Tesla of scooters,” is undergoing a significant strategic reset after years of financial losses. Entering 2026, the company has shifted from aggressive growth to a focus on stabilizing market share through cost control, product simplification, and a narrower strategy. The launch of the Ezzy 500 electric scooter in late 2024 exemplifies this change, offering a more affordable, less differentiated product priced around US$1,330 after subsidies, aiming to defend margins rather than disrupt the market. Founded in 2011, Gogoro pioneered battery swapping in Taiwan with a subscription model, but despite rapid adoption, profitability has been elusive, culminating in a record net loss of US$122 million in 2024. Under CEO Henry Chiang, Gogoro has cut fixed costs, tightened capital spending, and scaled back international ambitions, resulting in improved operating cash flow and gross margins by late 2025, though the company remains unprofitable. Internationally, Gog
energyelectric-scootersbattery-swappingenergy-infrastructureclean-technologysustainable-transportationelectric-mobilityEnergy Efficiency Is Forever, But US Presidents Come And Go
The article discusses the U.S. Department of Energy’s (DOE) continued commitment to advancing energy efficiency and storage technologies despite shifts in federal energy policy. A recent initiative involves a $155 million investment in 16 projects across national laboratories aimed at improving the competitiveness and energy efficiency of energy-intensive industries such as iron and steel, cement, chemicals, forest products, and food and beverage. While the DOE’s announcement downplayed the decarbonization aspect, the funding is intended to drive technological innovation that reduces costs and energy consumption, ultimately benefiting American workers and consumers. A notable project within this initiative is the SCCALE (Solutions Center for Commercial Advancement of Large-Scale Electrochemistry) at Lawrence Livermore National Laboratory, which received $12.5 million. SCCALE focuses on lowering capital costs and safety risks by reducing reliance on extreme temperatures and pressures in electrochemical processes, thereby saving energy. Electrochemistry is highlighted as a key area with broad sustainability implications, including renewable energy, water purification,
energy-efficiencyrenewable-energyelectrochemistryindustrial-decarbonizationenergy-storageDepartment-of-Energyclean-technologyOver 860 Public EV Chargers Operating At Sheetz & WaWa - CleanTechnica
The article highlights the growing availability of public electric vehicle (EV) fast chargers at mainstream retail locations, focusing on Sheetz and Wawa convenience stores. Together, these two chains operate over 860 public EV chargers across numerous sites, providing drivers with convenient, secure, and 24/7 accessible charging options. These retail locations are particularly attractive for EV drivers because they offer amenities such as restrooms, food, and beverages, allowing drivers to comfortably wait while their vehicles charge. This trend aligns with similar initiatives by other major retailers like Walmart and Kroger, which are also expanding their EV charging infrastructure. The expansion of public fast charging at familiar retail sites addresses a key concern for EV drivers, especially those traveling long distances or in rural areas where fast chargers were previously scarce. The article includes an example of an EV driver using a Wawa charger during a road trip, illustrating the practical benefits of these installations. The piece also emphasizes the importance of public charging infrastructure to the broader success of electric vehicles, counter
energyelectric-vehiclesEV-chargingpublic-chargersfast-chargingrenewable-energyclean-technologyOpening Up EV Trade in Canada, Leaving USA Behind - CleanTechnica
The article discusses a significant development in the electric vehicle (EV) market: Canada’s decision to open up EV trade with China, marking a shift away from reliance on the United States. This move aligns with a broader global trend where countries increasingly look to China for technological leadership and open trade opportunities in the EV sector. The article highlights a conversation among CleanTechnica contributors Steve Hanley, Larry Evans, and Zachary Shahan, who explore the implications of this shift, including which companies might enter the Canadian market and how the U.S. fits into this evolving landscape. While the article itself is brief and primarily promotional for a related video discussion, the key takeaway is that Canada’s new trade openness with China could reshape the North American EV market by diversifying supply chains and potentially accelerating EV adoption. This development underscores China’s growing influence in global EV technology and trade, and it raises questions about the future role of the U.S. in this industry. The article invites readers to engage further by watching the
energyelectric-vehiclesEV-traderenewable-energyclean-technologyCanada-China-tradeenergy-storageMajor success from the Electric Home Show - 3 months before it even happens - CleanTechnica
CleanTechnica is organizing its first large-scale event, the Electric Home Show, scheduled for April in Honolulu. This three-day festival includes a professional day for contractors followed by two days of consumer-focused trade shows featuring talks and workshops centered on earth-friendly technologies. The event aims to address a key market challenge: contractors often push traditional fossil fuel systems like gas water heaters because they are more familiar with them, limiting the adoption of efficient electric technologies such as heat pump water heaters. By educating contractors through Pro Day sessions—including technical training, marketing support, and rebate information—the show seeks to empower them to confidently install and promote advanced, energy-saving products. The Electric Home Show has already achieved significant early success, exemplified by connecting a local AC installer with Quilt Technologies, a company offering energy-efficient cooling systems. This partnership could lead to widespread adoption of Quilt’s products in Hawaii, reducing residential and commercial energy demand, lowering electricity costs, and accelerating the state’s transition to 100% clean energy. The event has
energyheat-pumpenergy-efficiencyclean-technologyHVACrenewable-energysustainable-livingUS Startup Brings Diesel-Killing Energy Storage System To Earth
The article highlights a significant advancement in long-duration energy storage by the California startup Noon Energy, which has developed a compact system capable of discharging stored solar power for over 100 hours—far exceeding the typical 2-10 hour capacity of conventional lithium-ion batteries. Noon’s technology centers on a reversible solid oxide fuel cell that uses renewable electricity to split carbon dioxide into oxygen and solid carbon, with the solid carbon serving as the energy storage medium. When electricity is needed, the system recombines oxygen from the air with the stored carbon to generate power. This approach requires less than 1% of the critical materials used in lithium-ion batteries, potentially addressing resource constraints. Noon’s technology draws inspiration from NASA’s MOXIE experiment on Mars, which uses solid oxide electrolysis to produce oxygen from the Martian atmosphere by decomposing CO2 at high temperatures. The company has been developing its system since its founding in 2018, receiving early funding support from the US Department of Energy’s AR
energyenergy-storagesolid-oxide-fuel-cellrenewable-energyelectrolysisclean-technologycarbon-captureNew Coal-Killing Geothermal Energy Anomalies Found In US
The article highlights a significant shift in the US energy landscape, where geothermal energy is emerging as a formidable competitor to coal, natural gas, wind, and solar power. Historically limited to a few Western states, geothermal energy is now expanding due to advances in drilling technology and innovative approaches like those developed by the startup Zanskar. Zanskar employs custom-built artificial intelligence (AI) to identify previously unknown geothermal fields more efficiently and economically, reducing drilling costs and failure rates. This AI-driven method enables the company to tap into geothermal resources closer to the surface, making geothermal power more scalable and cost-effective. Zanskar recently secured $115 million in Series C funding led by Spring Lane Capital, with participation from previous investors such as Obvious Ventures and Lowercarbon Capital. This funding will support the company’s expansion across multiple Western US locations, aiming to deliver clean geothermal energy on a gigawatt scale before 2030—well ahead of typical timelines for coal, gas, or nuclear projects. The US
energygeothermal-energyrenewable-energyAI-in-energydrilling-technologyUS-Department-of-Energyclean-technologyA US Sustainable Aviation Fuel Startup Takes Aim At Fossil Fuels
The article highlights the advancements of Syzygy Plasmonics, a Houston-based US startup focused on sustainable aviation fuel (SAF) as a means to reduce reliance on fossil kerosene jet fuel. While electrification is considered the ideal solution for aircraft decarbonization, it currently applies mainly to small aircraft and short routes. For larger, long-haul aircraft, alternative liquid fuels like SAF remain critical. Syzygy’s approach involves a proprietary photoreactor technology called Rigel™, which uses renewable energy to produce light that drives chemical reactions in a biogas reactor. This method enables scalable production of hydrogen, syngas, and other fuels, including sustainable aviation fuels, by leveraging plasmonic metallic nanoparticles to catalyze reactions efficiently without combustion. The company’s technology builds on research from the 1970s and recent breakthroughs in plasmonic antenna systems, enabling practical commercial applications. Syzygy has attracted significant investment and support from both government agencies and major energy and industrial
energysustainable-aviation-fuele-fuelsrenewable-energyclean-technologybiofuelscarbon-captureOh, So That's Why EV Charging Stations Are Still Hot Property - CleanTechnica
The article from CleanTechnica explores the apparent paradox of why public EV charging stations continue to proliferate across the U.S. despite a recent slowdown in new electric vehicle (EV) sales. One key reason is the anticipated surge in used EVs entering the market as off-lease vehicles return, creating sustained demand for charging infrastructure. Retailers and businesses, such as Kroger in partnership with EVgo, are investing heavily in installing thousands of new charging stations at grocery and retail locations, betting on the long-term growth of EV usage and the evolving needs of drivers. Cox Automotive highlights that the industry is on the cusp of the largest wave of used EVs ever seen, with lease maturities for EVs expected to rise sharply from 5% in 2025 to potentially 23% by 2028. This influx of used EVs will change driving patterns and charging requirements, supporting continued expansion of charging networks. Retailers see EV charging availability as a competitive advantage to attract customers, regardless
energyelectric-vehiclesEV-charging-stationsrenewable-energysustainable-transportationEV-infrastructureclean-technologyUS Startup Launches Energy Efficient Desalination System In Nice - CleanTechnica
California-based startup OceanWell has developed an innovative, energy-efficient desalination system designed to reduce the heavy fossil fuel footprint typical of conventional desalination processes. Traditional seawater desalination requires extremely high pressures (800–1,000 psi), consuming significant energy—often 5 to 26 times the theoretical minimum—and accounting for 25% to 40% of water production costs. OceanWell’s solution uses modular underwater “pods” that leverage natural water pressure to reduce energy consumption by up to 40%, while also minimizing environmental harm by protecting marine life and eliminating toxic brine discharge. OceanWell’s technology targets both seawater desalination and freshwater purification, filtering out salts, bacteria, viruses, pesticides, and PFAS. The company secured a pilot project with the Las Virgenes Municipal Water District in California and has received support from a coalition of state water authorities and the US Navy. In November 2024, OceanWell closed an $11 million Series A funding round, including investment and technological collaboration
energydesalinationwater-purificationenergy-efficiencyclean-technologysustainable-water-treatmentOceanWellCanada’s New Trade Agreement Has Far Reaching EV Implications - CleanTechnica
The article discusses the significant implications of Canada’s new trade agreements on the electric vehicle (EV) market, particularly highlighting how these changes could disrupt the affordability and availability of EVs. The introduction of price stipulations in trade deals is expected to benefit mainstream Chinese EV manufacturers like BYD and Geely by giving them a competitive edge over premium automakers and Tesla’s Chinese imports. As consumers gain access to more affordable EV options from China, demand is likely to increase, encouraging Chinese manufacturers to expand their presence in North America. The article also notes that manufacturing localization tends to follow market establishment, and with automation reducing labor cost differences, Chinese EV production could become more entrenched in the region. Additionally, Canada is strengthening trade ties with Brazil and Mexico, which could further boost the availability of both battery electric vehicles (BEVs) and plug-in hybrid electric vehicles (PHEVs) across the Americas. Latin American factories are producing PHEVs superior to those currently available in North America, potentially increasing sales and
energyelectric-vehiclesEV-adoptionclean-technologytrade-agreementautomotive-industrymarket-disruptionHappy Hour Clean Technology Special: Pubinno Smart Tap at CES - CleanTechnica
The article highlights Pubinno’s Smart Tap, showcased at CES, as an innovative clean technology designed to reduce waste in draft beer dispensing. Traditional draft beer systems often result in significant beer loss due to cleaning, poor pressure control, and excess foam. Pubinno’s smart tap precisely controls the pour, increasing keg yield by about 21% and reportedly saving over 1.4 billion liters of water from more than 200 million draft beers served. Unlike some competitors, Pubinno’s system does not require special glassware, reducing additional costs and carbon footprint. It also operates autonomously, making it suitable for self-service or inexperienced bartenders, and can adjust foam levels based on beer type and local preferences. The technology works with both carbonated and nitrogenated beers, as well as sodas, and delivers a consistent pour that minimizes waste and enhances user experience. The article suggests that the greatest environmental and economic benefits may come from reducing waste in expensive imported beers, which have a high transportation
IoTsmart-tapbeverage-technologywater-conservationcarbon-footprint-reductionclean-technologyCES-innovationsBYD Atto 1 Test Drive - CleanTechnica
The article provides a firsthand test drive review of the BYD Atto 1 electric vehicle, recently launched in Australia with deliveries beginning in Melbourne and Brisbane. The Atto 1, also known as the Seagull or Dolphin Mini in other markets, stands out for its competitive pricing, outperforming petrol rivals not only in technology and performance but also in design appeal. The vehicle’s exterior styling is described as youthful and attractive, featuring black accents against a base color, and it is positioned as a mini-SUV (CUV) expected to sell well once more stock arrives. The BYD sales approach includes allowing representatives to take cars home on weekends to better understand the product, reflecting a shift in sales culture toward electric vehicles. Inside, the Atto 1 offers comfortable, sporty two-tone seats comparable to those in a 2019 Tesla Model 3, with practical features such as large cupholders, a non-slip phone holder, and tactile physical roll controls instead of touchscreen menus, enhancing ease
energyelectric-vehiclesBYD-Atto-1clean-technologyelectric-carEV-chargingsustainable-transportationBYD + Miraculous — Saving the World in Different Ways - CleanTechnica
The article discusses a new partnership between BYD, a leading electric vehicle and clean energy company, and Mediawan Group, the production company behind the popular French animated series "Miraculous – Tales of Ladybug and Cat Noir." This collaboration aims to combine BYD’s brand with Mediawan’s creative content to promote innovation, sustainability, and global openness. Key initiatives include featuring BYD vehicles in Mediawan’s flagship projects, such as the upcoming Miraculous theatrical film, and developing original content inspired by BYD’s brand, including a special Miraculous Chibi episode on YouTube. Additionally, BYD and Mediawan will establish the "Build Your Dreams" Award to support emerging creative talents, granting €40,000 annually over the next three years at the Cannes Film Festival. While the partnership is expected to enhance BYD’s visibility in Europe, especially among younger audiences who watch Miraculous, the article expresses some skepticism about its immediate impact on BYD’s sales. Nonetheless, the
energyelectric-vehiclessustainabilityBYDrenewable-energyclean-technologyenergy-storageFrom Britain to the World: What Ofgem’s Energy Debate Looks Like in Global Context - CleanTechnica
The article discusses insights from participation in Ofgem’s Inside Energy podcast series, which explores the UK’s energy transition within a broader global context. Ofgem, the UK energy regulator, faces the challenge of managing a system influenced by international technology trends, supply chains, and infrastructure decisions beyond national borders. The series highlights the rapid pace of the energy transition—from fossil fuels to electrification, renewables, and digital control—and addresses issues such as artificial intelligence, grid constraints, customer impacts, investment risks, affordability, and reliability. The focus has shifted from proving technologies to integrating them effectively for millions of users. A key theme is the concept of "decoupling," where economic growth and fossil fuel emissions no longer move in tandem. Absolute decoupling occurs when GDP rises while emissions fall, and relative decoupling when emissions grow more slowly than GDP. Currently, about 90% of global GDP and 70% of the world’s population are in economies experiencing some form of decoupling—a significant
energyrenewable-energydecarbonizationenergy-transitiongrid-managementartificial-intelligenceclean-technologyComments on World's Potential Response to Trump on UNFCCC Withdrawal - CleanTechnica
The article from CleanTechnica discusses global reactions and potential consequences following the United States' withdrawal from the UNFCCC (United Nations Framework Convention on Climate Change) under the Trump administration. It highlights a range of insightful comments emphasizing that while the US retreat from international climate commitments is detrimental, it may not significantly hinder global progress on clean energy. Many other regions—including Europe, Asia, and Africa—are expected to accelerate their adoption of zero-emission technologies, such as widespread electrification beyond just electric vehicles, thereby driving down emissions and technology costs independently of US policy. A key point raised is that China stands to benefit substantially from the US withdrawal. The article notes that China has already capitalized on the US's inconsistent climate stance by heavily investing in renewable energy research, development, and deployment, effectively cornering the market on clean technology. The US’s imposition of tariffs and restrictions on solar panels, batteries, and related technologies has slowed its own transition while allowing China and other countries to advance rapidly.
energyrenewable-energyclean-technologyelectrificationsolar-panelswind-turbinesenergy-policySmash The Oiligarcy, The Future Is Now! - CleanTechnica
The article from CleanTechnica highlights the platform’s recent success in surpassing its $2,000 Kickstarter fundraising goal through donations and subscriptions, which are vital for supporting their cleantech journalism and initiatives. They are now focusing on new projects, including publishing their first full book—recommended as an engaging and well-researched resource for climate-conscious readers—and organizing their inaugural Electric Home Show. The article also promotes CleanTechnica-branded merchandise featuring cleantech-focused slogans such as “The Future Is Now” and the pun-inspired “Smash The Oiligarcy,” which critiques the US oil industry's resistance to clean energy progress. Additionally, the article reflects on the author’s experience presenting cleantech research globally, emphasizing the enduring relevance of spreading messages about clean technology and climate action. The merchandise serves both as a way to raise funds and foster community among readers, with the author sharing anecdotes of meeting fellow supporters in everyday settings. Readers are encouraged to engage further by subscribing to CleanTechnica’s newsletters
energyclean-technologyrenewable-energysustainabilityelectric-vehiclesclimate-changecleantechHow The World Can Respond To Trump & Rubio's UNFCCC Idiocy - CleanTechnica
The article from CleanTechnica critiques the decision by Donald Trump and Marco Rubio to pull the United States out of the United Nations Framework Convention on Climate Change (UNFCCC), highlighting widespread disappointment and concern within the climate and cleantech communities. It emphasizes that the U.S., as a petrostate heavily influenced by the oil and gas industry, has historically hindered global climate progress by weakening international commitments. The article argues that the U.S. has often acted as a laggard alongside other petrostates like Russia and Saudi Arabia, dragging down global efforts despite its significant influence. However, the author suggests a potential silver lining: with the U.S. stepping back from the UNFCCC, other countries might unite to forge stronger, more ambitious climate policies and treaties without U.S. interference. This could accelerate the growth of cleantech industries worldwide, with China and Europe potentially taking on more prominent leadership roles in clean energy deployment. The article acknowledges concerns that the U.S. withdrawal could lead to
energyclimate-changeclean-technologyrenewable-energysolar-powerwind-energyelectric-vehiclesFord EV Sales Drop In USA, But Not As Bad As I Expected - CleanTechnica
The article from CleanTechnica reports on Ford's significant decline in electric vehicle (EV) sales in the United States during 2025, attributing much of the downturn to shifts in U.S. EV policy under Republican leadership. Despite a dramatic pullback in Ford’s EV plans and investments, the sales results, while disappointing, were not as severe as initially feared. In the fourth quarter of 2025, Ford’s Mustang Mach-E sales dropped by 40.1%, the F-150 Lightning by 60.1%, and the E-Transit by 82.6% compared to the same period in 2024. Over the full year, the Mustang Mach-E remained relatively stable with only a 0.2% decline, whereas the F-150 Lightning and E-Transit experienced more substantial decreases of 18.5% and 58.9%, respectively. The Mustang Mach-E stands out as the relatively bright spot in Ford’s EV lineup, maintaining nearly steady sales despite
energyelectric-vehiclesFordEV-salesrenewable-energyautomotive-industryclean-technologyVolkswagen EV Sales — Mixed Results in USA - CleanTechnica
The article from CleanTechnica analyzes Volkswagen's electric vehicle (EV) sales performance in the United States following the loss of the $7,500 federal EV tax credit. Volkswagen's ID.4 electric crossover experienced a significant decline in sales during the fourth quarter of 2025, with only 248 units sold—a 62% drop compared to the same quarter in 2024 and a sharp fall from the 12,470 units sold in the third quarter of 2025. Despite this quarterly slump, the ID.4 achieved a notable 31.4% increase in full-year sales, rising from 17,021 units in 2024 to 22,373 units in 2025. In contrast, the Volkswagen ID. Buzz electric van showed resilience in a challenging market. Its fourth-quarter sales in 2025 slightly increased by 3.8% year-over-year, from 1,162 to 1,206 units, although this was about half of the third-quarter
energyelectric-vehiclesVolkswagenEV-salesrenewable-energyclean-technologyautomotive-industryCadillac EV Sales Actually Up Year Over Year In 4th Quarter! - CleanTechnica
Despite the expiration of the $7,500 US EV tax credit at the end of Q3 2025, which caused a surge in EV purchases before October followed by a sales decline, Cadillac uniquely increased its electric vehicle sales in Q4 2025 compared to Q4 2024. Key contributors to this growth included new model introductions such as the Escalade IQ, which saw sales rise from 670 to 2,085 units, the OPTIQ with 2,361 units sold (up from zero), and the VISTIQ with 2,210 units sold (also up from zero). However, the LYRIQ model experienced a significant sales drop, falling from 8,084 to 4,345 units in the same period. Overall, Cadillac’s total EV sales grew year-over-year in Q4, bucking the broader industry trend. When examining quarter-over-quarter data, Cadillac’s EV market share decreased to 27% in Q4 2025, down from
energyelectric-vehiclesEV-salesCadillacrenewable-energyEV-tax-creditclean-technologyHow Long Until China Is At 90% Plugin Vehicle Sales? - CleanTechnica
The article discusses the rapid growth of plugin vehicle (PV) sales in China, where more than half of new vehicle sales are now plugin vehicles, including 33% battery electric vehicles (BEVs). China quickly moved from 20% to over 50% PV sales, signaling a strong market shift toward electrification. However, uncertainty remains about future growth since China’s latest five-year plan no longer emphasizes electric vehicles or New Energy Vehicles, raising questions about whether the government is easing its push or considering the market mature enough to sustain itself. Drawing parallels from Norway, the first country to surpass 50% PV sales, the article suggests that China could reach 90% plugin vehicle sales by 2030. Norway took about four years to move from 50% to 90%, and given China’s highly competitive, rapidly growing, and well-developed EV market, it is plausible that China could achieve this milestone within five years. Additionally, Chinese automakers like BYD are expanding exports, which could
energyelectric-vehiclesplugin-vehiclesChinaclean-technologyrenewable-energyautomotive-industryRivian's 2025 Sales Were Meh — But Here Comes 2026! - CleanTechnica
Rivian's 2025 production and delivery figures were modest, with 9,745 vehicles delivered and 10,974 produced in the fourth quarter, and a total of 42,247 deliveries and 42,284 vehicles produced for the full year. The company currently focuses on large, expensive vehicles such as the R1T pickup, R1S SUV, and EDV delivery vans, which naturally limits volume growth. Despite the underwhelming 2025 results, Rivian is optimistic about 2026, as it plans to begin mass production of a more affordable, mid-market vehicle, the R2, and eventually the smaller electric crossover, the R1, which has generated significant interest. The transition to mass production of these new models is expected to be challenging, but Rivian's outlook remains hopeful. The company plans to release its fourth quarter and full-year 2025 financial results on February 12, 2026, followed by an audio webcast to discuss its performance
energyelectric-vehiclesRivianautomotive-industryrenewable-energyEV-productionclean-technologyNIO Explodes Through New Year, 55% Growth in December - CleanTechnica
NIO experienced a strong finish to 2025, with significant growth in vehicle deliveries during the last several months of the year. In December alone, NIO delivered 48,135 vehicles, marking a 54.6% increase compared to December 2024 and a 32.7% increase month-over-month. This was the fifth consecutive month of growth. The December deliveries were split among three brands: 31,897 from NIO, 9,154 from ONVO, and 7,084 from firefly. The company also set a new quarterly record in Q4 with 124,807 vehicles delivered, showing year-over-year growth of 27.8% for NIO, 92.1% for ONVO, and 52.8% for firefly. For the full year 2025, NIO sold a total of 326,028 vehicles, representing a 46.9% increase over the 221,970 vehicles sold in 202
energyelectric-vehiclesclean-technologysustainable-transportationbattery-technologyrenewable-energyautomotive-industryXPENG Sales Rise 126%, from 190,068 to 429,445 - CleanTechnica
XPENG experienced remarkable growth in 2025, with vehicle deliveries soaring 126% from 190,068 units in 2024 to 429,445 units. The majority of this growth occurred in China, but international sales also surged by 96%, with 45,008 vehicles sold across 60 global markets. The company highlighted the environmental impact of its sales, estimating that its 2025 deliveries will reduce life-cycle greenhouse gas emissions by over 6.61 million tons, equivalent to the carbon absorption of 110 million young trees over a decade. Despite the impressive annual growth, XPENG's December 2025 deliveries showed modest gains, increasing only 2% year-over-year and month-over-month, while fourth-quarter sales rose 27% from 91,507 to 116,249 vehicles. The company also expanded its charging infrastructure significantly, adding more than 1,100 new charging stations to reach a total of 3,000 stations by year-end, marking a key
electric-vehiclesXPENGcharging-networkenergy-storagerenewable-energycarbon-emissions-reductionclean-technologyTesla Sales Down 10% Since 2023 — CHARTS - CleanTechnica
Tesla’s vehicle deliveries declined significantly in 2025, with the company reporting 418,227 global deliveries in the fourth quarter—down 15.6% from Q4 2024 and 13.7% from Q4 2023. For the full year, Tesla’s sales fell by 8.54% compared to 2024 and approximately 10% compared to 2023. These figures came in slightly below Wall Street consensus estimates, which may explain Tesla’s early release of 2025 delivery data, possibly to manage market expectations. The decline was most pronounced in the combined sales of the Model 3 and Model Y, Tesla’s more affordable and higher-volume vehicles. Their deliveries dropped 13.85% in Q4 2025 versus Q4 2024, with annual sales down 6.97% compared to 2024 and 8.88% compared to 2023. The higher-end models—Model S, Model X, and Cyber
energyelectric-vehiclesTeslaautomotive-industryrenewable-energyenergy-storageclean-technologyNew Bill Gates-backed wind power design heads to CES 2026 spotlight
The article discusses Airloom, a US wind energy startup backed by Bill Gates, which is developing an innovative wind turbine design aimed at addressing the rising power demands driven by the rapid growth of artificial intelligence (AI) and hyperscale data centers. These data centers consume vast amounts of electricity, straining power grids and potentially increasing costs for consumers. Traditional horizontal-axis wind turbines face challenges such as large size, high costs, long deployment times, and limited suitable sites, which have slowed the expansion of wind energy as a scalable power source. Airloom’s alternative design features a low-profile turbine standing 66 to 98 feet tall, with a loop of adjustable wings moving along a track, resembling a roller coaster rather than a conventional windmill. This design reportedly uses 40% less mass, 42% fewer parts, and 96% fewer unique components, enabling simpler manufacturing and maintenance. The company claims its turbines can be deployed 85% faster and at 47% lower cost than traditional turbines,
energywind-powerrenewable-energywind-turbine-designsustainable-energyenergy-innovationclean-technologyGoogle AI Giving Wrong Information On US EV Tax Credit - CleanTechnica
The article from CleanTechnica highlights a significant issue with Google AI providing incorrect information regarding the U.S. electric vehicle (EV) tax credit. Despite the $7,500 federal EV tax credit having been discontinued since the end of September under the Trump administration, Google AI continues to incorrectly state that many electric vehicles still qualify for this incentive. A test by Andy Kalmowitz at Jalopnik revealed that Google AI mistakenly affirmed eligibility for 19 out of 20 electric cars checked, including popular models like the Hyundai IONIQ 5. While the AI correctly identified some qualification criteria—such as U.S. assembly, MSRP limits, and income thresholds—it failed to acknowledge that the credit had expired, potentially misleading consumers and causing costly surprises at tax time. This misinformation problem is emblematic of a broader challenge with AI-generated content online, where authoritative-sounding but inaccurate answers can mislead the general public who may not have the expertise to verify facts independently. The article stresses that while knowledgeable individuals can
energyelectric-vehiclesEV-tax-creditAI-misinformationclean-technologyGoogle-AIelectric-car-incentivesAlphabet Buys Intersect For $4.75 Billion — Is That A Good Thing? - CleanTechnica
Alphabet, Google's parent company, has acquired Intersect, a data center and energy infrastructure solutions provider, for $4.75 billion in cash plus debt assumption. Intersect builds large-scale power projects to support data centers and growing electricity demands. While some reports have labeled Intersect primarily as a renewable energy developer, the company also constructs fossil gas power plants, which are not considered clean energy. Alphabet’s official announcement highlights that the acquisition aims to accelerate data center and energy generation capacity, as well as energy development and innovation, without explicitly committing to exclusively renewable projects. The article expresses skepticism about the environmental impact of the acquisition, noting that if Alphabet intends to build gas power plants, it would be disappointing from a clean energy perspective. Although Intersect will explore emerging technologies to diversify energy supply and support Google’s U.S. data center investments, the specifics remain unclear. The author suggests cautious optimism but points out that 2025 has seen setbacks in cleantech and CO2 reduction efforts, leaving uncertainty about
energyrenewable-energydata-centersenergy-infrastructurebattery-storageclean-technologyAlphabet-acquisitionSaudi Arabia Opens Pathway for Electric Air Taxis - CleanTechnica
Saudi Arabia is positioning itself as a pioneering market for electric vertical takeoff and landing (eVTOL) aircraft, commonly known as electric air taxis. The country’s aviation regulator, the General Authority of Civil Aviation (GACA), has signed an agreement with Archer Aviation to develop a regulatory framework modeled on the U.S. Federal Aviation Administration’s eVTOL Implementation Pilot Program. This initiative aims to enable early operations in major cities like Riyadh and Jeddah, as well as in large-scale projects such as Red Sea Global, aligning with Saudi Arabia’s Vision 2030 to embrace advanced technologies. The partnership will involve proof-of-concept demonstrations, experimental flights, and efforts to build public acceptance and an operational ecosystem for eVTOL aircraft. Archer Aviation, which recently partnered with Saudi Arabia’s Public Investment Fund’s The Helicopter Company, views this collaboration as a way to safely and quickly bring electric air taxis to market. While the article expresses skepticism about the widespread adoption of electric air taxis globally,
energyelectric-aviationeVTOLSaudi-Arabiaclean-technologyurban-air-mobilitysustainable-transportationNickel-Zinc Battery Company Raises $30 Million - CleanTechnica
ZincFive, a company specializing in nickel-zinc (NiZn) battery solutions for immediate power applications, has successfully raised $30 million in an oversubscribed Series F funding round, bringing its total funding to $254 million since its founding in 2016. The new capital will support rapid scaling of ZincFive’s commercial and manufacturing operations to meet growing demand, particularly from AI data centers requiring reliable power backup. ZincFive claims to be a world leader in NiZn battery technology, having deployed or contracted 2 gigawatts (GW) of battery backup capacity, notable for this less common battery chemistry. The company highlights its nickel-zinc batteries as safer and more sustainable alternatives to lead-acid and lithium-ion options, offering superior power density, inherent safety (zero thermal-runaway risk), and a 96% recyclable design. ZincFive’s technology is engineered for the dynamic power needs of AI data centers, which represent a significant and rapidly expanding market due to the massive power demands of AI
energynickel-zinc-batteryAI-data-centersclean-technologybattery-technologyenergy-storagesustainable-energyT1 Energy Gets 5-Gigawatt US Solar Module Factory From Trina Solar - CleanTechnica
Chinese solar manufacturer Trina Solar has sold a large 5-gigawatt solar module factory in Texas to T1 Energy (formerly FREYR Battery), marking a strategic shift for T1 from battery production to solar power manufacturing. The acquisition, initiated by T1’s board in November 2024 and finalized on December 23, 2025, reflects the growing trend toward domestic manufacturing in critical clean energy sectors amid increasing global protectionism. Trina Solar received $100 million in cash and retained a 17% equity stake in T1 Energy as part of the deal. This move aligns with broader US policy dynamics, including the Inflation Reduction Act of 2022, which incentivizes domestic clean energy production. Although T1’s original plan to build a large battery factory in Georgia was canceled following political changes, the company has remained committed to US-based clean energy manufacturing by pivoting to solar modules. The transaction underscores the importance of localized production of solar panels and batteries in the evolving global energy market
energysolar-energysolar-modulesrenewable-energyenergy-storageclean-technologymanufacturingBYD & Tesla Combine for 30% of Cumulative BEV Sales Globally - CleanTechnica
The article from CleanTechnica highlights the dominant market share of BYD and Tesla in the global battery electric vehicle (BEV) market. As of the end of 2023, cumulative global BEV sales reached approximately 52.3 million units. Tesla accounted for about 8.7 million of these sales, representing 16.6% of the total, while BYD contributed nearly 7 million units, or 13.3%. Combined, these two manufacturers make up roughly 30% of all BEVs worldwide, meaning three out of every ten BEVs on the road are from either Tesla or BYD. Recent sales data for the first ten months of the year show a shift in market dynamics: BYD captured 16.8% of global BEV sales, surpassing Tesla’s 11.8% share during the same period. This indicates that BYD is gaining ground on Tesla in new sales, though their combined share remains close to 29%. The article poses
energyelectric-vehiclesBEV-salesTeslaBYDrenewable-energyclean-technologyJupiter I: World's first 30-MW pure hydrogen gas turbine goes live in China
The MingYang Group in China has successfully launched Jupiter I, the world’s first 30-megawatt (MW) pure hydrogen gas turbine. This turbine can burn 30,000 cubic meters of hydrogen per hour and generate up to 48,000 kilowatt-hours of electricity, enough to power approximately 5,500 households. The significance of Jupiter I lies in its ability to produce on-demand, carbon-free energy, potentially reducing carbon emissions by over 200,000 tonnes annually compared to conventional thermal power plants. The turbine is currently operating stably in Inner Mongolia, marking a major milestone in China’s efforts to transition to clean energy. Jupiter I addresses key challenges in renewable energy storage and grid stability. Excess renewable energy generated during low-demand periods can be converted into hydrogen via electrolysis, storing energy more efficiently than costly battery systems. Unlike the slow process of recombining hydrogen and oxygen to generate electricity, combusting hydrogen in the Jupiter I turbine provides rapid, controllable power output
energyhydrogen-energygas-turbinerenewable-energycarbon-free-powerenergy-storageclean-technologyA 15-Ton Rooftop Heat Pump Is Coming For Your Fossil Fuels
The article discusses the growing role of electric heat pumps in decarbonizing commercial buildings, highlighting advancements led by Carrier Global Corporation in the United States. Heat pumps are more efficient and economical than fossil-fueled heating and conventional electric systems, but their adoption was historically limited in colder climates due to efficiency losses. This challenge has been addressed through public-private partnerships initiated by the U.S. Department of Energy (DOE), including the “Commercial Building HVAC Accelerator” program launched in April 2024, which aims to develop advanced rooftop units (RTUs) that significantly reduce energy use compared to conventional systems, with market-ready products expected by 2027. Carrier has emerged as a leader in this space, becoming the first original equipment manufacturer to complete the DOE’s laboratory validation stage for a new 10-14 ton commercial heat pump. This system meets or exceeds DOE requirements for heating capacity even in very cold temperatures (100% capacity at 5°F and over 70% at -10°F), promising
energyheat-pumpscommercial-HVACenergy-efficiencydecarbonizationrenewable-energyclean-technologyThe 22 top clean tech and energy startups from Disrupt Startup Battlefield
The article highlights 22 leading clean tech and energy startups selected from TechCrunch’s annual Startup Battlefield pitch contest, which narrows thousands of applicants to 200 top contenders across various categories. These startups showcase innovative technologies aimed at sustainability and energy efficiency. Notable examples include AraBat, which uses a bio-based recycling process to recover critical metals from spent lithium-ion batteries using plant waste instead of toxic chemicals, and Aruna Revolution, which produces compostable menstrual pads from agricultural by-products, eliminating plastics and harmful substances. Other standout companies include CarbonBridge, which develops bioreactors for microbial gas fermentation to convert waste gases like methane and CO₂ into valuable molecules more efficiently than traditional methods, and Carbon Negative Solutions, which uses AI to transform industrial waste into carbon-negative cement compatible with existing equipment. Additionally, COI Energy operates a marketplace for enterprises to trade excess energy capacity, optimizing grid usage, while Coral offers an AI and blockchain-powered platform for automated carbon accounting and credit tracking. The startups collectively represent cutting-edge
energyclean-technologybattery-recyclingAI-energy-managementelectric-vehicle-chargingultracapacitorscarbon-negative-materialsIndustrial Green Hydrogen Is Coming To Europe From The US
The article discusses the emerging role of industrial green hydrogen in Europe, supplied from the US, amid evolving federal energy policies and advancements in clean technology. Green hydrogen, produced via electrolysis powered by renewable energy, is gaining traction as a critical component for decarbonizing industrial sectors such as refining, metallurgy, agriculture, and pharmaceuticals. While early enthusiasm for green hydrogen targeted diverse, small-scale applications, high transportation and storage costs limited its viability. Consequently, focus has shifted toward large-scale industrial uses where economies of scale can significantly reduce costs, with sectors like steelmaking, long-haul shipping, and petrochemicals identified as prime candidates for green hydrogen adoption. A key player highlighted is the Massachusetts-based startup Electric Hydrogen, which has developed the HYPRPlant electrolyzer platform designed to cut green hydrogen production costs by up to 60%. This turnkey, factory-assembled system can be deployed on-site for bulk hydrogen production, minimizing transportation expenses. Electric Hydrogen has attracted substantial investment from major industrial and climate-focused investors
energygreen-hydrogenrenewable-energyelectrolysisdecarbonizationindustrial-applicationsclean-technologyBYD's at 20% Share of Cumulative Plugin Vehicle Sales! - CleanTechnica
The article highlights a significant milestone in the electric vehicle (EV) market: BYD, the Chinese cleantech company, has achieved a remarkable 20% share of cumulative plugin vehicle sales globally. BYD has dominated its home market in China and is rapidly expanding its presence in South America, Africa, and other parts of Asia. While maintaining this 20% share amid the rapidly growing and diversifying EV market may be challenging, it remains an impressive accomplishment. In comparison, Tesla has delivered approximately 8.7 million vehicles cumulatively, representing just under 12% of the global plugin vehicle market. Tesla’s figure is notable, especially considering it sells only full battery electric vehicles (BEVs), whereas BYD’s share includes both BEVs and plugin hybrids. The article notes that if focusing solely on BEVs, Tesla’s market share would be relatively higher, and BYD’s share would be lower. The data discussed pertains to the modern EV era, excluding early electric vehicle sales from the
energyelectric-vehiclesclean-technologyBYDTeslaplugin-hybridsbattery-electric-vehiclesMillions of People Are Dying from USAID Cuts - CleanTechnica
The article from CleanTechnica highlights the severe humanitarian consequences resulting from significant cuts to USAID (United States Agency for International Development) programs, actions linked to Elon Musk’s involvement with a political entity dubbed the “Department of Government Efficiency” (DOGE) during the Trump administration. These budget reductions have reportedly led to the premature deaths of hundreds of thousands, with projections estimating up to 14 million deaths over five years. The cuts have devastated critical aid efforts, including food assistance to refugee camps and global health initiatives such as HIV response programs, exacerbating suffering among vulnerable populations like the Rohingya children and refugees worldwide. The piece underscores the bipartisan support USAID historically enjoyed due to its vital role in saving lives and enhancing U.S. global standing. It criticizes the Trump-era political appointees and Musk’s actions for dismantling these programs, describing the resulting humanitarian crisis as “horrible” and “beyond words.” Various experts, journalists, and politicians cited in the article condemn the
energyclean-technologysolar-energyelectric-vehiclescleantechrenewable-energyenvironmental-impactLast-Minute Christmas Present Idea — A Rivian! (Hopefully) - CleanTechnica
The article from CleanTechnica suggests a unique last-minute Christmas gift idea: entering someone into a raffle to win a Rivian electric vehicle. Inspired by the common practice of gifting lottery tickets, the author highlights a current EV raffle supported by CleanTechnica in partnership with ISEA, which sells only 2,500 tickets. This raffle offers a much better chance than typical lotteries and supports solar power advocacy and progress, making it a meaningful gift beyond just the chance to win a Rivian. Rivian, an electric vehicle manufacturer, has been in the spotlight recently due to its preparations for production and growing interest in its vehicles. The raffle tickets cost $100 each or $300 for four, providing an affordable way to potentially gift a high-value EV. The article encourages readers to consider this option as a fun, impactful present that avoids the usual holiday shopping stress and supports clean energy initiatives.
electric-vehiclesRiviansolar-energyrenewable-energyenergy-storageEV-productionclean-technologyRivian Training Veterans in Georgia - CleanTechnica
Rivian, the all-electric automaker, has launched a new workforce development initiative by partnering with the Veterans Training Empowerment Center (VTEC) at Fort Benning, Georgia, to train veterans in technical trades related to electric vehicle (EV) service and maintenance. The 15-week Rivian Technical Trades Program, officially designated by the U.S. Army, aims to prepare veterans transitioning out of service for careers in the EV sector, with employment opportunities offered to graduates. This program addresses the specialized skills required for EV technicians, including knowledge of advanced software, high-voltage battery handling, and EV vehicle architecture. This initiative aligns with Rivian’s broader expansion in Georgia, where it is building a new factory near Social Circle expected to create 7,500 jobs by 2030, alongside two existing service centers and a planned East Coast headquarters in Midtown Atlanta employing 500 people. Rivian’s efforts reflect its ambition to strengthen American leadership in automotive and advanced technologies by developing a skilled workforce and supporting
energyelectric-vehiclesworkforce-developmenttechnical-trainingveteransRivianclean-technologyDid Trump & Musk Open Up A Huge, Important Lane For Rivian? - CleanTechnica
The article from CleanTechnica discusses Rivian’s position in the competitive electric vehicle (EV) market, highlighting concerns about whether the company can break into a mature and heavily contested industry dominated by Tesla and numerous Chinese EV manufacturers. While Rivian has developed high-quality EVs and plans to scale up more affordable models like the R2 and R3 to achieve profitability, the market is now crowded with many compelling EV options from legacy automakers and Tesla’s aggressive pricing strategies. This saturation raises doubts about Rivian’s ability to capture significant market share. However, the article argues that recent political and market developments involving Elon Musk and Donald Trump may inadvertently create a valuable opportunity for Rivian. Musk’s political controversies have alienated some Tesla customers, potentially driving them toward Rivian as an alternative EV-only brand. Additionally, policy rollbacks on fuel economy standards and the federal EV tax credit, along with legacy automakers scaling back their EV investments (e.g., Ford’s $19.5 billion EV write-off
energyelectric-vehiclesEV-marketRivianTeslaautomotive-industryclean-technologyCalifornia & USA Set to Diverge Massively on Electric Vehicles? - CleanTechnica
The article from CleanTechnica discusses a growing divergence between California and the rest of the United States regarding electric vehicle (EV) adoption and market development. It highlights that major U.S. automakers like Ford and GM are scaling back their EV efforts nationally, partly due to financial struggles and a federal government perceived as unsupportive or even hostile toward EV advancement. In contrast, California is positioned to continue pushing stricter fuel economy and emissions standards, despite ongoing legal challenges initiated during the Trump administration. The state’s legal right to enforce higher standards to protect the environment is expected to prevail, enabling California to maintain and even accelerate its leadership in EV adoption. This divergence could lead to a bifurcated market where California enjoys a growing variety of compelling EV models and rising market share, while much of the rest of the country experiences stagnation or decline in EV availability and sales. The article draws a parallel to the earlier era of “compliance cars” that were initially limited and less attractive but notes that
energyelectric-vehiclesEV-marketCaliforniafuel-economy-standardsautomotive-industryclean-technologyEVs 2025 — It Was The Best Of Times, It Was The Worst Of Times - CleanTechnica
The article "EVs 2025 — It Was The Best Of Times, It Was The Worst Of Times" from CleanTechnica reflects on the trajectory of electric vehicles (EVs) through the lens of the classic S curve model of technology adoption. Initially, EVs followed the expected pattern: slow early adoption with high prices, followed by rapid growth as costs decreased and demand surged, supported by strong policy incentives such as the EU's 2035 internal combustion engine phase-out, China's EV incentives, and the U.S. Inflation Reduction Act of 2022. This period was marked by optimism about the EV revolution and its potential to dominate the automotive market. However, the article highlights a significant setback beginning in 2024, linked to political shifts in the U.S. and globally. The change in U.S. administration led to a rollback of EV and clean energy initiatives, including freezing funds for EV infrastructure, canceling offshore wind and solar projects, and attacking emissions mandates. This political reversal
energyelectric-vehiclesEV-chargersrenewable-energyInflation-Reduction-Actautomotive-industryclean-technologyEV Enthusiasts Are Losing The Battle In The USA Right Now — Why? - CleanTechnica
The article from CleanTechnica highlights the contrasting trajectories of electric vehicle (EV) adoption in China, Europe, and the United States, attributing much of the disparity to political leadership and policy decisions. China, under President Xi Jinping since 2013, has aggressively pursued cleantech policies, becoming the global leader in solar, wind, and EV markets, with over half of global EV sales occurring there. European countries have similarly implemented strong CO2 emissions regulations and supported EV adoption, resulting in significant plugin vehicle sales. In contrast, the U.S. has experienced inconsistent leadership on climate and cleantech issues, with political shifts often undermining progress. The article critiques past U.S. presidents who either failed to prioritize or actively hindered cleantech advancement. While President Obama initiated important stimulus efforts and regulatory measures to promote EVs and sustainable industries, subsequent leadership under Donald Trump reversed many of these gains by deregulating industries, subsidizing fossil fuels, and attacking EV initiatives. Despite President Biden’s
energyelectric-vehiclesclean-technologyclimate-policyrenewable-energyEV-adoptionenvironmental-regulationDigging Deeper Into EV Market Changes In Europe 2017–2025 - CleanTechnica
The article from CleanTechnica analyzes the evolution of the electric vehicle (EV) market in Europe from 2017 through the early part of 2025, focusing on sales data and market share among leading automakers. Over this period, the total EV market in the 13 covered European countries has grown rapidly, nearly tripling in size from 567,000 units in 2020 to an estimated 1.83 million units year-to-date in 2025. The Volkswagen (VW) Group has emerged as the dominant player since 2020, coinciding with the launch of its ID3 and ID4 models, consistently holding the largest market share, peaking at nearly 30% in 2025. Tesla, Renault-Nissan, Stellantis, and BMW have also been significant competitors, though Renault-Nissan and Tesla have seen declines in their market shares over time. Key takeaways include the remarkable acceleration of EV adoption in Europe, highlighting a major shift in leadership within the automotive
energyelectric-vehiclesEV-marketautomotive-industryrenewable-energyclean-technologyVolkswagenTesla's 8-Year Model Sales Trends in 11 European Countries - CleanTechnica
The article analyzes Tesla’s sales trends over eight years for its two main models, the Model Y and Model 3, across 11 European countries including Germany, the UK, Norway, and others. Using data from EU-EVs.com, the author highlights that the Model Y experienced its peak sales year in 2023, with a strong start in 2024, which nonetheless saw a slight decline compared to the previous year. However, projections indicate a significant sales drop in 2025, potentially falling back to 2022 levels by 2026 if current trends continue. The Model Y’s sales trajectory shows a rapid rise followed by a notable downturn in recent years. For the Model 3, 2024 marked its best sales year, boosted by its established market presence and a model refresh. Other strong years for the Model 3 were 2019 and 2021, with weaker sales in 2020 due to COVID-19 disruptions and in 2022 as the Model Y
energyelectric-vehiclesTeslaEV-salesclean-technologysustainable-transportationEuropean-marketHuge Changes in Auto Group Share of European EV Sales - CleanTechnica
The article from CleanTechnica analyzes the shifting market shares of major auto groups in European electric vehicle (EV) sales from 2017 through 2025. A key finding is the dramatic decline of the Renault–Nissan–Mitsubishi Alliance, which fell from a dominant 39.4% market share in Q1 2017 to just 6% by Q4 2025. This decline is attributed in part to internal turmoil, including the high-profile imprisonment and escape of former CEO Carlos Ghosn, who was a strong proponent of EVs. Tesla also saw a significant drop, from 22.6% to 7.7%, despite being fully focused on electric vehicles. BMW similarly declined from 16.6% to 8.8%. On the positive side, Volkswagen Group experienced remarkable growth, increasing its market share from 6.6% to 29.6%, becoming the dominant player in European EV sales. Other auto groups like Geely
energyelectric-vehiclesEV-marketautomotive-industryrenewable-energyclean-technologyVolkswagen-GroupUS Tesla Sales Drop 23% in November Year Over Year - CleanTechnica
In November, US Tesla sales declined by 23% year-over-year, reflecting a broader downturn in electric vehicle (EV) sales following a surge in the third quarter driven by the impending expiration of the $7,500 US EV tax credit on October 1. Tesla attempted to counteract this drop by introducing lower-priced, decontented versions of the Model 3 and Model Y, reducing prices by $5,000 to $5,500. However, these cheaper models have not compensated for the loss of the tax credit, and sales have continued to fall sharply in the fourth quarter. Additionally, Tesla faces a challenge with product cannibalization, as sales of the lower-cost versions have come at the expense of higher-margin, premium Model 3 and Model Y variants. This shift is negatively impacting Tesla’s gross margins, with some estimates suggesting a significant drop in gross profit from $20 billion in 2022 to potentially as low as $7 billion in 2023. The combination of
energyelectric-vehiclesTeslaEV-salesrenewable-energyclean-technologyautomotive-industryThe Chinese EV Sales Backfire That Was Too Obvious - CleanTechnica
The article discusses the unintended consequences of the European Union’s (EU) decision in June 2024 to impose high tariffs on fully electric vehicles (BEVs) produced in China, aiming to protect European automakers from competition. While the tariffs targeted Chinese BEVs, they did not apply to plug-in hybrid electric vehicles (PHEVs). This selective tariff approach has backfired, as Chinese automakers have significantly increased their overall EV sales in Europe, with a 93% rise reported within a year despite the tariffs. Chinese brands, such as BYD, have gained substantial market share, nearly matching Tesla’s presence in the European EV market. The article highlights that Chinese PHEVs, which were initially an afterthought for Chinese manufacturers focusing on BEVs, have become a competitive advantage due to the absence of tariffs on these vehicles. Chinese PHEVs outperform European counterparts in terms of price and specifications, driving rapid sales growth. The EU’s oversight in not imposing tariffs on PHEVs may
energyelectric-vehiclesEU-tariffsChinese-automakersplug-in-hybridsclean-technologyautomotive-industryUber Abandons EVs & Climate, After Cozying Up With Trump - CleanTechnica
The article criticizes Uber for abandoning its earlier commitments to electric vehicle (EV) adoption and climate-friendly policies. Initially, Uber had set ambitious goals to transition to 100% electric fleets in key markets like London by 2024 and North America and Europe by 2030, alongside providing drivers with EV incentives. However, the company has since dropped these targets, canceled monthly EV bonuses for drivers, and is now opposing local regulations that mandate ride-hailing companies to electrify their fleets, such as California’s law requiring 90% electrification by 2030. This reversal has contributed to a doubling of Uber’s carbon emissions over the past three years, resulting in a climate footprint larger than that of Denmark. The article also highlights Uber’s political alignment with the Trump administration, notably CEO Dara Khosrowshahi’s support for the “Big Beautiful Bill,” which the League of Conservation Voters deems “the most anti-environmental bill of all time.” This legislation undermines EV-support
energyelectric-vehiclesUberclimate-policyemissionsclean-technologytransportation-electrificationStellantis Says It Will Bring Electric Topolino To US - CleanTechnica
The article discusses Stellantis' plan to introduce an electric version of the iconic Italian "Topolino" microcar to the US market, inspired by the popularity of Japan's kei cars. Kei cars are small, affordable vehicles with strict size and engine displacement limits, designed to stimulate car ownership and industry growth in post-war Japan. These cars typically sell for around $10,000 new and have gained a niche following in the US, especially among enthusiasts importing models over 25 years old. The US president’s recent visit to Japan and his comments praising these tiny cars sparked renewed interest in bringing similar compact, affordable vehicles to America. The article highlights the political and economic context surrounding this move, noting that while kei cars are affordable, the US auto market is dominated by much larger and more expensive vehicles, with an average new car price exceeding $50,000. The administration’s rollback of emissions standards has encouraged automakers to produce bigger, less efficient vehicles, contradicting affordability goals. Stellantis’ initiative to
energyelectric-vehiclesautomotive-industrykei-carsclean-technologysustainable-transportationelectric-mobilityFrom Startup to Industry Pioneer: Taiga’s Off-Road Electrification Journey - CleanTechnica
The article highlights an interview with Sam Bruneau, CEO and cofounder of Taiga, a pioneering company in electric power-sports vehicles. Founded in 2015, Taiga aims to revolutionize the off-road and watercraft industries by developing fully electric vehicles that deliver superior performance without environmental compromise. The discussion centers on Taiga’s latest product, the Orca WX3, a versatile electric crossover watercraft designed for watersports and adventure, featuring innovations such as bi-directional charging, geofencing, and speed limiting—capabilities that traditional combustion engines cannot match. Bruneau also addresses the technical challenges his team has faced, particularly in scaling advanced battery manufacturing to meet the demands of rugged environments. The company’s mission is to lead the transition toward clean, high-performance recreational vehicles, emphasizing the growing importance of electrification in off-road and water-based activities. The article invites readers to explore Taiga’s current electric offerings and listen to the full podcast interview for deeper insights into the
energyelectric-vehiclesbattery-manufacturingelectrificationclean-technologypower-sportsrenewable-energyCheapest Used Electric Cars in the USA, Part 2 - CleanTechnica
The article from CleanTechnica revisits the market for used electric vehicles (EVs) in the USA, focusing on the cheapest options available as of early 2023, following the expiration of the $4,000 used EV tax credit in October. The author compares current prices to those from a previous analysis conducted just before the tax credit ended, using a selection of 14 popular and cost-competitive EV models that are less than six years old and have no accident history. The key finding is that prices have remained largely stable or even increased slightly since the tax credit expired, indicating that buyers who purchased used EVs before October benefited from significant savings. While most models showed little change in price when accounting for mileage, trim, and model year differences, a few exceptions stood out. The Hyundai IONIQ 5 and Nissan ARIYA exhibited notable price drops despite similar or lower mileage, with the ARIYA’s price decreasing by nearly $3,000 for comparable listings. Tesla models were
energyelectric-vehiclesEV-tax-creditused-electric-carsclean-technologyautomotive-energysustainable-transportationTesla Lobbying UK on EV Policies ... as Trump Guts Critical US Auto Policy - CleanTechnica
The article highlights Tesla’s efforts to influence UK government policy to strengthen electric vehicle (EV) mandates rather than weaken them. Specifically, Tesla opposed recent Labour government moves that introduced loopholes in the zero-emission vehicle (ZEV) mandate, which allows automakers to sell more petrol and diesel cars despite targets to increase EV sales. Tesla also advocated for policies supporting the used EV market to facilitate easier resale, encouraging more consumers to transition to EVs. These actions reflect Tesla’s push for smarter, more effective cleantech policies in the UK, contrasting with the Labour government’s recent regulatory relaxations and new taxes on EVs that critics say could undermine demand. In stark contrast, the article points out that the Trump administration in the United States has been actively rolling back EV-friendly policies. It eliminated consumer subsidies for both new and used EVs and is proposing significant rollbacks of fuel economy standards established under the Biden administration. These standards had modestly encouraged automakers to produce and sell more EVs and
energyelectric-vehiclesEV-policyclean-technologyfuel-economy-standardsTeslaautomotive-industryCall for Urgent Agreement on EU Battery Carbon Footprint Rules in Support of Europe’s Battery Industry - CleanTechnica
The article highlights a collective call from Transport & Environment (T&E) alongside various companies and organizations within the European battery value chain for an urgent agreement on the European Union’s battery carbon footprint regulations. This appeal comes ahead of the upcoming EU Battery Booster initiative, emphasizing the need for Member States and the European Commission to reach a fair and ambitious compromise on these rules. The goal is to support and foster the growth of Europe’s battery industry by establishing clear, effective carbon footprint standards. The letter, which stakeholders are encouraged to sign, underscores the importance of timely regulatory clarity to strengthen Europe’s position in the global battery market. The article also provides resources for readers to learn more about the letter and how companies can add their support. Overall, the piece stresses the urgency of finalizing these carbon footprint rules to ensure the sustainable development of the European battery sector.
energybattery-technologyEU-regulationscarbon-footprintelectric-vehiclessustainable-energyclean-technologyKia EV2 World Premiere Confirmed for Brussels Motor Show 2026 - CleanTechnica
Kia has confirmed the world premiere of its new all-electric B-segment SUV, the EV2, at the Brussels Motor Show on January 9, 2026. Designed, developed, and soon to be produced in Europe, the EV2 aims to make electric mobility more accessible without compromise. The vehicle features a modern, emotionally appealing design that aligns with Kia’s ‘Opposites United’ philosophy, combining advanced technology, smart EV features, and a spacious, adaptable interior tailored for European consumers. At the event, Kia will also present sporty GT versions of the EV3, along with the EV4 Hatchback and EV5 models, highlighting the brand’s expanding electric vehicle lineup. Marc Hedrich, President & CEO of Kia Europe, emphasized the EV2’s role in shaping responsible mobility in Europe, underscoring the company’s commitment to innovation and everyday usability in the electric vehicle market. The press conference will take place at Kia’s stand in Hall 5, Booth 3, from
energyelectric-vehiclesKia-EV2clean-technologysustainable-mobilityelectric-SUVautomotive-innovationNIO Sales Soar 76% - CleanTechnica
NIO experienced significant sales growth in November, delivering 36,275 vehicles, marking a 76.3% increase compared to November 2023. Although this was not a new monthly sales record, it was the company's second-highest sales month. The deliveries were divided among three brands: 18,393 for the NIO brand, 11,794 for the family-oriented ONVO brand, and 6,088 for the high-end small electric car brand Firefly. Cumulatively, NIO has delivered 949,457 vehicles to date, positioning the company close to reaching the milestone of 1 million total vehicle sales, likely in January 2025. Breaking down cumulative sales by brand, NIO leads with 797,712 vehicles sold, followed by ONVO with 119,415, and Firefly with 32,330. While the article notes some confidence in XPENG’s growth strategy alongside NIO’s, both companies are performing well and may eventually surpass
energyelectric-vehiclesNIOEV-salesrenewable-energyautomotive-industryclean-technologyStupid — UK Putting Road Tax on EVs in 2028 - CleanTechnica
The UK government plans to introduce a pay-per-mile road tax on electric vehicles (EVs) and plug-in hybrids starting in 2028, charging 3p per mile for fully electric cars and 1.5p per mile for plug-in hybrids. This tax, which will rise with inflation, is expected to generate about £255 annually for a driver covering 8,500 miles, roughly half the fuel tax paid by petrol and diesel drivers. While this tax is lower than fossil fuel taxes, critics argue it is premature and could hinder EV adoption, potentially reducing electric car sales by 440,000 over the next five years. Despite this new levy, the government is also implementing measures to encourage EV uptake, such as raising the Vehicle Excise Duty (VED) expensive car supplement threshold from £40,000 to £50,000 for electric vehicles, which could offset some negative impacts by boosting sales by 320,000. Additionally, the UK has committed £1.3 billion for
energyelectric-vehiclesEV-taxclean-technologyUK-government-policyelectric-car-incentivesEV-infrastructureTesla Ramping Up Model Y Production In Germany - CleanTechnica
Tesla is increasing production of its Model Y at the German Giga Berlin factory due to a rebound in demand, prompting the company to switch back to two full shifts per day as of September. This follows a period earlier in 2023 when production had dropped below two shifts daily after Tesla had previously operated three shifts at the end of 2022. The uptick in demand is partly attributed to the introduction of new Model Y variants, especially the more affordable Standard version, as well as the factory’s growing role in exporting vehicles to over 30 international markets. A significant driver behind the increased use of the German factory is the tariff war, which has raised costs on US-produced Model Ys, leading Tesla to export German-made vehicles to markets like Canada instead of those produced in the US. Despite this, the Giga Berlin factory does not supply Tesla’s two largest markets— the USA and China—both of which have experienced declining demand recently. Consequently, Tesla’s overall global consumer demand trends remain unclear,
energyelectric-vehiclesTeslaModel-Yrenewable-energyautomotive-manufacturingclean-technologySunlight helps convert methane into ethylene in clean new process
Researchers led by University of Queensland’s Professor Lianzhou Wang have developed a novel solar-powered process that converts methane—a potent greenhouse gas—into ethylene, a valuable chemical used in plastics and textiles. Unlike traditional methane conversion methods that require extremely high temperatures and are energy-intensive, this new approach uses Australia’s abundant sunlight and a palladium–gold alloy catalyst combined with titanium dioxide to drive the reaction. The catalyst uniquely alters the reaction pathway to favor ethylene production rather than over-oxidizing methane into carbon dioxide, thereby offering a cleaner and more energy-efficient alternative. This innovation not only promises to reduce methane emissions at their source, particularly from agriculture and coal mining in Australia, but also transforms harmful emissions into economically valuable products. The researchers envision deploying photocatalyst beds near methane-rich sites, such as livestock facilities, to capture and convert methane onsite using sunlight. While the current catalyst relies on costly metals like gold and palladium, ongoing research aims to find cheaper alternatives such as iron to make the process
energyrenewable-energymethane-conversionphotocatalysiscatalyst-developmentsolar-powerclean-technologyAlbania — 57% BEV Share in October! - CleanTechnica
In October, Albania achieved an impressive 57% market share for battery electric vehicles (BEVs) among new passenger car registrations, despite its small market size of only 933 new vehicles and relatively low purchasing power compared to other European countries. This remarkable EV adoption rate places Albania among the global leaders in BEV market share. A key factor driving this trend is the influx of electric vehicles from China, particularly from BYD, which commands over 40% of the entire Albanian new vehicle market—not just the EV segment. Further highlighting the dominance of electric vehicles, eight of the top ten best-selling models in Albania during October were BEVs, with BYD occupying the top four positions. When plug-in hybrid electric vehicles (PHEVs), which accounted for an additional 3% market share, are included, plug-in vehicles collectively represented 60% of the total new car market in Albania for that month. This data underscores Albania’s rapid transition toward electrification, fueled largely by Chinese EV imports
energyelectric-vehiclesBEVEV-marketclean-technologysustainable-transportationAlbaniaCyberfest & Furious 2025: Cybertrucks Humiliated Gas Cars, Drifted Like Maniacs, And Threw A Wild Light Show - CleanTechnica
The Cyberfest & Furious 2025 event held on November 15, 2025, at Showtime Speedway in Clearwater was a spectacular celebration of Tesla vehicles, particularly Cybertrucks, showcasing their dominance over traditional gas-powered cars. The event featured drag races where Cybertrucks consistently outperformed powerful fossil-fuel competitors like Cadillac Escalades, Hellcats, Ram TRXs, and even a Lamborghini Huracán, demonstrating the impressive instant torque and acceleration of electric vehicles. The crowd was energized by the thrilling races and the variety of Tesla models competing, including divisions for different drivetrain configurations and an "All Tesla Models" class. Beyond drag racing, the event turned chaotic and exciting with the CyberDrift sudden-elimination battles, where Cybertrucks slid sideways on a damp track in a wild, unpolished style reminiscent of "Florida Man" antics. Spectators witnessed dramatic drifts, near crashes, and spectacular recoveries, with one CyberBeast spinning 720 degrees yet continuing to drift,
energyelectric-vehiclesTeslaCybertruckdrag-racingelectric-mobilityclean-technologyThe Long Tail of BEV Sales in Australia - CleanTechnica
The article from CleanTechnica provides an in-depth look at the diversity and sales performance of battery electric vehicles (BEVs) in Australia for October 2025, focusing beyond the top-selling models. Australia, lacking domestic car production and reliant on imported vehicles, saw 19 BEV models selling more than 50 units each in that month alone, illustrating a broad and varied market. Notable models outside the top ten included the Zeekr 7X (178 units), Volvo EX30 (122), Toyota BZ4X (121), MG4 (106), and Audi Q6 e-tron (101), among others. The list featured mainly SUVs and a strong presence of European brands (11 models), with Chinese brands (6 models), a single American model, and only one Japanese model (Toyota). The article highlights the mixed reception of certain models, such as the underwhelming Toyota BZ4X, and praises others like the MG4 and Polestar 4 for their
energyelectric-vehiclesBEV-salesAustraliaclean-technologyautomotive-industrysustainable-transportationMore Than 80 New EV Chargers To Be Installed In Boise, Idaho - CleanTechnica
Boise, Idaho, is set to receive more than 80 new electric vehicle (EV) chargers, including between 80 and 100 Level 2 chargers and 2 to 8 fast chargers, primarily installed at parks and libraries. These additions are expected to be completed by early 2027, supplementing the city's existing 314 EV chargers. This expansion aligns with broader national trends, as other regions like San Diego, Tennessee, Virginia, Kentucky, and Wisconsin are also increasing their EV charging infrastructure, supported in part by federal grants despite political challenges. The increase in public EV chargers aims to reduce range anxiety among drivers and promote greater EV adoption. The article also addresses common misconceptions about EVs, clarifying that many models are priced below the average cost of new cars in the U.S. and that current EV ranges are sufficient for most drivers, especially as charging infrastructure improves. Overall, the development of more accessible charging stations in Boise and beyond reflects ongoing efforts to support the transition to electric transportation
energyelectric-vehiclesEV-chargerscharging-infrastructurerenewable-energyclean-technologysustainable-transportationGreen Aluminium Could Make EVs Even Cleaner for Just €25 — Study - CleanTechnica
A recent study highlighted by CleanTechnica emphasizes the significant climate benefits of using green aluminium in European electric vehicle (EV) manufacturing. While EVs reduce tailpipe emissions, the production phase—especially aluminium manufacturing—still accounts for about 60% of an EV’s total climate impact, with aluminium production responsible for roughly one-fifth of these emissions. Green aluminium, produced either from recycled materials or primary aluminium made using electrified heating and cleaner technologies, could drastically cut these emissions. Due to Europe’s relatively clean electricity grid, the EU is well-positioned to lead in green aluminium production, potentially saving as much CO2 annually as removing 900,000 fossil fuel cars from the road by 2040. The study finds that incorporating 60% green aluminium by 2035 and 85% by 2040 in new cars is feasible and would add only about €25 to the cost of a vehicle. The report also stresses the strategic importance of revitalizing the EU aluminium industry, which currently
energymaterialsgreen-aluminiumelectric-vehiclesclean-technologyEU-automotive-industrycarbon-emissions-reductionHow to Make the Industrial Accelerator Act Deliver for EVs & Batteries - CleanTechnica
The article from CleanTechnica discusses the need for a robust Industrial Accelerator Act (IAA) in Europe to strengthen the continent’s position in the global clean technology race, particularly for electric vehicles (EVs) and batteries. Europe is currently losing ground due to dependencies on non-European supply chains, risking deindustrialization and job losses. The article emphasizes that merely setting aspirational domestic production targets, as seen with the EU’s Net Zero Industry Act, is insufficient without concrete policies and funding. To counter this, Europe must ensure a significant portion of critical EV technology—such as batteries, electronics, electric motors, chips, software, and critical minerals—is produced locally, with non-European firms encouraged to onshore supply chains through beneficial partnerships. T&E proposes four pillars for a successful IAA: (1) clearly defining “Made-in-EU” rules for EVs and batteries to create transparent, investment-attracting standards focused on the electric tech stack; (2) linking these local content rules consistently across
energyelectric-vehiclesbatteriesclean-technologyindustrial-policyEU-manufacturinglocal-content-requirementsMany New EV Fast Chargers Coming To Wisconsin - CleanTechnica
A new initiative in Wisconsin will see the installation of fast electric vehicle (EV) chargers at 26 business locations, including Kwik Trip stores, hotels, gas stations, a chocolate shop, and a Culver’s restaurant. This project is supported by $14 million in federally funded grants aimed at expanding EV infrastructure across the state. While the exact number of new charging ports has not been specified, estimates suggest there could be between 26 and 104 ports, based on similar recent installations that typically feature multiple chargers per site. The Wisconsin Department of Transportation emphasizes that these new chargers will provide reliable and convenient stops for EV drivers, encouraging travel across the state and supporting local businesses. Although Wisconsin currently has relatively few electric vehicles—partly due to limited public charging options—the expansion of fast chargers is expected to increase awareness and usage. This infrastructure growth is particularly important now that federal consumer EV incentives have ended, making accessible charging stations a critical factor in promoting EV adoption in the region.
energyelectric-vehiclesEV-chargingfast-chargersrenewable-energyinfrastructureclean-technologyUS EV Sales — Forecasts for 2026 & 2030 - CleanTechnica
The article from CleanTechnica centers on a video discussion featuring experts Jose Pontes, Larry Evans, Steve Hanley, and Zachary Shahan, who analyze the current state and future outlook of the US electric vehicle (EV) market. They explore US EV policies, the expected market share of EVs by 2026 and 2030, and the roles of major players like Tesla and traditional automakers. The conversation also touches on the political landscape influencing EV adoption and the voluntary actions (or lack thereof) by legacy car manufacturers. While the article itself primarily promotes the video and CleanTechnica’s subscription services, it highlights that the discussion provides in-depth insights into how the US EV market is evolving, including forecasts for significant growth in EV market share over the coming decade. The experts emphasize the importance of policy support and innovation from both new and established automakers to meet future EV demand. However, specific numerical forecasts or detailed policy analysis are not included in the text provided.
electric-vehiclesEV-marketUS-EV-salesrenewable-energyclean-technologyenergy-storageTeslaNew Sodium-Ion Batteries Threaten The US Coal Recovery Plan
The article discusses the emerging threat that new sodium-ion battery technology poses to the U.S. coal recovery plan. Despite recent attempts to revive aging coal power plants amid a proclaimed national “energy emergency,” these efforts are faltering due to the rapid advancement and cost-effectiveness of renewable energy sources like wind and solar, coupled with innovative energy storage solutions. In the first half of 2024, renewables accounted for 93% of new capacity additions to the U.S. grid, with solar and energy storage projects making up 83%, underscoring the accelerating shift away from fossil fuels. Sodium-ion batteries are highlighted as a promising alternative to lithium-ion batteries for grid-scale energy storage due to their cost advantages, scalability, and supply chain security. Although the U.S. startup Natron, an early sodium-ion player, recently shut down, Peak Energy—a newer company with experienced leadership from Tesla, Apple, and Powin—has gained significant traction. Peak Energy secured $55 million in Series A
energysodium-ion-batteriesenergy-storagerenewable-energyclean-technologybattery-innovationUS-energy-policyCleanTechnica Needs You — No Paywalls, No AI BS, No Billionaire Owners - CleanTechnica
CleanTechnica, a clean technology news outlet with over 17 years of experience, is seeking financial support from its readers to sustain its operations. The site has built a comprehensive archive of original reporting on solar and wind energy, electric vehicles, batteries, and other clean tech topics, including in-depth analyses, product reviews, and on-site coverage of projects and events. Despite the significant time and financial investment required to maintain this level of quality journalism, CleanTechnica chooses not to implement paywalls, aiming to keep its content freely accessible to as many people as possible, including those who cannot afford subscription fees. The article highlights the challenges facing independent media outlets like CleanTechnica, including reduced traffic from search engines and social media platforms that prioritize keeping users on their sites rather than directing them to external content. Additionally, many media companies have turned to AI-generated content or are owned by billionaires and large corporations with less focus on societal benefit, trends CleanTechnica consciously avoids. The site emphasizes its commitment to
energyclean-technologysolar-energywind-energyelectric-vehiclesbatteriesrenewable-energyUS Plugin Vehicle Sales Dropped 27% Year Over Year In October - CleanTechnica
In October 2025, U.S. sales of plug-in electric vehicles (PEVs), including both battery electric vehicles (BEVs) and plug-in hybrid electric vehicles (PHEVs), declined by 26.9% compared to October 2024, with 91,067 units sold (74,897 BEVs and 16,170 PHEVs). This represented 7.16% of total light-duty vehicle (LDV) sales for the month, a notable drop from September 2025 when PEVs captured 13.55% of sales, boosted by the expiration of the U.S. EV tax credit. Despite the October decline, full electric vehicles still accounted for about 6% of all U.S. vehicle sales, indicating a resilient market. For the full year 2024, over 1.5 million PEVs were sold in the U.S., marking a 7% increase from 2023, with BEVs comprising 80%
energyelectric-vehiclesBEVsPHEVsUS-vehicle-salesplug-in-hybridsclean-technologyEuropean EV Sales — Forecasts for 2026 & 2030 - CleanTechnica
The article from CleanTechnica centers on a detailed discussion and forecast of electric vehicle (EV) sales in Europe for the years 2026 and 2030. Following a prior analysis of China’s EV market, the conversation—featuring CleanTechnica contributors including Zachary Shahan—focuses on expectations for the European EV market’s growth and market share in the coming years. While the article itself primarily promotes the video discussion and related content, it invites readers to consider and share their perspectives on the projected EV adoption rates in Europe by those target years. Additionally, the piece highlights CleanTechnica’s broader efforts to provide in-depth analyses and summaries on clean technology topics through various subscription options, newsletters, and podcasts. Zachary Shahan, the site’s director and chief editor, is noted for his expertise and extensive experience in electric vehicles and renewable energy, underscoring the credibility behind the forecasts and discussions presented. However, the article does not provide specific numerical forecasts or detailed data within the text
energyelectric-vehiclesEV-salesrenewable-energyEuropean-marketclean-technologyenergy-storageNew pressure method captures 99% of CO2 for just $26 per ton
Researchers at Texas A&M University and ExcelThermic Enterprises have developed a novel carbon-capture technology called Pressure Induced Carbon Capture (PICC), which uses only water and pressure to extract carbon dioxide (CO2) from industrial flue gases. Inspired by the physical principle behind carbonation in soda and sparkling drinks, PICC dissolves CO2 in water under high pressure and releases it when pressure is reduced. This physical absorption method avoids the drawbacks of traditional amine-based chemical capture systems, such as high costs, chemical degradation, and limited capture efficiency (typically around 90%). The PICC process involves cooling and compressing flue gas, which then contacts cold water in an absorption column to dissolve nearly all CO2 before the cleaned gas is released. The CO2-rich water is subsequently depressurized in stages to release and compress the captured CO2 for underground storage. Economic modeling indicates that PICC can capture 99% of CO2 emissions at a cost of $26 per metric ton, significantly lower
energycarbon-capturecarbon-dioxidedecarbonizationindustrial-emissionspressure-induced-carbon-captureclean-technologyBYD ATTO 1 & ATTO 2 Bring EV Price Parity to Australia! - CleanTechnica
BYD has launched two electric vehicles (EVs) in Australia—the ATTO 1 (also known as Seagull/Dolphin Mini) starting at AUD 23,990 (approximately USD 15,661) and the ATTO 2 (also known as Yuan Up/Yuan Pro) starting at AUD 31,990 (around USD 20,884). When including on-the-road costs such as taxes and fees, the ATTO 1 is priced at AUD 26,532, which is still significantly cheaper than comparable hybrid electric vehicles (HEVs) and internal combustion engine (ICE) cars like the Mazda 2. Similarly, the ATTO 2’s total cost of AUD 34,772 remains below or comparable to similar HEVs and ICE SUVs. These BYD models also come better equipped, effectively eliminating the traditional price advantage of legacy ICE vehicles in the Australian market. This pricing strategy marks a significant milestone in EV affordability, as it brings EV prices to parity
energyelectric-vehiclesBYDEV-price-parityclean-technologyautomotive-industrysustainable-transportationChina EV Sales — Forecasts for 2026 & 2030 - CleanTechnica
The article from CleanTechnica discusses forecasts for electric vehicle (EV) sales in China, focusing on projections for 2026 and 2030. It highlights a detailed discussion involving experts analyzing the Chinese EV market, government policies supporting EV adoption, and expectations for the EV share within the overall Chinese automotive market in the coming years. The conversation encourages readers to engage by sharing their own predictions about the future EV market share in China. While the article primarily promotes the discussion and related CleanTechnica content, it underscores China’s significant role in the global EV landscape and the importance of policy frameworks in driving EV growth. However, the article does not provide specific numerical forecasts or detailed data points within the text itself, instead directing readers to watch the discussion or subscribe for in-depth analyses. Overall, it emphasizes ongoing interest and expert engagement in understanding China’s EV market trajectory through 2026 and 2030.
energyelectric-vehiclesEV-marketChinarenewable-energyenergy-storageclean-technologyChina Is Changing The Global Balance Of Political Power With Renewables - CleanTechnica
The article discusses the evolving global political and economic landscape shaped by the rise of renewable energy, with a particular focus on China’s growing influence. It reflects on the 2015 Paris Agreement, which marked a hopeful moment when wealthy nations pledged to help poorer countries reduce greenhouse gas emissions through investments in clean energy. Despite significant investments—over a trillion dollars in clean energy and low-carbon technologies in the past decade—progress has been uneven. Many poorer nations are frustrated by the lack of promised funding, while wealthy countries have backtracked on commitments due to geopolitical tensions, the COVID-19 pandemic, and resistance from the fossil fuel industry. Consequently, global temperature rise is still projected to be between 2.5 to 2.9 degrees Celsius by century’s end, leading to severe climate impacts. A key takeaway is the shifting dynamic in renewable energy leadership. While the global north struggles with commitment and implementation, many fast-growing economies in the global south—such as Brazil, India, Vietnam, Ethiopia, Nepal
energyrenewable-energyclimate-changecarbon-emissionsclean-technologyglobal-warmingParis-AgreementFossil-Fueled Vehicle Sales Actually Grew in USA in 3rd Quarter - CleanTechnica
The article from CleanTechnica highlights a surprising trend in the U.S. automotive market during the third quarter (Q3) of 2025: despite record-high electric vehicle (EV) sales reaching over 10% of total vehicle sales (10.6%), sales of fossil-fueled vehicles also increased, marking the highest Q3 sales for gas-powered cars in several years. Specifically, fossil-fueled vehicle sales in Q3 2025 totaled approximately 3.71 million units, which, while lower than the 4.28 million sold in Q3 2019, still represent a notable rise compared to recent years like Q3 2021. This indicates that although EV adoption is growing, it has not yet significantly curtailed the demand for traditional internal combustion engine vehicles. The article underscores the core mission of CleanTechnica—to replace fossil-fueled technologies with zero-emission alternatives to combat climate change—and points out that the simultaneous growth in both EV and fossil-fue
energyelectric-vehiclesfossil-fuelsclean-technologyrenewable-energyvehicle-salesemissions-reductionHydrogen, Measured Properly: What 2,000 Projects Reveal About Its Climate Value - CleanTechnica
A comprehensive study published in Nature Energy by Terlouw et al analyzed around 2,000 hydrogen projects over 20 years, providing a rare life-cycle assessment of hydrogen’s climate impact. The study found that if all these projects were realized, hydrogen production would reach about 110 million tons annually, generating roughly 0.4 gigatons of emissions and offsetting between 0.2 and 1.1 gigatons of CO2. However, when compared to a future scenario focused on electrification, hydrogen’s climate benefits shrink by over 80%. The researchers conclude that hydrogen’s best use is replacing existing “dirty” hydrogen in industrial sectors like fertilizer, refining, and methanol production, rather than expanding into new applications where electrification is more efficient. The study highlights steel, biofuels, and ammonia as sectors where hydrogen offers the most significant climate returns, due to its unique role in chemical processes that electricity alone cannot replace. Yet even in steelmaking, hydrogen-based direct
energyhydrogenclimate-changerenewable-energyindustrial-applicationsemissionsclean-technologyUS Auto Sales Highest In Years in 3rd Quarter — Charts - CleanTechnica
The US auto industry experienced its strongest third quarter in several years, with overall sales rising 5% in Q3 2025 compared to Q3 2024, and showing significant growth of 21% over Q3 2022 and 2021. While electric vehicle (EV) sales benefited notably from the expiration of the US EV tax credit, the growth was not limited to EVs alone. Among brands, Toyota led in volume increases, while Chrysler and Lucid showed the highest percentage growth. Conversely, Subaru, Mitsubishi, and Mercedes saw declines, and Dodge and Ram struggled. Ford and Hyundai also stood out for volume growth compared to Q3 2023, with smaller brands like Fiat, Jaguar Land Rover, and Lucid leading in percentage gains. Tesla, despite being the 8th best-selling brand overall, ranked 10th in percentage growth and benefited disproportionately from the EV tax credit expiration, which inflated its Q3 2025 sales figures. This suggests that Tesla and
energyelectric-vehiclesUS-auto-salesEV-tax-creditclean-technologyautomotive-industryTesla$10 Trillion Invested In Clean Tech Since Paris Agreements - CleanTechnica
Since the Paris climate agreements, global investment in clean technologies has reached $10.3 trillion, with annual energy transition investments surpassing $2 trillion in 2024—more than double the amount in 2020, according to BloombergNEF. This surge in funding has driven significant advances in renewable energy, particularly solar and wind, which are beginning to meet accelerating electricity demand. Analysis suggests that emissions from the energy sector, the largest contributor to global warming, may have peaked last year and could already be in decline. Road transport emissions are also projected to peak by 2029, aided by the expected rise of electrified vehicle sales to 25% worldwide. China, responsible for nearly a third of global emissions, may see a reduction in emissions growth this year, signaling a potential turning point. Despite these positive trends, the latest UNEP report indicates that current national commitments and policies still project global warming of 2.3-2.5°C this century, an improvement from previous estimates but
energyclean-technologyrenewable-energyclimate-changeParis-Agreementenergy-transitionemissions-reductionBudget 2025 has the right signals on the importance of the clean economy but fails to connect its benefits to everyday Canadians - Clean Energy Canada
Clean Energy Canada’s executive director Rachel Doran responded to Canada’s Budget 2025 by acknowledging its positive signals toward supporting the clean economy and low-carbon industries as key drivers of the country’s economic future and international competitiveness. The budget emphasizes regulatory certainty, private capital mobilization, and incentives for clean technologies, including strengthened industrial carbon pricing and maintained Clean Electricity Regulations. Notably, the introduction of the Critical Minerals Sovereign Fund aims to secure supply chains vital for clean technologies and energy security, positioning Canada strategically in global trade. However, Doran criticizes the budget for failing to directly connect the clean economy’s benefits to everyday Canadians. She highlights the termination of programs like the Greener Homes Grant and Loan, uncertainty around the EV Availability Standard, and the lack of renewed federal EV rebates, which could reduce affordability for households facing fossil fuel price volatility. She calls for improved market conditions through competition and tariff adjustments to enhance EV accessibility. Additionally, the budget lacks ambitious nation-building efforts to expand clean electricity infrastructure,
energyclean-energyclean-economycarbon-pricingcritical-mineralsclean-technologyrenewable-energyPolicy Moving Forward: Reversing Protectionism Targeting Cleantech - CleanTechnica
The article from CleanTechnica critiques the protectionist trade policies targeting cleantech in the United States, emphasizing the negative economic and environmental consequences of tariffs on renewable energy technologies. It highlights how tariffs increase the cost of cleantech products like solar panels and electric vehicles (EVs), making them significantly more expensive in the U.S. compared to countries like China. Despite subsidies such as those in the Inflation Reduction Act, these measures only partially offset the higher prices, which in turn slows adoption of clean technologies, prolongs reliance on fossil fuels, and undermines long-term environmental and economic benefits. Politically, the article points out that both President Biden and former President Trump have pursued notably protectionist policies, with Biden being the most protectionist Democratic president in modern history. This protectionism is framed as a simplistic "us vs. them" approach that ignores the benefits of international trade and value exchange. The article warns that such policies echo the mistakes of Herbert Hoover’s era, which worsened the Great
energycleantechrenewable-energytariffssolar-panelselectric-vehiclesclean-technologyBYD BEV Sales Up 34.5% In October - CleanTechnica
In October 2024, BYD experienced mixed results in vehicle sales. Its full battery electric vehicle (BEV) sales increased significantly by 34.5% year-over-year, highlighting strong growth in the pure electric segment. However, plugin hybrid electric vehicle (PHEV) sales declined sharply by 31% compared to the previous year. Overall, combined plugin passenger vehicle sales for BYD fell by 12.7% in October 2024. Looking at the broader picture from January to October 2024, BYD’s plugin vehicle sales showed a positive trend with a 12.9% increase year-over-year. BEV sales maintained the strong 34.5% growth, while PHEV sales saw a smaller decline of 2.7%. Despite the recent drop in PHEV sales, BYD remains the global leader in the electric vehicle market, having surpassed Tesla in sales. The company continues to expand its BEV market share, effectively competing against itself as
energyelectric-vehiclesbattery-electric-vehiclesBEV-salesrenewable-energyelectric-mobilityclean-technology30 actions that should underpin Carney’s climate competitive vision: One Canadian Clean Economy Task Force - Clean Energy Canada
The One Canadian Clean Economy Task Force, supported by Clean Energy Canada, has released the North Star Action Plan outlining 30 key recommendations to support Canada’s climate competitiveness strategy ahead of a major federal budget announcement. The task force comprises leaders from sectors including critical minerals, batteries, clean transportation, energy efficiency, and clean technology. Their core belief is that Canada can protect its economy from current trade and tariff challenges while positioning itself to gain significant economic benefits from the global energy transition. The plan focuses on addressing government priorities such as selecting strategic national projects, reducing internal trade barriers, advancing Indigenous reconciliation, and enhancing climate competitiveness. Key challenges identified include lengthy and complex regulatory approval processes with overlapping jurisdictions, barriers to workforce development due to inconsistent training standards, and a lack of coordinated electricity planning leading to reliance on U.S. power. The task force recommends streamlining regulatory processes with earlier Indigenous engagement, prioritizing clean economy trades in labor mobility, investing in workforce reskilling, and launching a “United Canada” grid initiative
energyclean-energyclimate-competitivenessclean-economyrenewable-energyenergy-transitionclean-technologyNIO Scores Record Deliveries, Up 93% - CleanTechnica
NIO achieved a new record for monthly vehicle deliveries in October 2025, delivering 40,397 vehicles, which represents a 92.6% increase compared to October 2024. This surpassed their previous record set in September 2025. The deliveries were distributed among three brands: NIO with 17,143 units, ONVO with 17,342 units (marking the first time ONVO outsold the NIO brand), and Firefly with 5,912 units. Cumulatively, NIO is approaching a major milestone of 1 million total vehicle deliveries, currently standing at 913,182 units. The breakdown of cumulative sales by brand is 779,319 for NIO, 107,621 for ONVO, and 26,242 for Firefly. The ONVO brand’s rapid growth is notable, having already surpassed 100,000 cumulative deliveries. Despite past fluctuations, NIO is on a strong upward trajectory, with anticipation around whether
energyelectric-vehiclesNIOrenewable-energyvehicle-deliveriesclean-technologyenergy-storageCarlos Tavares Thinks Tesla Might Be Dead In 10 Years - CleanTechnica
Carlos Tavares, former CEO of Stellantis, made a provocative statement in an interview suggesting that Tesla might not exist in 10 years. Despite Tesla’s current strong financial position—with over $40 billion in cash, consistent profitability, and recent quarterly revenues of $28.1 billion—Tavares expressed skepticism about Tesla’s long-term viability. He pointed to the rapid growth and efficiency of China’s EV market, particularly highlighting competitors like BYD, and speculated that Elon Musk might shift his focus away from Tesla toward other ventures such as humanoid robots, SpaceX, or artificial intelligence. Tavares also criticized Tesla’s high stock valuation as unsustainable. This perspective is notable coming from a seasoned automotive industry leader who ran a major global car company. While some may dismiss his remarks as controversial or motivated by personal circumstances, Tavares appears to be seriously considering the challenges Tesla faces, including the risk of heavy spending combined with potential sales declines. The article concludes that Tesla remains financially robust
energyelectric-vehiclesTeslaautomotive-industryclean-technologyElon-Muskelectric-mobilityDiscussing Tesla's Unboxed Manufacturing & The Future Of The Company - CleanTechnica
The article from CleanTechnica centers on a 47-minute discussion among four of the site’s writers about Tesla’s manufacturing approach, company management, current priorities, and its strategic direction. The conversation explores Tesla’s “Unboxed Manufacturing” concept and whether the company is entering another critical, high-stakes phase in its development. While the article itself primarily serves as an introduction to the recorded chat, it highlights the significance of Tesla’s evolving operational strategies and the broader implications for the company’s future. Additionally, the piece encourages readers to engage with CleanTechnica’s content through subscriptions, newsletters, and podcasts for more in-depth analyses. Zachary Shahan, the site’s director and chief editor, is noted as a leading expert on electric vehicles and renewable energy, underscoring the credibility behind the discussion. However, the article does not provide detailed insights or conclusions from the conversation itself, focusing instead on promoting the discussion and CleanTechnica’s related offerings.
energyelectric-vehiclesrenewable-energyenergy-storageTeslaclean-technologymanufacturingTurning waste to power: Nissan and Lithion redefine EV battery recycling in Canada
Nissan Canada has partnered with Montreal-based clean tech company Lithion Technologies to launch an advanced EV battery recycling initiative aimed at recovering and repurposing valuable materials from end-of-life electric vehicle batteries. Lithion’s patented hydrometallurgical process uses a water-based, closed-loop system to efficiently extract up to 95% of battery materials and 98% of critical minerals such as lithium, nickel, cobalt, and graphite. This method contrasts with traditional pyrometallurgical techniques by significantly reducing greenhouse gas emissions and battery waste, thereby supporting a more sustainable and circular economy for EV batteries. The initiative leverages Lithion’s commercial recycling facility in Saint-Bruno, Quebec, and builds on Lithion’s prior collaboration with Hyundai Auto Canada. By localizing battery recycling, Nissan aims to reduce dependence on raw material mining, lower production emissions, and strengthen Canada’s clean technology sector. This partnership aligns with Nissan’s broader sustainability goals to close the loop on battery use, responsibly manage end-of-life batteries
energymaterialselectric-vehiclesbattery-recyclinglithium-ion-batteriesclean-technologysustainabilityAl Gore Nails It Again — This Is Where We Are - CleanTechnica
In a recent StrictlyVC Download podcast, Al Gore emphasized both optimism and concern regarding the global energy transition and climate crisis. He highlighted the steady and accelerating progress of clean technologies, which are becoming cheaper, more effective, and increasingly competitive against fossil fuels. Gore asserted that the transition away from fossil fuels is unstoppable, driven by favorable technology, economics, deployment models, and public opinion. However, he cautioned that the critical question remains whether this transition will happen quickly enough to avoid severe climate tipping points, citing a recent alarming report about the absence of the Humboldt Current upwelling, which is vital to marine ecosystems. Gore referenced Dornbusch’s Law, which suggests that change often takes longer than expected initially but then happens rapidly once a tipping point is reached. He believes we have now crossed that point with clean technology, though acceleration is still needed to outpace the worsening effects of climate change. The article underscores that while the clean energy revolution is well underway and irreversible, the race against time
energyclean-technologyrenewable-energyfossil-fuel-transitionclimate-changebattery-technologyelectricity-generationBMW iX3 Demand Higher Than Expected, Volkswagen ID Buzz Demand & Production Dropping - CleanTechnica
The BMW iX3 has experienced higher-than-expected demand since its launch at the IAA on September 8, with over 3,000 orders placed within six weeks. Christian Ach, head of BMW Group Germany, noted that demand for the iX3 surpasses that of the fossil-fuel-powered X3, marking a positive shift toward electric vehicles for the brand. The iX3 is the first model built on BMW’s Neue Klasse platform, with production at the new Debrecen plant in Hungary. Deliveries are expected to begin in Germany by the end of 2025, with broader availability across Europe by early 2026. BMW also aims to become the leader in the premium EV segment in China with this model. In contrast, Volkswagen is facing challenges with its ID Buzz electric minivan. Due to slowing demand, changing market conditions, and intense competition, Volkswagen paused production of the ID Buzz and its Multivan variant in Hanover, Germany, from October 20 to
energyelectric-vehiclesBMW-iX3Volkswagen-ID-BuzzEV-productionautomotive-industryclean-technologyChina’s Clean Technology Recommendations for Their Next 5-Year Plan - CleanTechnica
The article discusses the recent recommendations made by the Central Committee of the Communist Party of China for the country’s 15th Five-Year Plan, which will guide development through 2030. A key focus of these recommendations is on advancing China’s clean technology and modernizing its industrial system. China aims to maintain a strong manufacturing base while upgrading traditional industries and fostering emerging sectors, all with an emphasis on smart, green, and integrated development. The plan highlights the importance of balancing economic growth with environmental sustainability, reinforcing the “real economy” by producing tangible goods and services rather than relying on financial mechanisms. Additionally, the recommendations emphasize achieving greater self-reliance and strength in science and technology. China seeks to leverage the ongoing technological revolution to boost innovation capacity, promote original breakthroughs in core technologies, and integrate education, science, and talent development. The Digital China Initiative is a key part of this strategy. Importantly, despite a strong focus on domestic innovation, the plan also calls for high-standard opening up to
energyclean-technologyrenewable-energymanufacturingindustrial-modernizationinnovationgreen-developmentThis Is How Far Tesla Is Behind Its 2020s Growth Target - CleanTechnica
The article from CleanTechnica analyzes Tesla's progress relative to its ambitious goal of growing vehicle sales by 50% annually throughout the 2020s, a target frequently cited by Elon Musk in previous years. However, Musk has recently shifted the company's narrative away from this specific growth metric toward positioning Tesla more as a robotics and AI company. The author notes that despite the hype, no one has closely examined Tesla’s actual sales figures against the 50% compound annual growth rate (CAGR) target. By comparing Tesla’s vehicle deliveries over the first nine months of various starting years—2019, 2020, and 2021—with the expected sales if the 50% CAGR had been met, the article finds Tesla significantly behind its growth target. For example, starting from 2019 deliveries, Tesla should have sold about 2.9 million vehicles by the first nine months of 2025 but has only sold approximately 1.2 million, falling short by about 1.
energyTeslaelectric-vehiclesgrowth-targetsclean-technologyautomotive-industrysustainable-energyFastest Bullet Train in the World in Track Trials Now in China - CleanTechnica
China is currently testing the CR450, touted as the world’s fastest electric multiple unit (EMU) bullet train, on the Shanghai–Chongqing–Chengdu high-speed rail line. The train has achieved a top speed of 450 km/h (280 mph) during rigorous testing since its prototype launch late last year. Before entering commercial service, it must complete 600,000 kilometers of successful operation. The CR450 surpasses previous high-speed trains through advanced aerodynamic and structural improvements, including a lengthened 15-meter nose cone to reduce drag, fully enclosed bogies, lowered skirt panels, a 20-centimeter reduction in height, and a 50-tonne weight reduction, collectively cutting overall resistance by 22%. In addition to its top speed, the CR450 boasts rapid acceleration, reaching 350 km/h in just 4 minutes and 40 seconds. This development highlights China’s continued leadership in cleantech and high-speed rail innovation, contrasting with slower progress in countries like
energyhigh-speed-trainsaerodynamicsstructural-materialselectric-multiple-unittransportation-technologyclean-technologyHyundai's $11,000 Retail Cash Bonus for IONIQ 5 Expires in Two Weeks - CleanTechnica
Hyundai Motor America has announced a significant retail cash bonus of up to $11,000 on the IONIQ 5 electric vehicle, which is available until November 3, 2025. This incentive follows the end of the US federal EV tax credit for Hyundai and is part of the company’s broader strategy to make the 2026 IONIQ 5 lineup more accessible and competitive. Alongside this bonus, Hyundai has implemented price reductions ranging from $7,600 to $9,800 on the 2026 models compared to the 2025 versions, aiming to align with current market conditions and support increased US production. The article emphasizes that while the $11,000 cash incentive is a compelling deal, actual purchase prices can vary significantly depending on dealer pricing strategies and market demand. Buyers are encouraged to act quickly to take advantage of the offer before it expires, but the post-November 3 pricing landscape remains uncertain. Negotiation skills and market timing can also influence the final price
energyelectric-vehiclesHyundai-IONIQ-5EV-marketclean-technologyautomotive-incentiveselectric-mobilityFastned Keeps Redefining What A Charging Station Can Look Like - CleanTechnica
Fastned has consistently pushed the boundaries of what an electric vehicle charging station can be, evolving from simple, single chargers placed inconveniently to large, highly visible, and user-friendly stations. Over its first five years, Fastned’s design progressed from an iconic wave form to a flexible tree canopy structure adaptable to various station sizes. Recently, Fastned unveiled a new station concept that includes not only charging facilities but also a convenience store and rest area, signaling a shift toward offering more comprehensive services beyond just electricity. The latest innovation from Fastned is the development of the first indoor charging station, planned for Aberdeen, Scotland. This indoor facility addresses the challenges of harsh weather conditions common in the region, such as cold, wet, and windy environments, by providing a sheltered space for customers. The design includes a charging hall and rest area, enhancing user comfort and convenience. This novel approach is expected to inspire other Scottish cities like Glasgow and Edinburgh to follow suit, potentially sparking a regional competition to adopt similar infrastructure
energyelectric-vehicle-chargingFastnedcharging-stationsrenewable-energysustainable-transportationclean-technologyThe First Song Ever Written About A Water Heater - CleanTechnica
The article from CleanTechnica highlights the release of the first-ever song about a heat pump water heater (HPWH), timed with HPWH Day, an initiative aimed at raising awareness about this energy-efficient technology. The song and its accompanying music video creatively promote the benefits of switching to HPWHs, such as significant energy and cost savings—specifically, an estimated $500 annual savings on electric bills for a family of four according to ENERGY STAR. The video visually emphasizes these savings by depicting money raining from the sky. Beyond cost savings, the article underscores the environmental advantages of HPWHs, which reduce carbon dioxide emissions by about one ton per year compared to fossil fuel water heaters and help prevent local air pollution from nitrogen oxides and particulates. The music video also features people dressed in heat pump water heater costumes, adding a fun and engaging element to the campaign. The article encourages readers to participate in HPWH Week events and stay informed through CleanTechnica’s newsletters and podcasts.
energyheat-pump-water-heaterenergy-efficiencyCO2-emissions-reductionpollution-controlENERGY-STARclean-technologyAltitude Finances +120,000t CORCs From Biochar CDR Facilities In West Africa - CleanTechnica
Altitude, a carbon removal financier, has committed to purchasing over 120,000 tons of carbon removal credits (CORCs) from biochar-based carbon dioxide removal (CDR) facilities in West Africa. This move highlights Altitude’s strategy to scale durable carbon removal globally, particularly in developing regions with abundant biomass feedstock and significant local benefits such as soil enhancement, waste reduction, and job creation. All projects involved are verified under Puro.earth, a leading registry for engineered carbon removals, signaling strong market confidence in the bankability of long-term carbon removal investments. Biochar CDR technology locks carbon into a stable, solid form, and West Africa’s agricultural and forestry residues, available land, and demand for sustainable soil amendments make it an ideal location for these projects. Altitude’s +120,000-ton financing represents a shift from one-off carbon removal purchases to multi-year, standardized, investment-grade agreements, reflecting maturation in the carbon removal market. With 200,000 tons of carbon
energycarbon-removalbiocharclimate-financesustainable-agriculturecarbon-dioxide-removalclean-technologyThe Cleantech Revolution Will Not Be Led By Petrostates - CleanTechnica
The article from CleanTechnica argues that the global cleantech revolution will not be led by petrostates—countries whose economies are heavily dependent on oil and gas revenues—due to entrenched fossil fuel interests and political influence. While the U.S. has contributed significant early innovations in solar cells, batteries, and electric vehicles (EVs), its progress is often undermined by powerful fossil fuel lobbying and political shifts, particularly from the fossil-fuel-aligned Republican Party. As a result, EV adoption in the U.S. remains below 10%, and clean energy progress is frequently stalled or reversed. In contrast, China and Europe, which are not dominated by oil and gas industries, have been able to accelerate their leadership in cleantech, especially in EV development. The article highlights that petrostates like Russia and Saudi Arabia use their influence to delay global climate initiatives, such as the recent postponement of the International Maritime Organization’s Net-Zero Framework vote, driven by pressure from the U
energycleantechrenewable-energyelectric-vehiclesenergy-transitionfossil-fuelsclean-technologyTesla's Mission Has Been Completely Assaulted By Current US Policy - CleanTechnica
The article from CleanTechnica discusses how Tesla’s original mission—to accelerate the transition to electric vehicles (EVs) and sustainable energy—has been severely undermined by current U.S. policies, particularly under the Trump administration. Initially, Tesla aimed to push the auto industry toward electrification and later expanded its mission to include solar energy after acquiring SolarCity. However, political shifts and Elon Musk’s involvement in supporting Donald Trump, whose administration and Republican allies have largely opposed renewable energy initiatives, have coincided with a significant rollback of clean energy progress in the U.S. The article highlights numerous setbacks: automakers have scaled back EV production plans; major solar projects like Esmeralda 7 have been stalled by regulatory red tape; offshore wind projects have been delayed despite prior approvals and investments; and the U.S. government has retreated from clean energy and climate goals. These actions contrast sharply with the administration’s support for fossil fuel industries, which face fewer regulatory hurdles. The cumulative effect is described as a
energyrenewable-energyelectric-vehiclesTeslasolar-powerclean-technologyenergy-policyGood News, Bad News As Rondo Energy 100 MWh Heat Storage Facility Goes Live - CleanTechnica
Rondo Energy has developed a heat storage technology that uses electricity—preferably from renewable sources—to heat fire bricks to temperatures above 1500ºC. This system converts electrical energy into heat at 100% efficiency and delivers precisely controlled, high-temperature heat for industrial processes, such as dairy production and cement manufacturing, which traditionally rely on fossil fuels. The heat battery integrates easily into existing infrastructure as a zero-emission boiler replacement, recycling air to minimize heat loss and maximize efficiency. The first 100 MWh Rondo Energy system is now operational in Kern County, California, powered by a 20 MW solar installation. However, the heat generated is being used by Holmes Western Oil for enhanced oil recovery, which has drawn criticism from environmentalists who argue that using clean technology to support fossil fuel production prolongs carbon emissions. Supporters, including Energy Impact Partners and Rondo’s founder John O’Donnell, contend that this partnership is a pragmatic step toward decarbonization, reducing Holmes’ carbon footprint
energyrenewable-energyheat-storagedecarbonizationindustrial-heatclean-technologyenergy-efficiency'World's largest' industrial heat battery runs purely on solar energy
Rondo Energy has launched what it calls the world’s largest industrial heat battery, a 100 MWh system now operational at a Holmes Western Oil facility in California. Powered entirely by an onsite solar array, the Rondo Heat Battery stores solar energy during the day and delivers continuous high-temperature heat (above 1,000 °C or 1,832 °F) around the clock, replacing natural gas in industrial processes. Over a 10-week test, it achieved over 97% round-trip efficiency and produces as much heat as 10,000 household heating systems. The system integrates seamlessly with existing gas-fired boilers and steam infrastructure without requiring modifications, enabling industries to reduce carbon emissions and exposure to volatile energy costs. The technology relies on simple, widely available materials—bricks and wires—to store thermal energy, avoiding rare minerals, fire risks, and toxic leaks common in other energy storage methods. It charges for about six hours daily using low-cost or off-grid solar power and then supplies continuous heat
energyrenewable-energyindustrial-heat-batterysolar-powerdecarbonizationthermal-energy-storageclean-technologyNew task force of clean industry associations launches with a vision of Canada as a clean energy superpower - Clean Energy Canada
The One Canadian Clean Economy Task Force, a coalition of clean economy industry associations and organizations, has officially launched in Toronto with a vision to position Canada as a clean energy superpower. Representing sectors such as critical minerals, batteries, clean transportation, clean buildings, forest products, clean electricity, and clean technology, the task force aims to unify efforts toward building a competitive and sustainable Canadian economy. Their forthcoming action plan, due this fall, will focus on policy alignment, infrastructure development, and boosting demand and investment to support the clean economy. The task force emphasizes that as Canada’s major trade partners advance their own clean economies with net-zero commitments and carbon pricing, Canada must prioritize clean economic growth to remain competitive globally. Key voices from the task force highlight the importance of strategic actions such as workforce development, infrastructure support, and labor mobility to overcome current challenges like labor shortages in clean energy sectors. Sean DeVries of the Battery Metals Association stresses the battery industry’s potential as a cornerstone of Canada’s clean economy
clean-energybatteriesclean-technologyenergy-investmentdecarbonizationclean-economyinfrastructureSlash Energy Consumption Costs with Exhale Fans - CleanTechnica
The article from CleanTechnica highlights an innovative energy-efficient HVAC solution developed by Exhale Fans, led by CEO and Founder Richard Halsall. Exhale Fans has created a bladeless ceiling fan that uses a unique vortex effect to draw air from below and circulate it evenly in a 360-degree pattern throughout indoor spaces. Unlike traditional ceiling fans that push air straight down, this design provides a smooth, whisper-quiet breeze that reaches every corner of a room, enhancing comfort while reducing energy consumption. This technology is applicable across various environments including offices, hotels, airports, data centers, restaurants, schools, and homes, aiming to support year-round comfort with a modern, discreet aesthetic. The article also references a detailed discussion on CleanTech Talk, where Halsall elaborates on the fan’s design and benefits. Overall, Exhale Fans represents a promising advancement in HVAC efficiency, offering a quieter, more energy-saving alternative to conventional ceiling fans.
energyenergy-efficiencyHVACbladeless-fanclean-technologysustainable-coolingindoor-air-circulationThe Pope Asks People To Be More Human - CleanTechnica
The article from CleanTechnica emphasizes the critical role of cleantech—technologies aimed at significantly reducing pollution and combating climate change—in addressing the escalating environmental crises caused by greenhouse gas emissions. It highlights the ongoing conflict between the urgent need to transition away from fossil fuels and the entrenched financial interests that resist this change. Many individuals and entities benefit economically from the fossil fuel industry and often reject or ignore scientific evidence about climate change, perpetuating misinformation and obstructing progress toward sustainable solutions. Additionally, the article discusses broader humanitarian concerns, focusing on Pope Leo XIV’s recent statements condemning inhumane treatment of immigrants and inconsistent “pro-life” stances that oppose abortion but support the death penalty or harsh immigration policies. The Pope’s message underscores the importance of genuine human compassion and challenges societal divisions rooted in race, language, and heritage. The article argues that immigration positively contributes to the U.S. economy, contrary to common misconceptions, and that economic inequality—exacerbated by billionaires and corporations
energyclean-technologyclimate-changepollution-reductionfossil-fuelsgreenhouse-gasesenvironmental-impactAs Renewables In China Surge, Some Questions Are Raised - CleanTechnica
China is rapidly expanding its renewable energy capacity, positioning itself as the global leader in clean energy generation and technology exports. President Xi Jinping recently announced plans to reduce greenhouse gas emissions and increase renewable energy production sixfold, highlighting China’s commitment despite being the world’s largest polluter. A key focus is the vast renewable energy development in Tibet’s Qinghai province, where a 162-square-mile solar park—the Talatan Solar Park—operates at high altitude, benefiting from clear air and cooler temperatures to maximize efficiency. This site, combined with nearby wind turbines and hydroelectric dams, produces a massive amount of clean energy, with solar output alone reaching 16,930 megawatts and continuing to grow. The renewable energy generated in western China supports the country’s extensive high-speed rail network and expanding electric vehicle fleet, while also powering manufacturing facilities that produce solar panels dominating global markets. Additionally, excess solar power is being used for pumped hydro storage projects, enhancing grid reliability. The availability of cheap, clean electricity
energyrenewable-energysolar-powerwind-energyhydropowerclean-technologyChina-energy-policyFrom Bike To Car & Back Again: The VIGOZ Is A New Kind Of Vehicle - CleanTechnica
The VIGOZ, developed by French company CIXI, is an innovative "active vehicle" that blends the benefits of bicycles and cars to create a new form of personal transportation. Designed to promote active mobility, it encourages riders to engage physically through a unique chainless pedaling system called PERS (Pedaling Energy Recovery System). This system electronically senses pedaling to provide propulsion, allowing users to control acceleration and deceleration smoothly without gears. The vehicle balances human effort with electric power, enhancing efficiency and extending range compared to typical electric cars. CIXI emphasizes that the VIGOZ is not just a machine but a philosophy aimed at making daily commutes healthier, more engaging, and sustainable without compromising comfort or speed. Manufactured in Haute-Savoie, France, near Annecy, the VIGOZ reflects a commitment to local craftsmanship and sustainability, with a design focused on longevity through replaceable parts and software updates. It offers real-world performance with a top speed of 120 km/h (
energysustainable-transportationelectric-vehicleactive-mobilitypedaling-energy-recovery-systemclean-technologypersonal-transportationEVs Take 35.5% Share Of The UK - BYD Atto 2 Launches - CleanTechnica
In September, plugin electric vehicles (EVs) captured a 35.5% share of the UK auto market, up from 29.4% the previous year. Battery electric vehicles (BEVs) accounted for 23.3% of sales, growing 29% year-on-year, while plug-in hybrids (PHEVs) reached 12.2%, up 56%. Overall vehicle sales rose 14% to 312,891 units. Tesla remained the leading BEV brand with 10.9% market share, followed by Ford at 9.1% and BYD at 7.5%. Ford notably overtook Volkswagen for second place in a Tesla-dominated month, and BYD achieved a record third place, supported by a diverse lineup including the popular Sealion model. The UK government’s reintroduction of BEV purchase incentives, despite initial implementation issues, appears to be boosting lower-priced EV sales within the new £42,000 price cap. This
energyelectric-vehiclesBEVPHEVUK-auto-marketclean-technologyautomotive-industryLeaked Car Industry Paper: Carmakers’ EU Demands Would Cut EV Sales In Half - CleanTechnica
A leaked position paper from the European car industry lobby ACEA reveals that carmakers are pushing for numerous loopholes in the EU’s car CO2 regulations, which aim to mandate only zero-emission vehicle (ZEV) sales by 2035. According to analysis by Transport & Environment (T&E), these demands would significantly weaken the EU’s climate ambitions, potentially halving the share of electric vehicle (EV) sales. Key loopholes include counting cars running on so-called carbon-neutral fuels (such as biofuels or e-fuels) as zero-emission, which alone could reduce EV sales by 25%. Additional demands include scrapping the 2027 utility factor adjustment for plug-in hybrids, granting CO2 credits for scrapping old cars, and credits for CO2 reductions in car production, cumulatively lowering the EV market share target to just 52% by 2035. T&E’s Lucien Mathieu criticized the ACEA’s position as undermining investment certainty and Europe’s competitiveness
energyelectric-vehiclesEU-regulationscarbon-emissionsautomotive-industryclimate-policyclean-technologyGazelle Launches Fall E-Bike Lineup Emphasizing Comfort - CleanTechnica
Gazelle has introduced its fall e-bike lineup focused on comfort and inclusivity, featuring three main models designed for different rider needs. The Easyflow C7 targets riders seeking maximum comfort and confidence, including shorter, older, or returning cyclists. It features an extra-wide low step-through frame, pedal-forward geometry allowing feet flat on the ground when stopped, 24-inch wheels, and an upright riding position for smooth, stable rides. The bike also includes an adjustable stem and integrated rearview mirror for added safety and comfort. The Arroyo C380 and C5 models continue Gazelle’s reputation for comfort, described as “sofa on wheels,” ideal for commuting, errands, or relaxed rides without strain. Both have Dutch-style step-through frames, wide tires, suspension seatposts, and upright postures to reduce wrist, shoulder, and back strain. The C5 offers a simple, low-maintenance internal gear hub with belt drive, while the C380 features a continuously variable hub for effortless shifting.
energye-bikeelectric-bikepersonal-transportationclean-technologysustainable-mobilityurban-commutingThe Global Floating Offshore Wind Industry Is Off To The Races
The global floating offshore wind industry is experiencing significant growth despite political challenges in the United States, particularly under the Trump administration, which has sought to hinder domestic wind and solar sectors. Floating offshore wind technology offers distinct advantages over conventional fixed-bottom turbines by enabling deployment in deeper waters where wind resources are stronger and more consistent. This expands potential offshore wind development areas, including regions previously unsuitable due to depth constraints. Innovations such as low-profile turbines also address visual impact concerns from coastal communities, enhancing the technology’s appeal. A notable recent development is Samsung Heavy Industries (SHI) receiving the Approval in Principle (AiP) from Lloyd’s Register for its SnapWind Float platform, announced at Gastech 2025 in Milan. This floating substructure is designed to unlock deeper water sites and accommodate higher-capacity turbines, optimized for areas with limited skilled labor, heavy lifting equipment, and workspace. Korean Register and Bureau Veritas have also endorsed the design, highlighting its cost competitiveness and suitability for next-generation 15MW
energyrenewable-energyoffshore-windfloating-wind-turbinesclean-technologySamsung-Heavy-Industrieswind-powerMore EV Charging Stations For The US, Despite The War On EVs
Despite the current US federal administration’s fossil-fuel-friendly stance and political turmoil likened to a modern-day Civil War, the expansion of electric vehicle (EV) infrastructure continues robustly across the country. The article highlights that, regardless of President Trump’s opposition to EVs, the US has been rapidly adding EV charging stations throughout 2025, signaling the resilience and growth of the EV movement. This expansion is notably driven by private sector stakeholders in travel plazas, quick-serve restaurants, and convenience stores. A key development discussed is the partnership between Sheetz, a fast-growing family-owned convenience retailer, and Vontier, a global mobility technology firm. Sheetz has already installed 125 EV charging stations via third-party providers, and through its collaboration with Vontier’s subsidiary Driivz, it plans to enhance its EV charging network with advanced software and energy management tools. This partnership aims to integrate EV charging seamlessly into the Sheetz customer experience, leveraging the Sheetz mobile app to provide
energyelectric-vehiclesEV-charging-stationsenergy-managementclean-technologyVontierDriivzChina's Cleantech Exports Overtake US Fossil Fuel Energy Dominance with Lasting Implications - CleanTechnica
The article discusses a significant shift in global energy trade dynamics, highlighting that China’s clean technology exports have surpassed the United States’ dominance in fossil fuel energy exports. This transition reflects a broader change in how energy is produced, consumed, and valued worldwide. Unlike fossil fuels, which are finite, consumable, and environmentally damaging, clean technologies such as solar panels, batteries, and electric vehicles (EVs) offer durable, recyclable, and technology-driven solutions. Solar panels, for example, provide many times the energy value of their initial cost over their lifespan, representing a long-term energy investment rather than a one-time consumable product like fossil fuels. China’s export growth in clean technology is primarily driven by batteries and EVs, which facilitate increased electrification and more efficient use of renewable energy. These technologies help stabilize the grid by balancing intermittent renewable energy supply with demand, reducing curtailment, and enabling further electrification. EVs also shift energy consumption away from petroleum, contributing to immediate emissions reductions and
energyclean-technologycleantech-exportssolar-energyrenewable-energyenergy-consumptionglobal-energy-tradeAI-Powered Robots Install Solar Panels Faster Than Any Humans - CleanTechnica
Luminous Robotics, a Boston-based company, is revolutionizing solar panel installation with its Lumi 4 autonomous robots, currently deployed at the Goorambat East solar farm in Australia. This 250 MW facility, set for completion in 2026, will feature nearly 600,000 solar panels, most installed by these robots. The Lumi 4 fleet has exceeded production targets by 103%, with potential capacity increases up to 246%, thanks to aggressive logistics, manufacturing, and field deployment efforts supported by the Australian Renewable Energy Agency (ARENA). The company plans to further enhance the robots’ autonomy, reliability, and efficiency to significantly improve large-scale solar energy infrastructure. The use of these robots reduces construction time and labor costs, making solar projects more financially viable and accelerating the transition from fossil fuels to renewable energy. ENGIE Australia’s project manager, Justin Webb, highlighted that the autonomous systems not only lower costs and build times but also upskill the renewable energy workforce by requiring skilled technicians to operate
robotssolar-energyrenewable-energyautonomous-systemsenergy-infrastructuresolar-panel-installationclean-technologyTop-like ocean wave energy tech gets USD 1.3 million funding push
Canadian cleantech company Voltai has secured over USD 1.3 million (CAD 1.83 million) in an oversubscribed pre-seed funding round led by Invest Nova Scotia and supported by angel investors, including Mahir Sahin. Voltai is developing an innovative, compact, top-like electrostatic wave energy converter that harnesses kinetic energy from ocean waves and ship movements to generate clean electricity. Unlike traditional bulky wave energy systems, Voltai’s device can be installed directly on vessels and offshore structures without causing drag or performance loss. The technology aims to provide continuous, maintenance-friendly onboard power, helping the maritime industry reduce fossil fuel dependence and lower CO2 emissions. The company is currently scaling its prototype from 25 watts to 100 watts, with plans to bundle ten units into a one-kilowatt system suitable for marine and mobile applications such as powering vessels, navigation systems, coastal infrastructure, and research stations. Voltai’s unique energy conversion mechanism promises efficient and cost-effective wave energy
energywave-energyrenewable-energyclean-technologymarine-energyenergy-conversionelectrostatic-generatorUp To 96 Fast-Charging EV Ports To Be Installed In Alberta & British Columbia - CleanTechnica
SureCharge Corp. is deploying between 21 and 24 new EV charging locations across Alberta and British Columbia in Phase One of a project supported by Canada’s NRCan ZEVIP program. These sites will collectively offer between 84 and 96 fast-charging ports using Wallbox’s Supernova 180 kW chargers, with the capability to scale up to 350 kW at high-demand locations in the future. Each site will have either 2 chargers (4 ports) or 4 chargers (8 ports), and all chargers will support CCS1 and NACS connectors, making them compatible with the majority of EVs, including Tesla vehicles. Older EVs requiring CHAdeMO connectors will not be supported at this stage. The new charging stations will be strategically located near amenities such as restaurants, gas stations, community centers, and visitor centers to provide drivers with convenient access to restrooms, food, and rest areas. The first four sites, including locations in Red Deer, Lacombe, E
energyelectric-vehiclesEV-chargingfast-chargingrenewable-energyclean-technologyinfrastructureAltitude Expands Ascent 1 Financing Facility To 250,000t Carbon Removals - CleanTechnica
Altitude has expanded its Ascent 1 financing facility for carbon dioxide removal (CDR) from an initial commitment of 50,000 tons to 250,000 tons of carbon removals. Launched earlier this year, Ascent 1 aims to provide structured, long-term financing for high-integrity removal projects, reflecting Altitude’s belief that the CDR market is ready for significant growth and requires larger-scale financial support. The expanded facility is designed to offer developers stronger demand signals, improve price stability, and facilitate the scaling of projects from mid-size to industrial levels. The program continues to prioritize durable removals verified through methodologies from partners such as Puro and other verification platforms, with a global reach that especially supports CDR facilities in the Global South. This scale-up highlights the increasing momentum behind engineered biomass-based carbon removal and acknowledges the challenges of delivering removals at commercial volumes. Altitude emphasizes the importance of rigorous measurement, permanence, and portfolio diversification as it deploys the expanded financing, contributing
energycarbon-removalclimate-financecarbon-dioxide-removalclean-technologysustainabilityenvironmental-financeWhy Fossil Fuels Are Having Such A Hard Time Competing With Renewables - CleanTechnica
The article from CleanTechnica outlines three key reasons why fossil fuels are struggling to compete with renewable energy sources. First, the extraction of fossil fuels is becoming increasingly difficult and costly as the easiest reserves have been depleted. New fossil fuel projects require advanced technology and higher investment to access challenging locations like deep offshore sites and the Arctic, driving up breakeven prices. Additionally, geopolitical uncertainties and inflation further increase costs, making fossil fuels less economically attractive. Second, the article highlights Wright’s Law, which explains why renewable energy technologies like wind, solar, and batteries see rapid cost declines as production scales up. Unlike fossil fuel production, which grows slowly, renewables benefit from faster cumulative production increases, leading to more significant price reductions over time. This dynamic gives renewables a competitive edge as their costs continue to fall more quickly than those of fossil fuels. Finally, public opposition to fossil fuels due to their environmental and health impacts creates strong political headwinds against their use. Growing awareness of pollution and climate change has
energyrenewable-energyfossil-fuelsWright's-lawoil-extractionenergy-transitionclean-technologyThe Automakers That Completely Dropped The Ball On End Of US EV Tax Credit - CleanTechnica
The article from CleanTechnica highlights a notable disparity in U.S. electric vehicle (EV) sales growth among automakers in the third quarter of 2025 compared to the same period in 2024. While some companies experienced significant EV sales increases, several major automakers saw declines, indicating missed opportunities amid favorable market conditions and the end of the U.S. EV tax credit. Specifically, models like the Acura ZDX, BMW iX, Lexus RZ, Nissan EV lineup (ARIYA and LEAF), Subaru Solterra, and Toyota BZ4X all reported year-over-year sales drops ranging from about 7.5% to as much as 61%. The article criticizes these automakers for failing to capitalize on the growing EV market and the momentum generated by positive industry headlines. It suggests that despite overall market growth, these companies either lacked effective strategies or execution to maintain or grow their EV sales during this critical period. The piece also notes that some companies have yet to report
electric-vehiclesEV-tax-creditautomotive-industryelectric-mobilityrenewable-energyclean-technologyenergy-policyUS Energy Storage Startup Makes Final Round Of Earthshot Prize
US energy storage startup Form Energy has been named a finalist in the prestigious Earthshot Prize, joining 14 other global innovators in the final round of the highly competitive program. Despite skepticism from some US officials about the existence and cost-effectiveness of energy storage, Form Energy’s iron-air battery technology has gained recognition for its potential to address long-duration energy storage challenges. The company’s battery can reportedly deliver electricity for up to 100 hours, significantly surpassing the typical four-hour duration of current lithium-ion batteries, which are mainly used for short-term peak demand management. Form Energy’s iron-air battery also offers advantages in supply chain resilience and fire safety, having passed the UL9540A safety standard at the cell level—a critical industry benchmark. The startup has attracted substantial investment, raising hundreds of millions of dollars across multiple funding rounds since its 2017 launch, and has secured contracts with utility partners. Its technology is based on the principle of reversible rusting, aiming to provide a more economical and scalable solution
energy-storageiron-air-batteryrenewable-energyclean-technologylong-duration-batteryenergy-innovationsustainable-energyRivian Sales Up 32% In 3rd Quarter, Revises 2025 Guidance Downward - CleanTechnica
Rivian reported a 31.8% year-over-year increase in vehicle sales for the third quarter, delivering 13,201 vehicles and producing 10,720, which met the company's targets and exceeded Wall Street analysts' expectations of 12,000 deliveries. Despite this growth, Rivian has revised its full-year 2025 delivery guidance downward to a range of 41,500 to 43,500 vehicles, narrowing from the previous forecast of 40,000 to 46,000 vehicles provided in July. This revision has negatively impacted investor sentiment, with Rivian's stock (NASDAQ: RIVN) dropping 13.11% over five days. Analysts have mixed views on Rivian's outlook, with expectations of a narrower loss per share (73 cents) compared to the previous year (97 cents) and anticipated sales growth of 70.8% to $1.492 billion in the third quarter. However, the market remains cautious, reflecting concerns about the
energyelectric-vehiclesRivianautomotive-industryclean-technologyrenewable-energyenergy-storageTesla Sales Record Not Nearly As Positive As It Seems - CleanTechnica
The article from CleanTechnica analyzes Tesla’s third-quarter sales performance, highlighting that despite headlines celebrating a record quarter, the results are less impressive upon closer examination. Tesla’s sales increased by only 7.4% year-over-year, a modest gain given the company’s already high sales base. Furthermore, the record delivery total of 497,099 vehicles barely surpassed the previous record of 495,570 set in Q4 2024, marking only a 0.3% increase. This marginal growth occurred despite a surge in US sales driven by buyers rushing to take advantage of the expiring US EV tax credit. The author expresses concern about Tesla’s growth trajectory, suggesting that the slight improvement in deliveries may not indicate strong future growth without a significant breakthrough. While some remain optimistic about Tesla’s prospects, the article implies that the company’s recent sales figures are more a cause for caution than celebration. The piece also notes the lack of regional sales data from Tesla, which limits a more detailed analysis
energyelectric-vehiclesTeslaEV-salesrenewable-energyenergy-storageclean-technologyClean Technology Innovation & Collaboration: Climate Week NYC Recap, Part 2.2 - CleanTechnica
The article recaps key clean technology innovations and collaborations showcased during Climate Week NYC, highlighting the convergence of global leaders, venture capitalists, engineers, and innovators focused on advancing sustainable solutions. A notable event was the 111th Hardware Meetup, which brought together creators of physical clean tech products, emphasizing the importance of connecting innovators with global manufacturing capabilities to accelerate prototype development and production. The event was hosted by Infinite Machine, a company specializing in electrified personal transportation, which unveiled its Olto vehicle designed for enhanced safety and compliance with bike lane regulations, priced at $3,495 with deliveries starting soon. Other highlighted innovations included Thea Energy’s novel approach to fusion energy, using an array of laptop-sized magnets controlled by software to create precise magnetic fields for plasma containment, aiming for net energy positive fusion in the coming years. Additionally, Atalanta Climate from Vancouver presented an indoor carbon capture system that converts CO2 into calcium carbonates, improving indoor air quality without significant energy loss, which is particularly relevant
clean-technologyenergy-innovationfusion-energyelectrified-transportatione-bikescarbon-captureclimate-technologyKia EV Sales In September Modest Despite EV Tax Credit Going Away, Down In 2025! - CleanTechnica
The article discusses the modest sales performance of Kia electric vehicles (EVs) in September 2025, despite the expiration of the US EV tax credit, which many expected would trigger a surge in EV purchases. While Kia’s EV6 and EV9 models saw some growth in September—31.3% and 47.6% increases respectively—the overall sales volumes remain low. More concerning is the significant decline in sales for these models over the first nine months of 2025 compared to the same period in 2024, with EV6 sales dropping from 15,985 to 11,077 and EV9 sales falling from 15,970 to 12,448. The article also highlights a similar downward trend for Nissan’s EVs, particularly the LEAF and ARIYA, which experienced substantial sales declines in the third quarter of 2025. The LEAF’s sales plummeted by 84% compared to the previous year’s third quarter, while ARIYA sales
energyelectric-vehiclesEV-salesKia-EVNissan-EVtax-creditclean-technologyChevrolet EV Sales Grew 86% in 3rd Quarter - CleanTechnica
In the third quarter of 2025, Chevrolet significantly increased its electric vehicle (EV) sales in the U.S., achieving 37,114 units sold, which represents an 86.2% rise compared to 19,933 units in the same period in 2024. This growth was driven largely by the Equinox EV, which saw a 156.7% increase in quarterly sales (from 9,772 to 25,085) and became the best-selling non-Tesla EV in the country. The Silverado EV also nearly doubled its sales year-over-year, reaching 3,940 units sold in Q3 2025 compared to 1,995 in Q3 2024. Meanwhile, the Bolt EV/EUV sales dwindled to zero, and the Blazer EV sales grew modestly by 1.1% in the quarter. Looking at the first nine months of 2025, Chevrolet’s EV sales continued to show strong growth: the Blazer
energyelectric-vehiclesChevroletEV-salesrenewable-energyautomotive-industryclean-technologyThe Cheapest Used Electric Cars I'm Finding - CleanTechnica
The article from CleanTechnica outlines a new, systematic approach to tracking the used electric vehicle (EV) market, focusing on identifying the cheapest used EVs available under specific criteria. The author, Zachary Shahan, aims to regularly update this data to monitor market changes over time. Key parameters for the search include excluding vehicles with accident history or over 50,000 miles, limiting models to those originally priced under $60,000 (potentially lowering to $50,000), excluding models released within the last two years (with some exceptions), and only considering cars less than ten years old. The search is geographically limited to within 100 miles of Southwest Florida. Initial findings highlight that certain models, such as the Volkswagen ID.4, are available used at significantly lower prices compared to new, possibly due to factors like sub-par infotainment systems. The author plans to share ongoing data via a Google Sheet and invites reader feedback on the methodology and findings. The article also notes that the last day
energyelectric-vehiclesused-carsEV-marketclean-technologytax-creditsustainable-transportationClimate Week NYC Recap Highlights, Part 1: Thinking Globally - CleanTechnica
The article provides a personal recap of Climate Week NYC, highlighting the vast scope of the event, which featured nearly a thousand official activities, making comprehensive coverage challenging. The author began with an international perspective by reflecting on experiences in Sweden, noting progress in mass transit and electric vehicles, though many buses and ferries still relied on biodiesel. This contrasted with the dominant role China now plays in clean technology development, raising questions about the competitiveness of European and US companies and the importance of international collaboration despite geopolitical tensions. Back in New York, the author observed a sense of discouragement among attendees due to the US political climate, particularly referencing former President Trump’s stance on climate change, which many feared could undermine global efforts. To reset this perspective, the author participated in a LEGO® Serious Play® workshop aimed at understanding and influencing stakeholders resistant to technological and trade disruptions, especially those tied to legacy industries. The workshop underscored the need for policies facilitating economic transition, retraining, and support to mitigate job losses
energyclean-energyclimate-changeelectric-vehiclesclean-technologysustainable-transportationinternational-collaborationGet an Electric Car for More Freedom! - CleanTechnica
The article from CleanTechnica argues that electric vehicles (EVs) offer greater freedom compared to gas-powered cars, challenging the common perception that traditional cars symbolize personal freedom. The key point is that gas cars create dependence on centralized oil companies and fuel stations, often linked to geopolitical and environmental issues, whereas EVs allow for more autonomy in energy sourcing. Electricity can be generated from a variety of decentralized and renewable sources, including personal solar power systems, reducing reliance on oil markets and increasing individual control over fuel costs and environmental impact. Additionally, the article highlights the financial benefits of EVs through personal anecdotes. One example contrasts the high daily cost and maintenance of a diesel van with the significantly lower and more predictable cost of charging an electric car, emphasizing how fuel and maintenance expenses for gas vehicles can limit personal financial freedom over time. The article also addresses common concerns about EV charging times and range anxiety, noting that charging an EV often takes less time overall than refueling a gasoline car, especially when charging at home
energyelectric-vehiclesrenewable-energysolar-powersustainable-transportationenergy-independenceclean-technology10 Quick Responses to Common Electric Car & Renewable Energy Myths - CleanTechnica
The article from CleanTechnica addresses and debunks ten common myths surrounding electric vehicles (EVs) and renewable energy technologies. It clarifies that EVs are not major fire risks compared to gasoline cars, and their batteries typically last 10 to 15 years rather than needing frequent costly replacements. Contrary to the belief that electric cars are prohibitively expensive, there are now many affordable models available, some priced well below the average new car cost in the U.S. EVs also offer greater convenience for most owners by enabling home charging and eliminating the need for gas station visits and routine maintenance like oil changes. Regarding renewable energy, the article highlights that solar and wind power are currently the cheapest sources for new electricity generation and dominate new power plant capacity worldwide. These clean technologies produce significantly less pollution than fossil fuel alternatives, despite requiring some resources for manufacturing. Solar and wind installations can coexist with traditional farmland, often benefiting crop growth and providing supplemental income to farmers. The integration of more renewables into the grid is
energyrenewable-energyelectric-vehiclessolar-powerwind-powerbattery-storageclean-technologyWind-Powered Trimaran Cargo Ship To Be Launched In 2026 - CleanTechnica
The article announces the upcoming launch of a wind-powered trimaran cargo ship, developed through a partnership between Takeda and VELA, set to begin operations in 2026. This innovative vessel measures 220 feet in length with a beam of 82 feet and features two 171-foot-high masts. It is designed to transport up to 600 European or 500 US pallets, focusing on high-value, temperature-sensitive goods such as pharmaceuticals, medical devices, luxury items, and wine. The ship aims to cross the Atlantic from France to the eastern United States in under 15 days, offering speeds two to four times faster than traditional cargo vessels by utilizing less congested secondary harbors and efficient loading/unloading processes. The trimaran is propelled entirely by wind power during ocean crossings, with hydraulic engines powered by renewable energy sources—solar panels, batteries, and underwater hydro-generators—used only for maneuvering, eliminating fossil fuel use in standard operations. It carries over 240 square meters of photovoltaic
energyrenewable-energywind-powermaritime-shippingsustainable-transportclean-technologycargo-shipWhy US Inequality Makes EVs, Solar, & Heat Pumps Fragile - CleanTechnica
The article highlights how growing economic inequality in the United States is creating fragility in the adoption of clean technologies such as electric vehicles (EVs), residential solar panels, and heat pumps. It notes that the top 10% of American households now account for roughly half of all consumer spending, skewing economic data toward the behavior of affluent consumers rather than reflecting the broader population. This concentration of wealth and spending power means that while wealthy households can afford to invest in new cars, solar arrays, and high-efficiency HVAC systems without concern for payback periods, the majority of Americans face financial constraints that delay or prevent such purchases. Specifically, the article points out that the average price of new EVs significantly exceeds the median household income, effectively locking out most middle-income buyers despite federal tax credits that are limited by income and vehicle price caps. Similarly, residential solar adoption is concentrated among higher-income homeowners who can leverage tax credits and have access to credit, while renters and low-income households are largely excluded.
energyelectric-vehiclessolar-energyclean-technologyincome-inequalityrenewable-energyenergy-adoptionDACLab says it can remove CO2 using less electricity than many competitors
DACLab, a startup emerging from stealth mode with $3 million in seed funding, claims it can remove carbon dioxide from the atmosphere using significantly less electricity than many competitors. While direct air capture (DAC) typically requires around 2,000 kilowatt-hours (kWh) of electricity per metric ton of CO2 captured, DACLab reports achieving this at approximately 1,500 kWh per ton, with plans to reduce consumption below 1,000 kWh per ton. Their technology, adapted from an industrial carbon capture system developed at TU Wien in Austria in partnership with Shell, separates the CO2 capture and release processes into different locations, allowing for lower heat requirements (around 70°C) and improved energy efficiency compared to conventional integrated systems. DACLab has built two pilot units capable of capturing 100 metric tons of CO2 annually, priced under $500,000 each, with plans to scale up to units capturing 1,000 and 5,000 metric tons per year. Initial
energycarbon-capturedirect-air-captureCO2-removalclean-technologyrenewable-energyclimate-change-mitigationUrsula Kicks EU Car Industry into Gear Making Affordable Small BEVs - CleanTechnica
In her 2025 State of the European Union speech, Ursula von der Leyen emphasized the need for Europe to develop affordable, small battery electric vehicles (BEVs) to meet both domestic demand and global market growth. She announced a forthcoming "Small Affordable Cars" initiative aimed at fostering the production of clean, efficient, lightweight, and economically accessible electric cars built entirely within Europe, leveraging European supply chains. This move is intended to prevent China and other global competitors from dominating the emerging electric vehicle market and to ensure that Europe remains a key player in the future of automotive manufacturing. The article highlights that this initiative marks a shift in EU industrial policy, which historically focused on agriculture and limited interference in national industrial strategies to maintain a level playing field within the union. Previously, the EU relied on tariffs and regulations to protect its market, such as taxing Chinese BEVs to offset subsidies. However, the new approach signals a more proactive European-wide industrial policy, starting with defense and now extending to strategic sectors like automotive
energyelectric-vehiclesEuropean-Unionclean-technologyautomotive-industrysustainable-transportationelectric-mobilityThis One Chart Embarrasses USA - CleanTechnica
The article from CleanTechnica highlights a revealing chart from Our World In Data that compares electric vehicle (EV) market growth across several countries, emphasizing how the United States is significantly lagging behind. While Norway has nearly completed its EV transition and China has rapidly surged to a 50% EV market share, the U.S. EV market remains small with slow and anemic sales growth. The UK and Europe have shown steady EV growth over the past several years, although the EU's expansion has recently stalled, but even these regions outperform the U.S. by a wide margin. This disparity is described as embarrassing and indicative of the U.S. falling behind in 21st-century technology leadership, especially in clean transportation. The article frames the U.S. situation as a "disgrace" and a stark visual representation of how the country is no longer at the forefront of technological innovation in critical sectors like electric vehicles. Overall, the piece calls attention to the urgent need for the U.S. to accelerate
energyelectric-vehiclesEV-marketrenewable-energyclean-technologyenergy-storagesustainable-transportationVehicle Sales Growth Since 2020 Is Entirely From Electric Cars - CleanTechnica
The article from CleanTechnica challenges the common narrative that demand for electric vehicles (EVs) is weak while fossil-fueled car sales remain strong. Using data from the International Energy Agency (IEA), it highlights that fossil-fueled vehicle sales have been declining steadily since before the COVID-19 pandemic, with significant drops in 2020 and continued decreases through 2024. Despite a slight rebound in 2023, fossil-fueled car sales have not returned to pre-pandemic levels, suggesting that the era of peak gasoline-powered cars may have passed. Conversely, electric vehicle sales have shown consistent and strong growth over the past five years. Even during 2020, a challenging year for the auto industry, EV sales increased slightly and then more than doubled in 2021. This upward trend continued through 2022, 2023, and into 2024, reaching nearly 20 million EV sales out of about 80 million total vehicle sales in 2024
electric-vehiclesEV-sales-growthelectric-carsrenewable-energyautomotive-industryclean-technologyenergy-transitionThe Solar Empire Strikes Back! - CleanTechnica
The article from CleanTechnica highlights a challenging period for the U.S. solar industry, marked by a somber mood at the recent US Renewable Energy Market conference. Industry leaders and investors agree that solar is entering a consolidation phase where smaller developers unable to secure capital may need to restructure or sell projects. This downturn is attributed to the current U.S. administration’s rollback of renewable energy incentives and increased support for fossil fuels, which has caused significant setbacks, as noted by SEIA CEO Abby Ross Hopper. Despite these challenges, the solar sector remains optimistic due to strong market demand driven by the need for affordable, quickly deployable electricity, especially to power AI data centers. Advances in battery technology are also helping to address concerns about solar’s intermittent supply, and there is a growing trend toward domesticizing the solar supply chain and manufacturing in the U.S. The article also contrasts the U.S. situation with China’s aggressive expansion in green technology manufacturing. Citing a Johns Hopkins report, it notes that Chinese firms
energysolar-energyrenewable-energyclean-technologybatteriesgreen-manufacturingenergy-storageBYD Dolphin Surf Gets 5 Stars from EURO NCAP and Will Start Production in Hungary This Year - CleanTechnica
The BYD Dolphin Surf (also known as the Seagull) has achieved a 5-star safety rating from EURO NCAP, joining other top performers like the Nio Firefly, Hyundai IONIQ 9, smart #5, and MINI Cooper. This rating is notable given the Dolphin Surf’s small size and short crumple zones, which typically present challenges in crash safety. In contrast, several other models, including the BMW 1 Series and Toyota Urban Cruiser, scored only 4 stars, underscoring the Dolphin Surf’s impressive safety performance. Additionally, BYD announced that the Dolphin Surf will be the first vehicle produced at its new manufacturing plant in Szeged, Hungary, starting later this year. This European production is aimed at serving the European market more efficiently by reducing delivery times and avoiding tariffs. The move also reflects BYD’s strategy to localize production and tailor vehicles for different global markets. While the Dolphin Surf’s compact design and safety features could appeal to urban
energyelectric-vehiclesBYDautomotive-safetyEURO-NCAPclean-technologymanufacturingBYD Sales Transition Update: Sealion 06EV in Short Supply with Over 100,000 Orders - CleanTechnica
The article reports on BYD’s new electric vehicle, the Sealion 06, which has quickly become one of the best-selling models in China since its launch, surpassing other models in the Sealion family and ranking highly among all vehicles sold nationwide. The Sealion 06 has received over 100,000 orders, with 85% of buyers opting for the top-spec version that offers a 605 km range and advanced features, including a sophisticated suspension system. The vehicle is priced between 143,800 and 163,800 RMB ($20,200 to $23,000 USD). Unlike typical EV launches, the Sealion 06 began accepting orders only as sales started, with a gradual rollout across local markets. Initially, only 2WD versions are available, with AWD models expected later, and plans exist to introduce the model internationally. Meanwhile, the BYD Song Plus, which the Sealion 06 is poised to replace at Ocean dealerships in China, has shifted focus primarily to
energyelectric-vehiclesEVBYDclean-technologysustainable-transportationbattery-rangeFrom Clarion-Clipperton to Clean Tech: The Debate Over Seabed Mineral - CleanTechnica
The article presents a detailed conversation between Michael Barnard and Lyle Trytten, a seasoned professional engineer specializing in minerals processing and battery minerals, focusing on the emerging field of seabed mining for polymetallic nodules. Trytten shares his extensive background, which began unexpectedly in metals after starting as a chemical engineer in Alberta’s petroleum-focused environment. Over decades, he gained broad international experience in mining operations and metal refining, including designing and commissioning nickel and copper projects worldwide. His expertise led to advisory roles with Natural Resources Canada (NRCan) and the International Energy Agency, where he contributes to critical minerals policy and research. The discussion centers on the techno-economic assessment of seabed mining, a topic gaining traction due to recent U.S. policy moves, such as President Trump’s executive order promoting seabed mining and consultations in American Samoa regarding leasing. Several companies, including Canadian firms, are developing technologies to extract these seabed nodules, which are rich in critical minerals essential for clean technology. Trytten
energyseabed-miningminerals-processingbattery-mineralspolymetallic-nodulestechnoeconomic-assessmentclean-technologyHow Much Are Non-Electric Vehicle Sales Dropping Globally? - CleanTechnica
The article from CleanTechnica discusses the challenges and variability in assessing the global decline in non-electric (internal combustion engine, ICE) vehicle sales amid rising electric vehicle (EV) adoption. Using data from José Pontes and other sources, the article highlights differing estimates of how much ICE vehicle sales have dropped between July 2024 and July 2025. One analysis suggests a significant decline of over 8 million ICE vehicles annually, while other data comparisons show either a modest decrease of around 69,000 to 342,000 units or even a slight increase in fossil fuel vehicle sales during the same period. These discrepancies stem from the difficulty of collecting consistent global vehicle sales data across many countries and sources. The article underscores that while EV sales are clearly growing, the exact rate at which non-electric vehicle sales are falling remains uncertain due to data inconsistencies. The author expresses interest in further exploring these challenges with José Pontes, who has extensive experience in automotive market analysis. Overall, the piece emphasizes the
energyelectric-vehiclesautomotive-industryclean-technologyvehicle-sales-trendsclimate-impactfossil-fuel-alternativesUS firm gets funding to test water-jet drill for geothermal energy
Dig Energy, a U.S.-based startup, has secured $5 million in venture funding to pilot its innovative geothermal drilling technology aimed at drastically reducing costs. The funding round was co-led by Azolla Ventures and Avila VC, with additional support from several investors and accelerators, including the U.S. Department of Energy’s EPIC Prize. Dig Energy’s mission is to make geothermal heating and cooling cost-competitive by addressing the primary barrier: the high expense of drilling boreholes. Currently, geothermal systems account for only about 1% of U.S. building installations largely due to the use of oversized, oil-and-gas-style drilling rigs that are costly and impractical for many sites. Dig Energy has developed a compact water-jet drill that replaces traditional carbide bits with high-pressure fluid drilling, cutting drilling costs by up to 80%. This smaller, purpose-built rig is designed specifically for geothermal applications and can access urban and tight sites where demand is highest. By lowering upfront costs, Dig aims
energygeothermal-energydrilling-technologyrenewable-energyenergy-efficiencysustainable-energyclean-technologyWebinar: How to talk to Canada's next clean technology adopters - Clean Energy Canada
The article announces an upcoming webinar titled “How to talk to Canada’s next clean energy adopters,” organized by Re.Climate and Clean Energy Canada. The webinar will launch the report Empowering Households, developed in partnership with Abacus Data, based on a survey of 3,000 people in the Greater Toronto and Hamilton Area and Metro Vancouver. This research identifies five distinct groups of clean technology adopters, ranging from highly motivated individuals to those not yet interested, and explores the barriers, motivations, information sources, and potential incentives influencing their adoption of clean technologies like electric vehicles (EVs) and heat pumps. The article emphasizes the urgency of accelerating clean technology adoption in Canadian households, which contribute at least 17% of the country’s emissions. Despite strong interest, obstacles such as upfront costs, housing limitations, and confusing information hinder broader uptake. The webinar will feature insights from report authors and clean technology experts, focusing on the main barriers and offering policy and communication strategies tailored to effectively engage the diverse
energyclean-technologyclean-energy-adoptionelectric-vehiclesheat-pumpsclimate-goalsCanada-energy-policyCleantechnica Exclusive: Interview with MiBot Creator Kusunoki-san - CleanTechnica
The article features an exclusive interview with Kusunoki-san, the creator of the MiBot, a compact electric vehicle (EV) designed specifically for Japan’s narrow streets and solo commuting needs. Kusunoki emphasizes that traditional cars are too large for Japan’s urban environment, inspiring the development of the MiBot, which is priced aggressively at around $7,000 USD—about half the cost of Japan’s best-selling EV, the Nissan Sakura. This affordability and practicality have driven strong market interest, with over 3,300 pre-orders, surpassing Toyota’s total EV sales in Japan for 2024. Kusunoki highlights that despite lacking a traditional engineering background, the biggest challenge was assembling a team and partners who shared the project’s vision, which they achieved through transparent communication and sharing their development journey on YouTube. Kusunoki believes the MiBot’s concept has global potential in urban areas with similar constraints, especially given rising environmental awareness and demand for last-mile mobility solutions. However, he
energyelectric-vehiclesEVclean-technologyurban-mobilitysustainable-transportationautomotive-innovationGood News For Solar & Virtual Power Plants In Canada - CleanTechnica
The article highlights positive developments for solar energy and virtual power plants (VPPs) in Canada, focusing on a pilot project in Blatchford, a residential community near Edmonton, Alberta. Despite Edmonton’s challenging climate for solar power due to its northern latitude, cold temperatures, and snow, the community has successfully networked 20 homes equipped with rooftop solar panels and battery storage into a VPP. This network, which will eventually expand to 100 homes with a combined storage capacity of 2 megawatt-hours, demonstrates the feasibility of integrating solar energy even in less-than-ideal conditions. The project uses batteries supplied by Germany’s Sonnen, with local utilities EPCOR and Solartility managing the system to stabilize the grid and optimize electricity use. VPPs like the one in Blatchford offer significant benefits by enabling more renewable energy sources, such as wind and solar, to be added to the grid while addressing intermittency issues. They help balance electricity supply and demand, reduce the need for
solar-energyvirtual-power-plantsrenewable-energyenergy-storagesmart-gridsolar-panelsclean-technologyHorse Powertrain Unveils C15 Compact Engine For EV Retrofits - CleanTechnica
Horse Powertrain, a joint venture between Renault and Geely, has unveiled the C15 compact engine designed for electric vehicle (EV) retrofits, aiming to address consumer concerns about charging anxiety. The C15 integrates an engine, generator, and inverter into a compact unit (measuring roughly 20 x 22 x 11 inches) that can be fitted into existing battery electric vehicle (BEV) platforms with minimal modifications. This allows original equipment manufacturers (OEMs) to convert BEVs into range-extended electric vehicles (REEVs), expanding their product offerings to meet diverse market demands. The company highlights the growing market for REEVs globally and positions the C15 as an efficient, flexible, and cost-effective solution to support this trend. The announcement comes amid a challenging environment for EV adoption, particularly in North America, where recent policy rollbacks in the US and Canada have dampened EV mandates and incentives. For example, Canada recently rescinded a policy requiring automakers to increase EV sales
energyelectric-vehiclesEV-retrofitscompact-engineHorse-Powertrainclean-technologyautomotive-innovationBYD Electric Truck Sales Up 10% - CleanTechnica
The article from CleanTechnica reports on BYD’s recent sales performance in the electric vehicle sector, focusing particularly on heavy-duty commercial electric vehicles. In August, BYD’s electric bus sales declined significantly by 41% year over year, with 382 units sold compared to 647 the previous year. Despite this drop, bus sales for the first eight months of the year still showed a modest increase of 10.6% compared to the same period last year. Meanwhile, BYD’s non-bus commercial electric vehicle sales rose by 10.2% in August year over year, although the overall trend since April has been a sharp decline following a strong surge earlier in the year. Over the first eight months of 2024, BYD’s non-bus commercial vehicle sales experienced a remarkable 423.3% increase year over year, highlighting significant growth despite recent volatility. The article notes that these markets remain unpredictable and subject to rapid changes, with the outlook appearing more optimistic after April
energyelectric-vehiclesBYDcommercial-truckselectric-trucksclean-technologyrenewable-energyCanada is full of would-be clean tech adopters—if only they could - Clean Energy Canada
The article from Clean Energy Canada emphasizes the crucial role households play in Canada’s transition to a net-zero, electrified future. Households directly contribute at least 17% of Canada’s climate emissions, with higher shares in provinces like Ontario. Beyond emissions, households are increasingly significant investors in clean energy technologies such as rooftop solar, electric vehicles (EVs), and heat pumps. In advanced economies, household energy investments have surged, accounting for nearly 60% of energy-investment growth since 2016. This trend underscores the potential of widespread clean technology adoption to reduce fossil fuel demand and emissions globally. Clean Energy Canada’s partnership with Abacus Data involved a survey of 3,000 residents in Canada’s largest English-speaking urban areas, revealing five distinct groups with varying interest levels in clean technologies. Overall, there is strong openness to adoption: 59% intend to buy an EV next, 56% view heat pumps positively, and 57% prioritize energy-smart homes. However, a significant gap
clean-energyclean-technologyelectric-vehiclesenergy-transitionrenewable-energyenergy-investmentclimate-changeBYD BEV Sales Up 34% While PHEV Sales Down 23% — Charts - CleanTechnica
BYD's August 2025 sales data reveals a mixed performance in its electric vehicle segments. Battery electric vehicle (BEV) sales increased significantly by 34.4% year-over-year for August and were up 39.4% for the first eight months of 2025 compared to the same period in 2024. This growth, while solid, is more moderate than the company’s earlier hypergrowth phases. Conversely, BYD’s plug-in hybrid vehicle (PHEV) sales declined by 22.7% in August 2025 compared to August 2024, although PHEV sales were still up 8.4% for the year-to-date period. The decline in PHEV sales may indicate market saturation or shifting consumer preferences in China. The combined effect of these trends resulted in a marginal 0.2% increase in overall passenger plug-in vehicle sales for BYD in August 2025 year-over-year, signaling a slowdown from previous rapid growth.
energyelectric-vehiclesBEVPHEVautomotive-salesrenewable-energyclean-technologyNIO Sales Spike 55% - CleanTechnica
NIO experienced a significant surge in vehicle sales in August 2025, delivering 31,305 vehicles, which represents a 55.2% increase compared to August 2024. For the first eight months of 2025, the company achieved a total of 166,472 vehicle deliveries, marking a 30% year-over-year growth. This upswing breaks a recent trend of stagnant or slow sales growth for the company. A notable development in August was the sales crossover between NIO’s brands: the newer “family-oriented” ONVO brand outsold the original NIO brand with 16,434 deliveries versus 10,525. Additionally, the FIREFLY brand, which focuses on small, high-end electric vehicles and is even newer than ONVO, contributed 4,346 deliveries. Since its inception, NIO has sold a total of 838,036 vehicles, with the milestone of one million vehicles sold expected within the coming months.
energyelectric-vehiclesNIOautomotive-salesrenewable-energyenergy-storageclean-technologyXPENG Sales Rise 169%! - CleanTechnica
XPENG reported a significant surge in vehicle sales, delivering 37,709 units in August 2025, which marks a 169% increase compared to August 2024. Although month-over-month growth has stabilized, August sales still set a new monthly record for the company with a 3% rise from July 2025. Over the first eight months of 2025, XPENG achieved 271,615 deliveries, representing a remarkable 252% increase from the same period in 2024. This growth spike began around November 2024, driven by enhanced production and sales capabilities. Despite concerns that XPENG’s rapid sales growth may plateau, the company is addressing this with new models like the all-new P7, which has already started deliveries. Additionally, XPENG’s advanced technology is gaining strong user adoption; in August 2025, its XNGP human-AI co-pilot feature reached an 85% urban driving monthly active user penetration rate, indicating widespread acceptance and
energyelectric-vehiclesXPENGautonomous-drivingAI-co-pilotclean-technologyrenewable-energyEV Share of USA Auto Market Drops to 7.4%, Fossil Fuel Vehicle Sales Rise - CleanTechnica
The article from CleanTechnica reports that the electric vehicle (EV) market share in the United States declined to 7.4% in the second quarter of 2025, down from 8.1% in Q2 2024 and 7.6% in Q1 2025. This marks the lowest EV market share since early 2024. The decline is concerning because EV adoption is critical for reducing CO2 emissions and harmful air pollution. However, the article anticipates a temporary rebound in EV sales in Q3 2025 due to consumers rushing to purchase EVs before the expiration of the US EV tax credit, followed by a likely drop in Q4. In contrast, sales of fossil-fueled vehicles in the US have increased by 3% year-over-year and compared to two years ago, though they remain 14% below the unusually high sales levels seen in Q2 2021, a period marked by a post-COVID-19 rebound.
energyelectric-vehiclesEV-marketfossil-fuelsclean-technologyrenewable-energyautomotive-industryUSA Electric Car Sales Down 6% In Q2 — Driven By Tesla's Drop - CleanTechnica
In the second quarter of 2025, U.S. electric vehicle (EV) sales declined by 6% year-over-year, dropping by 20,511 units compared to Q2 2024. This downturn was primarily driven by a significant decrease in Tesla sales, while non-Tesla EV sales remained relatively flat, increasing by only 218 units over the same period. Despite this recent decline, overall EV sales in the U.S. have grown substantially over the past few years, with Q2 2025 sales still 60% higher than in Q2 2022 and 163% higher than in Q2 2021. The data reveals that Tesla’s sales growth has been stagnating or declining for several years, a trend that predates Elon Musk’s more controversial public behavior starting around 2020. In contrast, non-Tesla EV sales have consistently risen, nearly doubling since 2021, although growth stalled in 2025. This divergence has led to
energyelectric-vehiclesTeslaEV-salesclean-technologysustainable-transportationautomotive-industryHenrik Fisker quietly wound down his nonprofit after his EV startup went bankrupt
Henrik Fisker, founder of the now-bankrupt EV startup Fisker Inc., and his wife Geeta quietly dissolved their private charitable foundation, the Geeta & Henrik Fisker Foundation, which was established in late 2021 to support innovation across healthcare, education, sustainability, and mobility. Over its three-year existence, the foundation made only about $100,000 in grants, with minimal activity and no public announcement of its creation. The foundation’s initial endowment was tied to Fisker Inc. stock, which significantly declined in value from around $4 million to under $2 million as the company struggled with production and delivery of its electric SUV. The foundation’s limited grantmaking included a $92,287 donation to a JP Morgan Charitable Gift Fund in 2023 and a final smaller grant before closing. The Fiskers’ foundation contrasts with other EV companies’ philanthropic efforts, such as Rivian’s foundation, which was initially funded with 1% of the company’s equity and has
energyelectric-vehiclesEV-startupssustainabilityrenewable-energyelectric-mobilityclean-technologyBYD’s Opportunity to Establish Brand Preference in the Developing World - CleanTechnica
The article from CleanTechnica discusses BYD’s strategic opportunity to build strong brand preference in developing markets, particularly in Asia. BYD’s focus on emerging economies—where economic growth is driven by technology rather than resource extraction—aligns well with the demographic profile of new car buyers, who tend to be younger and entering key life stages such as starting families and careers. For example, data from BYD’s Han model buyers in China shows that over 64% are under 35 years old and most are married with children, indicating a customer base forming brand loyalties early in their consumer lives. This demographic trend, combined with BYD’s expansion into markets that other automakers have retreated from, presents a significant long-term advantage in establishing brand loyalty among future generations. The article also emphasizes the importance of brand preference, defined as consumers’ tendency to favor one brand over others based on experience and perception. It highlights how brand preferences often form during major life transitions and early purchasing decisions, making the
energyelectric-vehiclesBYDemerging-marketsclean-technologyautomotive-industrybrand-preferenceUS manufacturing investment stumbles as clean tech cancellations pile up
In the second quarter of 2025, U.S. clean tech manufacturing investments experienced a notable decline, with cancellations outpacing new project announcements for the first time in recent history. According to a report from the Rhodium Group and MIT, companies cancelled $5 billion worth of clean tech projects, primarily battery factories, while only $4 billion in new investments were announced. This represents a 15% drop in actual clean tech manufacturing investments. The downturn follows legislative changes under the "One Big Beautiful Bill," which weakened key components of the Inflation Reduction Act by reducing incentives such as production tax credits and dampening demand for electric vehicles. Earlier cancellations in Q1 were mostly related to electric vehicle production, whereas Q2 saw battery manufacturing projects bearing the brunt of cancellations, despite battery manufacturing still driving $8 billion in new investments. This pullback in clean tech mirrors a broader contraction in U.S. manufacturing investment overall. Data from the U.S. Bureau of Economic Analysis shows that spending on new manufacturing
energyclean-technologybattery-manufacturingelectric-vehiclesUS-manufacturinginvestment-trendsInflation-Reduction-ActFinding the Spark at Long Beach’s New Electric Vehicle Campus - CleanTechnica
The article highlights Ford’s newly established Electric Vehicle Development Center (EVDC) in Long Beach, California, which serves as the company’s main design and innovation hub for advanced electric vehicles in Southern California. Housed in a repurposed aviation facility with a rich history dating back 95 years, the campus spans 250,000 square feet and includes design studios, fabrication shops, testing labs, and collaborative spaces designed to foster spontaneous interactions and cross-disciplinary teamwork. The center aims to develop a new generation of electric vehicles that are user-friendly and accessible, inspired by the simplicity and impact of the historic Model T. Ann Diep, a senior technical program manager at Ford and former consumer electronics professional, emphasizes the importance of user-centric design and collaboration in the EVDC’s culture. The facility encourages open communication among experts from diverse fields such as electronics, semiconductors, and drone technology, blending Ford’s automotive heritage with a startup-like agility. This collaborative environment, combined with partnerships across Ford’s teams in
energyelectric-vehiclesEV-developmentautomotive-innovationclean-technologysustainable-transportationFord-electric-campusA Few More Days For Big EV Raffle From CCAN — Podcast & YouTube Chat - CleanTechnica
The Chesapeake Climate Action Network (CCAN) has been running an electric vehicle (EV) raffle for seven years, which has grown significantly in scale and popularity. This year’s raffle features attractive prizes including a first-place choice among a Rivian, Porsche, or Lucid EV; a second-place prize of either a VW ID. Buzz or Hyundai IONIQ 5; and a third-place prize of a Chevrolet Equinox EV LT. The raffle serves both as a fundraising effort and a way to promote EV adoption, reflecting CCAN’s ongoing commitment to climate action and clean transportation. In a recent podcast and YouTube discussion, CleanTechnica’s Zachary Shahan spoke with Quentin Scott, CCAN’s Federal Policy Director, about the raffle and broader cleantech policy issues in the U.S. The conversation delved into the political complexities surrounding cleantech growth and the policies shaping the industry’s future. Shahan also shared his personal connection to CCAN, having collaborated with the organization over
energyelectric-vehiclesEV-raffleclean-technologyrenewable-energycleantech-policyenergy-storageSix New Public EV Charging Stations Installed In Parsippany, New Jersey - CleanTechnica
Six new public electric vehicle (EV) charging stations have been installed in Parsippany, New Jersey, marking a significant increase of about 25% in the township’s total public EV chargers, which previously numbered fewer than 30. This addition addresses range anxiety by expanding accessible charging infrastructure, reducing the need for EVs with extremely long ranges or large batteries. Strategically located less than a quarter mile from the I-287 ramp and a third of a mile from Route 46, the chargers serve both local residents and commuters, providing convenient access without detours. The site is adjacent to Waterview Marketplace, offering amenities such as coffee shops and retail stores, allowing drivers to utilize their charging time productively. The six charging stations offer 32A output and are compatible with all EV models, with Tesla vehicles requiring an adapter. Payment options include app-based charging and QR code scanning for credit or debit card checkout, priced at $0.40 per kWh with a 10-minute idle grace period
energyelectric-vehiclesEV-charging-stationspublic-infrastructurerenewable-energyclean-technologyenergy-efficiencyNIO Day 2025, See You in Hangzhou - CleanTechnica
NIO Day 2025 will be held in Hangzhou, marking the first time the event takes place in autumn. Despite a shorter preparation period and increased coordination complexity, the Organizing Committee, guided by user advisors, selected Hangzhou due to its blend of cultural heritage and modern vitality. The event will feature the official launch of the All-New ES8 and offer attendees a chance to experience Hangzhou’s cultural charm, including its famous West Lake, Qiantang River tides, and tea culture. The theme “Grow with the Light” emphasizes growth and harvest, with a specially designed city icon inspired by the osmanthus flower symbolizing the city’s welcoming spirit. NIO, founded in 2014, is a leading global smart electric vehicle company focused on sustainable innovation and premium user experiences. It is the first car company listed on the NYSE, HKEX, and SGX, with three major brands: NIO, ONVO, and firefly. As of mid-2025
energyelectric-vehiclessmart-technologysustainable-energyautomotive-innovationNIOclean-technologyCould the “Faltering” US Dollar Create Global Clean Tech Investment Opportunities? - CleanTechnica
The article discusses the recent significant decline of the US dollar, which has lost nearly 11% of its value against a basket of major global currencies in the first half of 2025—the worst performance since the era when the dollar was backed by gold. This weakening dollar has broad implications, including making US imports more expensive and affecting global trade dynamics. The article connects this currency shift to opportunities in global clean technology (cleantech) investments, especially as the US transition to renewables appears to be faltering while other countries accelerate their efforts. Key investment insights include favoring US companies with strong international sales, as revenues earned in stronger foreign currencies translate into higher dollar values. Emerging markets, particularly China, are highlighted as leaders in cleantech production and sales, surpassing the US and expanding influence in regions like Africa by removing tariffs and fostering local startups. This shift signals growing opportunities not only for Chinese firms but also for local cleantech ventures in developing countries across Africa, Asia, and Latin
energyclean-technologyrenewable-energyglobal-investmentcleantechemerging-marketselectric-vehiclesTurkiye EV Sales Report — Three Kings Rule Fast-Growing Market - CleanTechnica
Turkey’s electric vehicle (EV) market is experiencing rapid growth, with plugin electric vehicle (PEV) sales soaring 128% in 2025 to over 103,000 units and capturing an 18% market share in the first seven months of the year. This marks a significant rise from less than 1% in 2022, progressing to about 7% in 2023 and 10% in 2024. Given Turkey’s large overall passenger car market, which exceeds one million units annually, this growth is particularly notable. The market’s top three EV models—the BYD Seal U, local Turkish brand Togg T10X, and Tesla Model Y—account for 44% of EV sales, highlighting a mix of international and domestic success. The Togg T10X’s strong second-place finish underscores the potential for new local brands to thrive in the EV sector when executed well. Tesla’s Model Y, produced in Germany, has also seen robust sales but remains
energyelectric-vehiclesEV-marketTurkeyautomotive-industryclean-technologysustainable-transportationFrom Norway To Nigeria, Beijing To Bogotá: Mapping The World’s EV Inflection Points - CleanTechnica
The article from CleanTechnica examines the global transition to electric vehicles (EVs) through the lens of innovation diffusion theory and complex adaptive systems, highlighting how EV adoption follows an S-curve pattern with distinct inflection points. Adoption begins slowly, accelerates rapidly between 5% and 40% market penetration as infrastructure and consumer behavior shift, and eventually levels off as the market saturates and legacy internal combustion engine (ICE) vehicles persist in the fleet. The pace and timing of this transition vary significantly by region due to differing policies, market dynamics, and cultural factors. Norway leads the global EV transition, with nearly all new car sales expected to be electric by 2025, driven by supportive policies, renewable energy integration, and dense charging infrastructure. Europe follows with a regulatory mandate for 100% zero-emission car sales by 2035, though adoption rates vary within the continent. China has rapidly surpassed its EV sales targets, reaching 50% EV sales by 2025 due
energyelectric-vehiclesEV-adoptionrenewable-energycharging-infrastructureclean-technologysustainable-transportationThe Thing Pollution-Heads Celebrating Climate-Policy Sabotage Don't Understand - CleanTechnica
The article from CleanTechnica criticizes the Trump administration's efforts to undermine renewable energy and electric vehicle (EV) initiatives by cancelling incentives and rolling back regulations. It highlights that despite these political setbacks, the global transition to cleantech—particularly EVs and renewable energy—is inevitable and accelerating. The piece argues that while oil-rich nations, including the U.S., currently wield significant economic and political influence, their dominance will diminish as other countries, especially China and Europe, advance more rapidly in cleantech innovation and adoption. The author warns that the U.S. risks falling behind in the global clean technology race if it continues to defund and sabotage these industries. This could relegate the country to a secondary market status for critical emerging technologies, undermining economic competitiveness. Additionally, the article underscores the public health consequences of resisting clean energy, noting increased pollution-related illnesses and premature deaths. It criticizes the influence of oil industry propaganda on public opinion and stresses that opposing cleantech development neither saves money
energyrenewable-energyelectric-vehiclesclean-technologyclimate-policypollutionenergy-transitionVolvo Cars Strengthens Its Leadership, Sharpening the Focus on Product & Commercial Responsibility - CleanTechnica
Volvo Cars has announced key leadership changes to strengthen its focus on product development and commercial responsibility, reflecting its commitment to enhancing customer offerings and regional product alignment. Erik Severinson has been appointed Chief Commercial Officer, continuing his role on the Executive Management Team, while Michael Fleiss returns as Chief Strategy & Product Officer. Fleiss brings extensive experience from his previous tenure at Volvo and his work with Aurobay and Horse Powertrain, positioning the company to accelerate its transition to an all-electric future. The commercial team will be reorganized under Severinson’s leadership, with new Product Line Owners reporting directly to him to ensure a cohesive approach across regions and product lines. These leadership adjustments come at a pivotal time for Volvo Cars, which reported a record core operating profit of SEK 27 billion and an all-time high revenue of SEK 400.2 billion in 2024, alongside global sales of 763,389 vehicles. The company remains focused on its ambition to become a fully electric car maker and achieve net
energyelectric-vehiclesautomotive-industryelectrificationclean-technologyproduct-strategycommercial-leadershipScientists find solar waste could be Australia’s richest silver source
Researchers at Macquarie University have developed a novel precision extraction technology that recovers silver from discarded solar panels with over 77% efficiency, without damaging the silicon wafers or glass components. This method, called Jet Electrochemical Silver Extraction (JESE), uses a fine stream of weak acid to selectively dissolve silver directly from the panel surface, preserving other materials for reuse. The technology complements the team’s patented microwave-powered delamination process, which separates panel components without grinding or high heat, enabling recovery of intact glass sheets and reusable silicon wafers. This innovation is licensed to ASX-listed Lithium Universe, which secured global rights for over A$500,000 for 20 years. The significance of this development lies in the growing volume of solar panel waste in Australia and globally, as many panels installed in the early 2000s reach their end of life. Australia alone may accumulate about one million tonnes of solar panel waste by 2035. Each panel contains approximately 20 grams of silver, a
energysolar-panelssilver-recyclingrenewable-energysustainable-materialswaste-managementclean-technologyIt's So Easy To Fool People — Misinformation & Myths Abound - CleanTechnica
The article from CleanTechnica highlights the pervasive challenge of misinformation and myths surrounding electric vehicles (EVs), renewable energy, and climate science. Drawing on the author's extensive experience covering these topics for over a decade, it emphasizes how easily people are misled by repeated falsehoods, especially when presented by seemingly authoritative sources or amplified by media outlets like Fox News and social media platforms. The piece notes that misinformation has led to widespread misconceptions, such as the false belief that EVs are worse for the environment than fossil-fueled cars, denial of global heating caused by CO2 emissions, and other unrelated conspiracy theories like election fraud or vaccine skepticism. The author argues for the need to regularly debunk these myths and proposes creating a centralized resource page that compiles common misinformation alongside clear, refined responses to help educate the public. They invite readers to contribute examples of prevalent myths and effective ways to counter them in a friendly and inclusive manner, aiming to reduce misinformation without alienating those who have been misled.
energyrenewable-energyelectric-vehiclesclean-technologymisinformationclimate-sciencecleantech-myths500 Global Launches Sustainable Innovation Program Backed by Catalytic Partners - CleanTechnica
500 Global, a prominent venture capital firm, has launched the Sustainable Innovation Program to support founders developing commercially viable, sustainability-focused solutions in the global south. Anchored by the Shell Foundation and co-funded by the UK Government through its Transforming Energy Access (TEA) and Catalysing Agriculture by Scaling Energy Ecosystems (CASEE) programs, this initiative aims to build a network of resources that empower entrepreneurs in sectors such as agriculture, energy, mobility, and the built environment. The program emphasizes local leadership and inclusive innovation to drive sustainable growth and measurable impact, combining strategic capital, multilateral partnerships, and domain expertise. The program debuts with the Sustainable Innovation Seed Accelerator in Nairobi, an intensive eight-week initiative targeting seed-stage startups across Africa. Participating startups receive mentorship and access to a global network of partners, investors, and operators. Since 2010, 500 Global has invested in over 140 companies across 27 countries that align with sustainability goals, focusing on localized infrastructure to address regional
energysustainabilityventure-capitalclean-technologyrenewable-energysustainable-innovationglobal-developmentTesla Brand Loyalty Drops An Unprecedented Degree In USA - CleanTechnica
A recent leaked update from S&P Global Mobility reveals a significant and unprecedented decline in Tesla's brand loyalty in the United States, attributed largely to CEO Elon Musk's controversial behavior. Although Tesla's brand loyalty rebounded slightly to 57.4% in May—comparable to Toyota and slightly above average—it remains 16 percentage points lower than the previous year. Notably, Tesla now trails behind Ford and Chevrolet in this key industry metric, marking a dramatic shift given Tesla's historically strong loyalty rates exceeding 70%. S&P analyst Tom Libby emphasized the rapidity and scale of this decline as unprecedented in his experience. The drop in Tesla's new car sales appears directly linked to Musk's increasingly erratic public and political actions. The article raises the question of whether Tesla's brand loyalty can recover if Musk reduces his political visibility or if the damage is permanent. Overall, the report highlights a critical challenge for Tesla as it faces growing competition and reputational risks amid shifting consumer sentiments.
energyelectric-vehiclesTeslabrand-loyaltyrenewable-energyautomotive-industryclean-technologyVery Mixed Trends in California EV Market by Brand in Q2 - CleanTechnica
The article analyzes the second-quarter 2025 electric vehicle (EV) market trends in California by brand, revealing a mixed performance landscape. Tesla remains the dominant EV brand by a wide margin, far ahead of the second-place Hyundai in zero-emission vehicle (ZEV) sales. However, Tesla’s overall market position slipped from #2 to #3 among all auto brands in California, with Ford and Chevrolet closing the gap significantly. Tesla’s EV sales dropped by over 11,000 units compared to Q2 2024, marking a substantial decline that could impact its market dominance. Excluding Tesla to better assess other brands, Hyundai, BMW, and Chevrolet were closely matched in EV sales, separated by fewer than 50 units in Q2 2025. Several brands showed notable year-over-year growth in EV sales, including Chevrolet, Nissan, Acura, Honda, Porsche, Cadillac, and Volvo. Conversely, other major players such as Kia, Hyundai, Ford, Mercedes, Rivian, Toyota
energyelectric-vehiclesEV-marketCaliforniaTeslaautomotive-industryclean-technologyLeapmotor Gets Its Own Ocean Vessel For Vehicle Shipments - CleanTechnica
Leapmotor, a rapidly growing Chinese electric vehicle (EV) manufacturer, has launched its own ocean vessel, the Grande Tianjin, to ship vehicles overseas, marking a significant step in its global expansion. The ship, chartered by the Grimaldi Group—Leapmotor’s logistics partner since 2022—will have a capacity to deliver over 2,500 cars to Europe on its inaugural voyage. This move follows a trend set by BYD, which has been expanding its fleet of ocean vessels for EV shipments worldwide, highlighting increased vertical integration in EV logistics. Leapmotor’s international presence is expanding swiftly, with business operations in more than 30 countries and regions, supported by over 1,500 sales and service outlets and cumulative deliveries exceeding 800,000 units. The company is preparing to launch the B10, a compact electric SUV priced at approximately $13,900 in China, which is expected to constitute a significant portion of its future exports. This development underscores Leapmotor’s growing competitiveness
energyelectric-vehiclesEV-shippingrenewable-energylogisticsclean-technologyLeapmotorEcoFlow Home Backup Sale: Massive Price Drops On Power Stations & Solar Bundles - CleanTechnica
The article highlights a significant sale on EcoFlow’s home backup power solutions, including power stations, solar panels, batteries, and smart home integration equipment designed to protect against blackouts and power outages. Key deals feature substantial discounts on bundled packages and standalone units, such as the EcoFlow DELTA Pro with two 220W portable solar panels and a free carrying bag, discounted by $2,598, and the standalone DELTA Pro portable home battery, marked down by $1,600. Other notable offers include the EcoFlow 400W portable solar panel with a $450 discount, the DELTA 2 Max with solar panels discounted by $2,077, and the DELTA Pro Ultra whole-home backup power system, which is UL 9540 certified and discounted by $1,919. These products cater to a wide range of energy needs, from portable units suitable for on-the-go use to high-capacity whole-home backup systems offering between 3.6 kWh and up to
energysolar-powerportable-power-stationshome-backup-powerbatteriesrenewable-energyclean-technologyRural Roads: Exploring the Frontier of EV Adoption - CleanTechnica
The article "Rural Roads: Exploring the Frontier of EV Adoption" by Mark Jacobs highlights the often-overlooked potential for electric vehicle (EV) adoption in rural America. Contrary to common myths that EVs are too costly, unsuitable for rural terrain, or prone to leaving drivers stranded, the article presents real-life examples of rural residents—farmers, ranchers, veterinarians, and accountants—who have embraced EVs and are saving significant amounts on fuel costs, collectively over $38,000 annually. These early adopters, driving models like Tesla Model Y, Chevy Bolt, Ford F-150 Lightning, and Rivian, actively share their positive experiences to encourage their neighbors to consider switching to EVs. The article emphasizes that the main barriers to rural EV adoption are cultural rather than infrastructural or financial. Despite rural residents often having the means and facilities to charge EVs, skepticism persists due to perceptions that EVs are urban-centric and politically charged. The campaign featured in the article focuses on
energyelectric-vehiclesEV-adoptionrural-transportationsustainable-energyclean-technologyrenewable-energyICE Sales Melting! - CleanTechnica
The article "ICE Sales Melting!" from CleanTechnica highlights a significant decline in global internal combustion engine (ICE) vehicle sales between June 2024 and June 2025. Using data analyzed by a contributor named trackdaze, it was found that pure ICE vehicle sales dropped from 5.16 million units in June 2024 to 4.68 million units in June 2025, representing a decrease of approximately 480,000 vehicles year-over-year. During the same period, the market share for plug-in vehicles increased from 22% to 28%, indicating a growing consumer shift toward electric and hybrid vehicles. This decline in ICE sales underscores the accelerating transition away from fossil-fueled vehicles toward cleaner alternatives, reflecting broader trends in the automotive industry and consumer preferences. The article credits trackdaze for the data analysis and emphasizes the importance of tracking ICE sales alongside electric vehicle sales to fully understand market dynamics. The piece also encourages readers to engage with CleanTechnica’s in
energyelectric-vehiclesrenewable-energyfossil-fuelsvehicle-salesclean-technologyenergy-storageEVs Take 33.8% Share Of The UK - Government Bungles Incentives - CleanTechnica
In July 2024, plugin electric vehicles (EVs) captured a 33.8% share of the UK auto market, up from 27.4% year-on-year, with battery electric vehicles (BEVs) accounting for 21.3% and plug-in hybrids (PHEVs) 12.5%. Despite this growth, overall auto sales declined by about 5% year-on-year to 140,154 units. BEV volume grew modestly by 9%, while PHEVs saw a stronger 33% increase. Volkswagen led BEV sales in July with a 9.5% market share, followed by Ford (8.3%) and Audi (7.2%). Ford’s rise, partly driven by the Zero Emission Vehicle (ZEV) mandate, was notable, with the Ford Explorer SUV emerging as a potential best-selling BEV for the month. New MG models, including the IM5 sedan and IM6 SUV, also debuted, offering
energyelectric-vehiclesBEVPHEVUK-auto-marketclean-technologygovernment-incentivesSweden, Once A Climate Action Leader, Now Lags Behind Its Peers In Europe - CleanTechnica
Sweden, historically a leader in climate action, is now falling behind its European peers, raising concerns about the future of the EU’s climate ambitions. The country’s environmental leadership dates back over a century, highlighted by early scientific contributions to understanding carbon emissions and pioneering policies such as carbon taxation in 1991. Sweden also played a key role in international climate efforts, including substantial financial commitments to the Green Climate Fund and the establishment of a comprehensive Climate Policy Framework supported by most political parties. The global climate movement, notably sparked by Greta Thunberg’s activism, further cemented Sweden’s reputation as a frontrunner in decoupling economic growth from fossil fuel emissions, achieving a significant reduction in carbon emissions while growing its GDP. However, recent developments have reversed much of this progress. Since the right-wing shift in Sweden’s government, investments in climate action have been drastically cut, leading to the largest increase in fossil fuel emissions in 15 years and a halving of carbon uptake by forests. These
energyclimate-changecarbon-emissionsclean-technologyenvironmental-policysustainable-developmentEuropean-Green-DealXPENG Overseas Sales in 14 Countries Growing 339% in 2025 — CHART - CleanTechnica
XPENG, a Chinese electric vehicle manufacturer, is experiencing rapid growth in its overseas sales, particularly in 14 foreign markets where sales increased by 339% in the first half of 2025 compared to the same period in 2024. While the majority of XPENG’s sales remain in China, the company is expanding aggressively abroad, now selling in 46 global markets. Sales in these 14 countries rose from 2,241 units in H1 2024 to 9,828 units in H1 2025, with notable increases in European countries such as Belgium, France, Germany, and Norway, as well as in Southeast Asian markets like Malaysia and Thailand. The growth is widespread across multiple countries, including new market entries where XPENG had no sales in the previous year, such as Great Britain, Ireland, Italy, Portugal, Spain, and Thailand. This expansion is supported by new models like the XPENG G6 and G9 being introduced in Europe. Additionally, XP
energyelectric-vehiclesXPENGrenewable-energyautomotive-industryclean-technologyinternational-salesNIO Sales Up 25% (Or 2.5%) - CleanTechnica
NIO reported a total of 21,017 vehicle deliveries in July, comprising 12,675 from the NIO brand, 5,976 from the family-oriented ONVO brand, and 2,366 from the new high-end Firefly brand. The company highlighted a 25.2% increase in sales over the first seven months of 2025 compared to the same period in 2024, reflecting solid growth. However, July’s year-over-year sales growth was modest at just 2.5%, which may explain why NIO did not emphasize this figure. Looking ahead, NIO expects stronger sales momentum with the upcoming launch of its flagship SUV, the All-New ES8, set to debut in late August and officially launch at NIO Day 2025 in late September, with deliveries beginning immediately. Since its initial deliveries, NIO has sold a total of 806,731 vehicles across its brands: 737,923 from NIO, 58,599 from
energyelectric-vehiclesNIOautomotive-technologyrenewable-energyenergy-storageclean-technologyGoodbye Oil Changes: What 40–80% EV Adoption Will Look Like - CleanTechnica
The article from CleanTechnica discusses the impending transformation in vehicle fueling and maintenance as electric vehicle (EV) adoption accelerates from 40% to around 80%, signaling a rapid decline in internal combustion engine (ICE) infrastructure. Historically, fueling and maintaining gasoline cars has been convenient and affordable, but as EVs become mainstream, the infrastructure supporting ICE vehicles—such as gas stations and repair services—will collapse swiftly. This transition is already observable in leading markets like Norway and China, where EV sales dominate and gasoline stations are closing rapidly, leaving only a few along major highways or in remote areas. The author frames this shift using diffusion of innovations and logistic growth theories, emphasizing that surpassing the 40% EV adoption threshold marks a critical tipping point. Beyond this, the economic and infrastructural support for gasoline vehicles deteriorates much faster than commonly expected. However, the pace and shape of EV adoption vary widely by region due to factors like regulatory policies, infrastructure readiness, consumer attitudes, and economic incentives
energyelectric-vehiclesEV-adoptionrenewable-energyinfrastructuresustainable-transportationclean-technologyChina escapes nuclear 'cost curse' with $2 per watt power plants
A recent study by researchers from Johns Hopkins University, Harvard, CUNY, and Stony Brook University highlights how China has significantly reduced the costs of nuclear power plant construction compared to the US and France. While new nuclear plants in the US can cost up to $15 per watt and French plants around $4 per watt, China’s highly standardized designs achieve costs as low as $2 per watt. This stark contrast is attributed to China’s strategic approach, which includes strict regulation, long-term planning, and a focus on indigenization—substituting expensive imports with domestically produced components to lower expenses and improve efficiency. The study notes that while the US and France have seen rising nuclear construction costs due to factors like increased regulation, lack of standardization, and complex reactor designs, China has managed to halve its costs since the early 2000s and maintain stability. China’s model involved initially importing foreign reactors for immediate deployment, then gradually shifting to domestic production of simpler components and relying on local
energynuclear-powerChina-energy-strategyclean-technologypower-plant-costssustainable-energyenergy-infrastructureFrom Niche To Normal: Why The 5–15% EV Window Changes Everything - CleanTechnica
The article discusses the critical adoption window of 5% to 15% market penetration as a pivotal phase in the transition of technologies from niche products to mainstream acceptance. Drawing on frameworks like diffusion of innovations, logistic growth models, and complex adaptive systems, it explains how early adopters and innovators initially test new technologies, but widespread adoption accelerates sharply once this threshold is crossed. This phase is crucial because it triggers shifts in infrastructure, policy, and consumer attitudes that enable rapid growth and market transformation. Examples from various industries illustrate this pattern. The smartphone market saw rapid expansion after surpassing 15% penetration around 2010, driven by improved networks, apps, and falling prices. Similarly, digital photography transitioned from niche to mainstream after digital cameras exceeded 15% market share in 2004, leading to a decline in film-based photography infrastructure. In electric vehicles (EVs), infrastructure development is an early indicator of impending adoption growth. Countries like the Netherlands, Germany, and Norway invested heavily in public
energyelectric-vehiclesEV-adoptioncharging-infrastructureclean-technologysustainable-transportationenergy-transitionHow Ancient Kings & Their False God Screwed Up CleanTech Adoption & Other Climate Efforts Today - CleanTechnica
The article examines how historical religious and cultural dynamics have contributed to the United States' slow adoption of clean technologies, despite political conditions that might favor progress. It highlights that even with Democratic control of the federal government, passing meaningful clean technology funding has been difficult, largely due to cultural and religious opposition to innovations like electric vehicles, solar panels, and electric stoves. This resistance is not merely about fear of new technology but is deeply rooted in longstanding religious and cultural beliefs that shape attitudes toward environmental and technological change. Delving into ancient Near Eastern religious history, the article explains that the transition from polytheism to monotheism—specifically the elevation of Yahweh over other gods—was driven more by political and social power struggles than purely theological reasons. Monarchs and elites used the concept of a single, often violent, god to justify their authority and control, including suppressing female deities like Asherah to reinforce patriarchal structures. This historical consolidation of religious power influenced cultural attitudes that persist today
energyclean-technologyrenewable-energysolar-panelselectric-vehiclesclimate-changeclean-energy-adoptionCalifornia ZEV Sales Dip As Tesla Sales Crash In The Golden State - CleanTechnica
California remains the leading market for zero-emission vehicles (ZEVs) in the US and holds a significant share globally. However, Tesla sales in California have sharply declined in 2025, dropping 18.3% year-over-year from 101,991 units in the first half of 2024 to 83,375 units in the first half of 2025. This decline is attributed partly to the controversial political actions of Tesla’s CEO and increased competition, which has impacted Tesla’s brand perception in its home state. Although sales of non-Tesla ZEVs have increased, the growth has not been sufficient to offset Tesla’s sales drop, leading to an overall decrease in California’s ZEV market share from 22% in 2024 to 19.5% in the first half of 2025. Despite the decline, California’s ZEV market share remains significantly higher than the US average of 7.8%, with the state accounting for 28.6
energyelectric-vehiclesTeslazero-emission-vehiclesCaliforniaclean-technologyautomotive-marketBYD Goes for the Heart of Europe (& South America) Again — Partners with Inter Milan - CleanTechnica
Chinese electric vehicle giant BYD has entered a three-year global automotive partnership with Italian football club Inter Milan, aiming to leverage the club’s massive international fanbase to boost its presence in Europe and South America. Inter Milan, despite recent mixed sporting results, remains one of Europe’s most beloved and historically significant football clubs, with over 533 million fans worldwide. Notably, the club has a strong following in China (over 154 million fans) and South America (nearly 90 million fans), two key markets for BYD’s expansion. This partnership reflects BYD’s strategy to connect emotionally with consumers through football, a sport deeply ingrained in European and South American cultures. BYD’s Executive Vice President Stella Li emphasized the shared values between the two brands, highlighting their mutual drive for growth, innovation, and excellence. BYD, known for its commitment to green technology and climate change mitigation, sees this collaboration as a way to inspire young people and football fans globally. Inter Milan’s Chief Revenue
energyelectric-vehiclesBYDclean-technologyclimate-changegreen-technologyautomotive-industryAre You There? - CleanTechnica
The article "Are You There?" from CleanTechnica highlights the challenge of recognizing and uniting the large portion of Americans concerned about climate change, estimated at about half the population according to a recent Gallup poll. Despite this significant number, many people underestimate how many share their concern because there is no universally accepted symbol to identify climate-conscious individuals. The author argues that such a symbol is crucial for fostering community, influencing politics, and encouraging businesses to respond to climate concerns, drawing parallels to well-known symbols like the pink ribbon for breast cancer awareness or the peace symbol for anti-war movements. To address this gap, the article proposes adopting an existing, visually compelling symbol that is already somewhat recognized and easy to display—specifically, the "global warming stripes" created by climatologist Dr. Ed Hawkins in 2018. These stripes visually represent the rise in average global surface temperatures over the past 150 years, providing a clear and impactful image without overwhelming data. The stripes have been displayed worldwide and meet
energyclimate-changeenvironmental-awarenesssustainabilityclean-technologyclimate-symbolclimate-activismTILER Compact: The Wireless E‑Bike Charger That Starts When You Park - CleanTechnica
TILER, a Dutch clean-tech startup, has developed the TILER Compact, a wireless e-bike charger designed to simplify charging by starting automatically when the bike is parked on a slim charging pad called the Tile. This system uses induction charging via a specially designed kickstand adapter, eliminating the need for cables and plugs. It offers charging speeds comparable to wired chargers and features a waterproof IP67 rating, allowing use in any weather. The Compact is compatible with about 78% of current e-bike systems, including major brands like Bosch and Shimano, and comes in versions suited for regular bikes and heavier cargo models. Its scalability allows up to 24 Tiles to operate from a single 230V power source, making it ideal for offices, mobility hubs, and delivery fleets. The technology has been proven in real-world conditions, with over 300,000 kilometers charged using earlier versions and more than 200 units currently tested across Europe. One fleet of 20 e-cargo bikes reportedly saved around €1,
energywireless-charginge-bikeclean-technologysustainable-mobilityelectric-vehiclesinduction-chargingKia PV5 WKNDR Is A Digital Detox Vehicle - CleanTechnica
The Kia PV5 WKNDR is a concept electric adventure vehicle unveiled at the 125th New York International Auto Show, designed to appeal to overlanders and outdoor enthusiasts seeking a "digital detox" lifestyle. Built on the award-winning Kia EV3 platform, the WKNDR features rugged, versatile amenities such as solar panels, a pullout mobile kitchen, and ample storage, emphasizing practicality for spontaneous escapes into nature. The vehicle reflects Kia’s strategic push into recreational and adventure-focused electric mobility, aiming to combine quiet electric powertrains with camper utility for modern explorers. Feedback from attendees highlighted the WKNDR’s appeal to digital nomads and overlanders alike, with users appreciating its design tailored for adventure and off-grid living. Discussions also touched on practical aspects of overlanding, such as the challenges of sanitation and the desire for hybrid or fully electric setups in mobile homes. While some found the WKNDR compact for full-time living, it was praised as a versatile and innovative concept that aligns with
energyelectric-vehiclesolar-panelselectric-mobilityadventure-vehicleKia-PV5clean-technologyTesla loses its charm for India’s loyalists — even as Musk finally delivers
Tesla recently opened its first showroom in India, marking a long-awaited debut in the country. However, many early Indian Tesla supporters, including Vishal Gondal—a prominent entrepreneur who pre-booked a Model 3 in 2016—expressed disappointment rather than excitement. Despite being among the first visitors to the Mumbai showroom, Gondal decided against purchasing a Tesla, citing underwhelming experiences and frustrations with Tesla’s delayed entry and refund process. He and others had to wait years to receive refunds for their initial reservation fees, with some only getting reimbursed shortly before the official launch. The launch itself was perceived as lackluster compared to other major tech brand entries, such as Apple’s, with minimal buzz and no special outreach to early backers. Loyalists like Amit Bhavani and Varun Krishnan voiced their dissatisfaction, highlighting Tesla’s poor communication and slow progress relative to other companies like Starlink. While some early supporters remain proud of their initial faith in Tesla, most are hesitant
energyelectric-vehiclesTeslarenewable-energyautomotive-industryclean-technologyIndia-marketTransport Decarbonisation Is A Lever For Industrial Competitiveness But The EU Budget Fails To Capitalise On It - CleanTechnica
The article critiques the post-2027 EU budget proposal for failing to adequately leverage transport decarbonisation as a means to boost industrial competitiveness. While the new European Competitiveness Fund (ECF) allocates €67 billion over seven years for climate transition and industrial decarbonisation, €40 billion of this amount is repurposed from existing funds, leaving insufficient new resources to scale up clean technologies. Key sectors like battery manufacturing and sustainable aviation and shipping fuels risk being underfunded, threatening up to 100,000 jobs in the battery industry alone. Although the budget introduces positive elements such as production aid for clean products and “Made in EU” requirements favoring local suppliers, the overall funding is deemed too limited to establish a robust green industrial strategy. Additionally, the proposal sets a 35% target for climate and biodiversity investments, which is considered inadequate for meeting EU climate goals, and does not exclude fossil fuel subsidies. The dismantling of the LIFE program, a core EU climate
energyclean-technologydecarbonisationEU-budgetbatteriesrenewable-energyclimate-transitionArguments Why Used Electric Car Prices Are Likely To Go Up In October - CleanTechnica
The article discusses arguments from readers on why used electric vehicle (EV) prices are likely to increase in October, coinciding with the expiration of the $4,000 US tax credit for used EVs. Several contributors suggest that the removal of this credit, combined with the effective $7,500 price increase for new EVs (due to the loss of the new car subsidy), will make used EVs comparatively more attractive and valuable. Limited new EV inventory, higher new EV prices, and tariffs on imported EVs are expected to constrain supply and push buyers toward the used market, thereby driving up used EV prices. Additionally, economic factors such as a potential economic contraction could shift consumer preference from new to used vehicles, further supporting used EV price increases. Some readers also note that automakers currently do not profit from EV sales without regulatory credits, which may reduce incentives to lower new EV prices, reinforcing the upward pressure on used EV values. While some acknowledge uncertainty in these predictions, the consensus is that used
energyelectric-vehiclesEV-tax-creditused-car-pricesrenewable-energyautomotive-marketclean-technologyBYD Sold 2.14 Million Vehicles in the First Six Months of 2025 - CleanTechnica
In the first half of 2025, BYD Group achieved cumulative sales of 2.146 million vehicles, making it the only Chinese automaker to surpass 2 million units sold in that period. June 2025 sales alone reached 382,600 vehicles, marking an 11.98% year-on-year increase. Notably, pure electric vehicle sales rose significantly by 42.50% to 206,900 units, while plug-in hybrid vehicle sales declined by 12.45% to 170,700 units. BYD has also advanced its intelligent driving technology and supplier collaborations. In February 2025, the company launched three levels of intelligent driving solutions (A/B/C), with the highest level (C-level) featuring the Horizon Journey 6 chip series. BYD placed a large-scale chip order with Horizon and incorporated Black Sesame Intelligent’s autonomous driving computing chip in its Denza brand vehicles. Additionally, BYD invested in Zhuoyu Technology, a former DJI vehicle-mounted
energyelectric-vehiclesautonomous-drivingintelligent-driving-solutionsautomotive-chipsBYDclean-technologyBYD Sales Growth Leaves Tesla In The Dust — Charts & Graphs - CleanTechnica
The article highlights the significant sales growth disparity between Chinese electric vehicle (EV) manufacturer BYD and American EV leader Tesla. While Tesla once led the market and maintained a close race with BYD, recent data shows BYD dramatically outpacing Tesla in both overall plugin vehicle sales and battery electric vehicle (BEV) sales. In the second quarter of 2025, BYD sold over 1.1 million plugin vehicles compared to Tesla’s 384,000, and BYD’s first-half sales exceeded 2 million vehicles, more than double Tesla’s approximately 700,000. Notably, BYD’s sales growth is robust and increasing quarter over quarter, whereas Tesla’s sales have stagnated or declined year over year. Focusing specifically on BEVs, BYD’s sales have surged sharply, while Tesla’s BEV sales have declined, signaling diverging trajectories for the two companies. The article suggests BYD is moving strongly in the right direction with accelerating growth, whereas Tesla appears to
energyelectric-vehiclesBYDTeslabattery-electric-vehiclesclean-technologyautomotive-industryMaximising Climate Bank — EIB Operations in Sustainable Transport - CleanTechnica
The European Investment Bank (EIB), committed since 2021 to becoming the EU’s Climate Bank through its Climate Bank Roadmap, plays a crucial role in financing sustainable transport as part of the clean transition. An analysis by Transport & Environment (T&E) of 254 EIB operations from 2021 to early 2025, totaling €61 billion, reveals significant gaps and opportunities. While the EIB has invested heavily in rail (€23.6 billion) and urban mobility (€13.3 billion), which are positive contributions to decarbonization, it has also allocated substantial funds to less sustainable areas. Notably, €7.79 billion went to road infrastructure—mostly new roads—and €1 billion to biofuels, which are considered environmentally problematic. Additionally, airport expansions and port projects largely lack renewable energy integration, sometimes violating the EIB’s own climate commitments. Looking ahead to the 2026–2030 Climate Bank Roadmap, T&E urges the EIB to
energysustainable-transportclean-technologybattery-manufacturingrenewable-energyclimate-financeEuropean-Investment-BankAirlines, e-SAF Producers, and NGOs Get Behind e-SAF - CleanTechnica
The article from CleanTechnica highlights the growing support among airlines, e-Sustainable Aviation Fuel (e-SAF) producers, and NGOs for e-SAF as a critical component in advancing European competitiveness, autonomy, and the clean technology sector. e-SAF offers a significant environmental benefit, with the potential to reduce CO₂ emissions by over 90% compared to conventional fossil jet fuels. Europe is positioned to lead in this area, with 41 announced e-SAF projects that represent a unique opportunity to merge climate goals with industrial innovation and strategic independence. To capitalize on this potential, the article emphasizes the need for the European Union to leverage the Sustainable Transport Investment Plan (STIP) to accelerate e-SAF deployment. Key recommendations include prioritizing e-SAF through a dedicated EU strategy with targeted financial support, maintaining the ReFuelEU regulation’s e-SAF sub-target and associated penalties, and ensuring fair market access and competition. Additionally, the creation of a market intermediary funded by aviation ETS revenues is proposed
energysustainable-aviation-fuele-SAFclean-technologycarbon-emissions-reductionEuropean-Union-energy-policyrenewable-energyCan the New Wave of BEV & PHEV Pickups Boost EV Sales in South Africa? - CleanTechnica
The article highlights the significance of pickups in South Africa’s vehicle market, where models like the Toyota Hilux, Ford Ranger, and Isuzu D-Max dominate sales charts. In June 2025, the Toyota Hilux led with 3,035 units sold, followed by the Ford Ranger and Isuzu D-Max, underscoring the popularity of pickups in the country. Despite this, electric vehicle (EV) adoption remains very low, with battery electric vehicles (BEVs) accounting for only 0.24% of total vehicle sales in 2024 (1,257 units), and plug-in hybrid electric vehicles (PHEVs) making up just 0.14% (737 units). The slow growth is attributed to limited BEV model availability, high import duties, and taxes on EVs. Notably, no BEV or PHEV pickups were available in South Africa until recently, despite pickups being a top-selling segment. The situation is beginning to change in 2025
energyelectric-vehiclesBEVPHEVautomotive-marketSouth-Africaclean-technologyDo You Think Used EV Prices Will Drop By $4,000 In 3 Months? - CleanTechnica
The article discusses the potential impact of the expiration of a $4,000 tax credit for used electric vehicles (EVs) on their resale prices. The tax credit effectively lowers the cost of buying a used EV by $4,000, but some argue that this benefit is simply reflected in higher used EV prices rather than actual savings for buyers. In other words, buyers might pay the same total amount whether the credit exists or not, meaning that once the credit ends, used EV prices could drop by approximately $4,000. The article also highlights the broader market implications if used EV prices do fall. Sellers of used EVs could face significant losses or choose to delay selling their vehicles, which may reduce the availability of used EVs and slow the overall electric vehicle market growth. This dynamic could negatively affect both buyers and sellers, potentially hindering the adoption of electric vehicles. The author invites readers to share their opinions via a poll and plans to report on the results, emphasizing the uncertainty around how much
energyelectric-vehiclesEV-tax-creditused-electric-carsclean-technologysustainable-transportationautomotive-marketWhoops — US EV Tax Credits Ended Sooner Than Expected In Big Bad Budget Bill - CleanTechnica
The recent “One Big Beautiful Bill” (nicknamed the Big Bad Budget Bill) has accelerated the end of U.S. electric vehicle (EV) tax credits, terminating them on September 30, 2025, much earlier than initially anticipated. This change is expected to trigger a surge in EV purchases in the current quarter as consumers rush to take advantage of the incentives before they expire. However, after this date, the U.S. EV market is likely to face a significant downturn due to the loss of these financial incentives. There is speculation that automakers might offset the loss of tax credits by lowering EV prices, but this seems unlikely given that many manufacturers are not yet profitable on their EV programs. Tesla, often seen as a potential beneficiary due to its EV-only lineup, may also struggle since its sales have recently declined and its profit margins have shrunk considerably. The article suggests Tesla may not have the financial flexibility to reduce prices substantially, meaning it too could experience a notable drop in U.S
energyelectric-vehiclesEV-tax-creditsrenewable-energyTeslaautomotive-industryclean-technologyOil Is Going To Take A BIG Hit - CleanTechnica
The article from CleanTechnica discusses the impending significant disruption to the oil industry driven by the rapid rise of electric vehicles (EVs). Although the current automobile fleet remains predominantly powered by oil-based fuels, the share of new vehicle sales that are plug-in electric vehicles has surged from 10% to 25% in a short time, with China recently surpassing 50%. Given China's large role in the global auto market and its aggressive push to sell EVs worldwide, especially in developing countries, the global EV sales rate could quickly reach and exceed 50%. This accelerating transition threatens to substantially reduce oil demand in the near future. The author emphasizes that while the oil industry has not yet felt a major impact, the disruption is imminent and may already be starting to show. Over the coming decade, sustained growth in EV adoption will erode oil’s dominance as the primary economic and political force globally. The article predicts a future of independence from oil’s "fierce, ruthless grip," leading to profound
energyelectric-vehiclesoil-industryclean-technologyrenewable-energymarket-disruptiontransportation-transitionPlans To Assemble Polestar 7 In Slovakia Possible - CleanTechnica
Volvo plans to assemble the upcoming Polestar 7 electric SUV at its new Kosice plant in Slovakia, with production expected to begin in 2026 and the vehicle launch slated for 2028. This marks a strategic expansion of Polestar’s manufacturing footprint beyond its traditional base in China, reflecting a broader global production approach. Slovakia was chosen due to its established automotive industry, skilled workforce, and robust supply chain, hosting major manufacturers like Volkswagen and Kia. The Kosice facility, currently under construction and 60% complete as of mid-2024, will initially produce a next-generation Volvo model before transitioning to Polestar 7 assembly. Polestar, originally Volvo’s performance division, has historically focused manufacturing in China following Geely’s acquisition, with models like the Polestar 1 and 2 produced there. However, recent diversification includes production of the Polestar 3 SUV in both China and the U.S., and the Polestar 4 in China and South Korea. The Polestar
energyelectric-vehiclesautomotive-manufacturingPolestarSlovakiaEV-productionclean-technologyTime For Canada To Dump The Big Three & Go Electric With China - CleanTechnica
The article argues that Canada’s traditional automotive giants—Ford, GM, and Stellantis—are resisting the inevitable shift to electric vehicles (EVs) by urging the government to scrap its zero-emission vehicle mandate. These companies claim financial hardship and technological barriers, effectively seeking to maintain the status quo of internal combustion engine production. The author criticizes this stance as regressive and compares it to outdated industries resisting innovation, warning that such resistance threatens the future prosperity of Canada’s automotive sector. In contrast, China is highlighted as the global leader in EV production, with companies like BYD and Yutong already manufacturing millions of electric vehicles annually and expanding globally, including in countries with emerging automotive industries such as Pakistan. The article points out that Canada, despite its long automotive manufacturing history and previous success attracting Japanese and Korean automakers, has yet to secure a major Chinese EV factory. It suggests that Canada should embrace this opportunity by inviting Chinese EV manufacturers to utilize idle Canadian facilities, thereby revitalizing the industry with
energyelectric-vehiclesautomotive-industryclean-technologyelectric-mobilityChina-EV-marketzero-emission-vehiclesJackery SolarSaga 200W: Powerful, Portable Solar Charging - Now 46% Off! - CleanTechnica
The Jackery SolarSaga 200W Portable Solar Panel is a high-efficiency, durable solar charging solution designed for off-grid adventures and emergency power needs. Featuring advanced monocrystalline solar cells and IBC technology, it achieves a conversion efficiency of up to 24.3%, outperforming typical panels, especially in low-light conditions. Users can connect up to six panels to recharge the Jackery Explorer 2000 Plus power station fully in just 2.5 hours, enabling fast and reliable power for devices like fridges, lights, and communication gear. Built for rugged outdoor use, the SolarSaga 200W is IP68 waterproof and protected by an ETFE-laminated shell, making it resistant to rain, dust, and prolonged sun exposure. It offers easy setup with quick unfolding, three adjustable kickstands, and a SolarTarget sunlight angle indicator for optimal positioning. Weighing just over 18 pounds and folding compactly, it includes an ergonomic handle and a 9.8
energysolar-powerportable-solar-panelrenewable-energyoff-grid-powerJackery-SolarSagaclean-technologyNIO Sales Up 26% Year Over Year - CleanTechnica
NIO’s electric vehicle sales have shown strong growth, with deliveries in June 2025 rising 17.5% compared to June 2024, and a 25.6% increase across the second quarter. In June alone, NIO delivered 24,925 vehicles, totaling 72,056 for the quarter. The company’s sales are now distributed among three brands: the premium NIO brand (14,593 units), the family-oriented ONVO brand (6,400 units), and the high-end FIREFLY brand (3,932 units). Cumulatively, NIO has sold 785,714 vehicles to date, approaching a milestone that might redefine its status beyond a startup. In addition to sales growth, NIO received notable recognition in the 2025 J.D. Power studies, with its ET5 and ET5T models ranking first among mid-size battery electric sedans in China, and the EC6 topping the premium BEV segment. The company has maintained
energyelectric-vehiclesbattery-electric-vehiclesNIOclean-technologyrenewable-energyvehicle-salesA Cheap & Easy Way To Reduce Carbon Emissions From Ships - CleanTechnica
The article discusses the significant carbon dioxide and pollutant emissions produced by ocean-going ships, which exceed those from air travel. Traditional marine engines burn bunker oil, a thick, cheap residual fuel that also serves as the engine’s lubricant, making it difficult and costly to switch to cleaner fuels or retrofit ships with modern engines. Such retrofits are expensive—costing upwards of half a million dollars—and require ships to be out of service for extended periods, creating financial disincentives for shipowners to adopt cleaner technologies. A promising solution comes from a London-based company called Seabound, which has developed an onboard carbon capture system ready for immediate deployment. The system uses steel containers filled with quicklime pellets that chemically react with the ship’s exhaust CO2, converting it into limestone and thereby reducing emissions. Quicklime is a widely produced industrial material, making this approach scalable and practical. The technology was conceived by entrepreneur Alisha Fredriksson, inspired by climate change reports, who adapted existing industrial carbon capture
energycarbon-captureshipping-emissionsmarine-fueldecarbonizationclean-technologyquicklimeBerlin on Verge of Creating Gigantic Car-Free Zone - CleanTechnica
Berlin is on the verge of establishing a massive car-free zone in its city center, potentially becoming one of the largest pedestrian and bike-friendly urban areas worldwide. The proposed zone would be bounded by the Ringbahn, a 22-mile railway encircling central Berlin, making it larger than Manhattan. This initiative, led by the Volksentscheid Berlin Autofrei campaign since 2020, aims to significantly reduce private automobile traffic in the core of the city, promoting human-powered transport like walking and biking to enhance livability and environmental sustainability. Despite strong opposition from pro-car groups and legal challenges from the Berlin Senate—who argued the proposal was unconstitutional, causing a three-year delay—the initiative is moving forward. A recent court decision has cleared procedural hurdles, allowing the campaign to resume signature collection and potentially hold a referendum in 2026. Advocates see this as a crucial step toward transforming Berlin’s transport policy and aligning it with other global cities like Paris and Bogotá, which have successfully reclaimed public spaces for pedestrians and
energyclean-technologyelectric-vehiclessustainable-transportationurban-planningcar-free-zonesgreen-citiesBYD in Midst of Unmatched Flurry of Product Launches in Europe - CleanTechnica
Chinese electric vehicle manufacturer BYD is undertaking an unprecedented series of product launches in Europe, aiming to rapidly expand its presence in the region despite high tariffs on Chinese-built EVs. To circumvent these tariffs, BYD has established a manufacturing facility in Hungary and is preparing to introduce multiple new models tailored specifically for the European market. The company, currently the world’s largest pure electric vehicle seller primarily in China, has already launched six cars in Europe within a year, including the recently introduced Dolphin Surf in the UK. While initial units of the Surf are imported from China, production will soon shift to Hungary to better serve local demand. BYD’s European strategy involves significant localization and adaptation of its vehicles to meet regional preferences, which has delayed some model launches by up to 18 months compared to other markets. Alfredo Altavilla, BYD’s special advisor for Europe, emphasized the company’s commitment to building a dedicated product lineup for Europe, distinguishing BYD from other Asian brands. Beyond the main BYD brand
energyelectric-vehiclesBYDautomotive-industryclean-technologyelectric-car-manufacturingEuropean-marketEthiopia Could Open EV Floodgates Across Africa, Asia, And Beyond - CleanTechnica
Ethiopia made a groundbreaking move last year by banning the import of fossil fuel vehicles, a policy unprecedented not only in Africa but globally. This ban has been maintained and even expanded to include prohibitions on semi knocked down (SKD) and completely knocked down (CKD) kits for fossil-fueled vehicles. The country’s leadership remains committed to this policy despite initial skepticism and potential backlash, signaling strong governmental support for transitioning to electric vehicles (EVs). Ethiopia’s approach is seen as a potential catalyst for other nations, especially those without significant oil and gas industries, to adopt similar measures. The article highlights the growing availability of affordable electric cars, notably from manufacturers like BYD, which are entering more markets and increasing competition. If neighboring countries or others in Africa and Asia emulate Ethiopia’s import ban on fossil fuel vehicles, it could create key markets for EVs and accelerate the global shift toward clean transportation. The author expresses hope that Ethiopia’s example will inspire a broader wave of pro-EV
energyelectric-vehiclesrenewable-energyelectric-carsfossil-fuel-bansustainable-transportationclean-technologyBYD's Profit Margin Looks Quite Good Amidst Price War Allegations - CleanTechnica
The article addresses recent allegations of a "price war" in the Chinese electric vehicle (EV) market, focusing on BYD's pricing strategies. Despite claims from some automakers and scrutiny from China’s Ministry of Industry and Information Technology (MIIT) that BYD’s aggressive price cuts are destructive and unsustainable, evidence suggests otherwise. BYD has maintained a profit margin above 5% in Q1 2025, which is better than most quarters over the past decade, indicating that the company remains profitable even while lowering prices. This challenges the notion that BYD cannot make money at current price levels and supports the argument that cost reductions can be passed on to consumers without sacrificing profitability. The article also highlights that other Chinese automakers like Li Auto, Geely, and Xiaomi are turning profits in their EV segments, with some closing the profitability gap. BYD holds about 15% of China’s overall automotive market, which is highly competitive, and its market share is still smaller than some major
energyelectric-vehiclesBYDautomotive-industryprofit-marginprice-warclean-technologyUV-C LED Disinfection Solutions Company AquiSense Closes Series A Investment - CleanTechnica
AquiSense, a leading provider of UV-C LED disinfection systems, has secured a Series A investment led by Burnt Island Ventures. The company specializes in UV-C LED solutions for disinfecting water, surfaces, and air, addressing critical public health concerns such as waterborne diseases that affect millions globally each year. AquiSense’s product lineup includes the PearlAqua series for water treatment at various scales—from small point-of-use units like PearlAqua Micro and Deca to industrial and municipal systems like PearlAqua Kilo and Tera. Additional products include the PearlLab Beam and ThinFilm™ for precise UV calibration and low UV transmittance applications, as well as the PearlAero™ for air disinfection in environments such as factories, hospitals, and public restrooms. The company’s UV-C LED technology offers significant advantages over traditional mercury-based UV disinfection systems. These benefits include enhanced durability, compact design, longer lifespan with some lamps lasting up to five years, and reduced maintenance through features
energyUV-C-LEDwater-disinfectionair-disinfectionclean-technologysmart-operationindustrial-water-treatmentBloomberg 2025 Electric Vehicle Outlook Report - CleanTechnica
The Bloomberg 2025 Electric Vehicle (EV) Outlook Report, produced by Bloomberg New Energy Finance (BNEF), provides a comprehensive global analysis of the EV market, covering vehicle sales, oil markets, electricity demand, charging infrastructure, batteries, metals, and CO2 emissions. The report highlights that plug-in EVs are projected to account for one in four new passenger vehicles sold worldwide in 2025, with China leading the market by having EVs cheaper on average than comparable combustion vehicles. In China, extended-range plug-in hybrid sales surged over 83% in 2024, driven largely by rural customers purchasing SUVs with substantial electric-only range, reflecting strong EV adoption despite limited charging infrastructure. However, the report also identifies challenges ahead, particularly in the US and Europe. The cost of public fast charging has risen sharply since 2022, now matching or exceeding gasoline prices, which undermines the economic incentives for EV adoption where purchase prices remain higher than conventional cars. Battery production is dominated by
energyelectric-vehiclesEV-chargingbatteriesrenewable-energyelectric-mobilityclean-technologyPower Anywhere: This Jackery Solar Generator Bundle Is Nearly 50% Off Right Now - CleanTechnica
The article highlights a significant discount on the Jackery Solar Generator 1000 v2 bundled with a 200W SolarSaga solar panel, currently available for nearly 50% off its usual $1,299 price. This portable power solution offers 1,070Wh capacity and 1,500W continuous output (3,000W surge), powered by a durable LiFePO₄ battery rated for over 4,000 charge cycles. It supports fast charging—about 1 hour from a wall outlet and roughly 3 hours from solar under ideal conditions—making it highly convenient for emergencies, outdoor activities, or off-grid use. The unit is compact (23.8 lbs), rugged, quiet, and manageable via a dedicated app. The bundle is ideal for campers, overlanders, remote workers, homeowners needing backup power during outages, and clean energy advocates seeking a gas-free, renewable power source. The article emphasizes the rarity of such a high-quality solar generator setup being offered below $
energysolar-powerportable-generatorLiFePO4-batteryrenewable-energyoff-grid-powerclean-technologyTesla & Musk — Tied at the Hip, and the Mouth - CleanTechnica
The article "Tesla & Musk — Tied at the Hip, and the Mouth" by eveee, published on CleanTechnica, explores how Elon Musk’s personal ideology and leadership style have deeply influenced Tesla’s corporate identity and public perception. Musk’s conservative libertarian beliefs, emphasizing individualism and “free speech absolutism,” shape his management approach, which is described as highly centralized, paranoid about losing control, and dismissive of authority, regulation, and employee rights. This founder-driven style, rooted in an Ayn Rand-inspired philosophy, has led Musk to treat Tesla as a small personal venture rather than a mature, large company, hindering its ability to evolve with seasoned leadership. The article highlights how Musk’s personality and political actions have negatively impacted Tesla’s reputation and sales, particularly in Europe. For example, Tesla’s failure in Sweden is attributed to Musk’s disregard for the country’s strong cultural commitment to unions and collective bargaining, which soured public opinion well before controversies in Germany, France, and
energyelectric-vehiclesTeslaElon-Muskclean-technologyrenewable-energyautomotive-industryTop BYD Exec Says Chinese EV Price War "Not Sustainable" & "Not Healthy" - CleanTechnica
The article discusses the ongoing price war among Chinese electric vehicle (EV) manufacturers, highlighting concerns about its sustainability and impact on the industry. Chinese automakers have been aggressively cutting EV prices, with BYD recently reducing prices on up to 22 models by as much as 30%. While BYD remains profitable and continues to grow—reporting about 15% growth in early 2025 and aiming for 30% growth with a 5.5 million vehicle sales target—it acknowledges that the current price war is "not sustainable" or "healthy." Most other Chinese EV makers, unlike BYD and Tesla, are still losing money on their EV operations, and the intense price competition is hurting overall profitability. Chinese regulators, including the Ministry of Industry and Information Technology (MIIT), have warned automakers to halt the price war to prevent further damage to the industry, signaling potential intervention. Meanwhile, BYD is pursuing aggressive international expansion, planning to invest $20 billion in Europe to establish a strong
energyelectric-vehiclesBYDautomotive-industryprice-warclean-technologyEV-marketCall Upon the French, Spanish, and Portuguese Governments to Improve Cross-Border Rail Connections - CleanTechnica
The article from CleanTechnica highlights a call from global and Iberian business travel associations, along with the logistics company Transfesa, urging the French, Spanish, and Portuguese governments to improve and complete key cross-border rail connections. The focus is on enhancing international train links between these countries to facilitate more sustainable travel options. Traveling by train instead of flying can reduce emissions by over 90% on certain routes, making rail a significantly greener alternative for business travel. However, the current lack of competitive and efficient international rail connections between France, Spain, and Portugal hampers efforts by businesses to reduce their carbon footprint by choosing trains over planes. The article emphasizes that better rail infrastructure and services are essential to support the shift toward less polluting transportation modes, thereby contributing to broader environmental goals. The piece also includes a brief mention of CleanTechnica’s newsletters and community engagement but primarily centers on the environmental and logistical benefits of improved cross-border rail travel in the Iberian region.
energytransportationsustainable-travelelectric-trainsemissions-reductioncross-border-railclean-technologyTrump’s 2025 R&D Retreat Ignores Key Lessons from "The Entrepreneurial State" - CleanTechnica
The article critiques the Trump administration’s 2025 plan to reduce government R&D investment, contrasting it with insights from Mariana Mazzucato’s 2024 book, which highlights the essential role of state-led innovation in driving transformative technologies. Mazzucato challenges the common belief that breakthrough innovation is primarily driven by private firms, emphasizing that governments have historically borne the significant risks of early-stage, radical research. She provides examples such as the internet, biotechnology, and pharmaceuticals, where foundational technologies were developed and funded by public agencies long before private companies commercialized them. Venture capital, often celebrated as a key innovation driver, typically enters later in the cycle, focusing on scaling rather than pioneering uncertain technologies. The article further illustrates how critical energy technologies like solar panels, wind turbines, and lithium-ion batteries emerged from decades of patient government R&D, underpinning companies like Tesla. Even the shale gas boom, commonly viewed as a free-market success, relied heavily on federal funding for early hydraulic fracturing research.
energygovernment-fundinginnovationR&Dclean-technologysolar-energylithium-ion-batteriesWhy Clean Equals Competitive When Building Canada’s Trade Alliances Beyond the US - Clean Energy Canada
The article from Clean Energy Canada highlights the urgent need for Canada to diversify its trade alliances beyond the United States in response to deteriorating trust and unpredictable trade policies under the Trump administration. Canada is well-positioned to pivot towards global markets, as it holds trade agreements covering 60% of the global economy. Importantly, Canada’s top non-US trade partners have committed to net-zero emissions, implemented carbon pricing, and are adopting carbon border adjustments and electric vehicle (EV) requirements. These policies signal a global shift away from fossil fuels toward clean energy, creating growing demand for low-carbon products and technologies. Canada’s competitive advantage lies in its abundant clean energy resources, low electricity costs, and rich deposits of critical minerals essential for clean technology, such as cobalt, lithium, nickel, and copper. The country’s renewable energy capacity has expanded significantly and continues to attract substantial investment, with Indigenous partnerships playing a key role. The global market for clean energy technologies is projected to nearly triple by 2035, offering Canada an opportunity to grow its clean economy, support domestic demand, and increase exports. To capitalize on this, the article recommends a coordinated industrial policy focused on industries that align with net-zero goals, trade diversification, and building domestic clean supply chains using Canadian resources and expertise. In summary, Canada’s future economic competitiveness hinges on embracing clean energy and leveraging its natural and technological assets to meet the evolving demands of global trade partners committed to sustainability. This strategic shift will help Canada reduce reliance on the US market, enhance energy security, and position the country as a leader in the global clean economy.
clean-energyrenewable-energycarbon-pricingelectric-vehiclesclean-technologyenergy-policylow-carbon-economyMore Bad News For Tesla, EV Charging Edition
The article discusses recent challenges and shifts in the U.S. electric vehicle (EV) charging landscape, highlighting setbacks for Tesla alongside emerging competitors. Early in the year, the Biden administration canceled federal funding for public EV charging stations, casting uncertainty over the EV sales environment. Tesla, long considered the industry leader with its proprietary Supercharger network, has faced brand reputation issues partly due to CEO Elon Musk’s controversial decisions, including significant staff changes in the charging division. Notably, the New Jersey Turnpike Authority replaced Tesla Superchargers at key service areas with Universal Open Access chargers from Dublin-based Applegreen Electric, signaling a shift away from Tesla’s exclusive network. Applegreen Electric is aggressively expanding its footprint in the U.S., securing contracts beyond New Jersey, including with the Pennsylvania Department of Transportation for the Pennsylvania Turnpike. Despite federal funding cuts, several states had already secured funding before the cancellation, allowing Applegreen to win most contracts for new chargers along major highways like I-76. The article also notes Tesla’s missed opportunities in the electrification market, such as delays in launching electric trucks and neglecting the convenience store (c-store) segment, which integrates EV charging with traditional fuel stops and amenities. Applegreen’s parent company is capitalizing on this by installing EV chargers at numerous convenience and fuel stations across the Midwest, Northeast, and parts of the Southeast, positioning itself as a key player in the evolving EV infrastructure ecosystem.
energyelectric-vehiclesEV-charging-stationsTeslarenewable-energytransportation-infrastructureclean-technologyOn Tesla, Irrational Support, & Irrational Hate - CleanTechnica
The article "On Tesla, Irrational Support, & Irrational Hate" from CleanTechnica presents two thoughtful perspectives on the polarized views surrounding Tesla. Larry Evans argues that Tesla has long enjoyed irrational support, leading to distorted perceptions where objective criticism is misinterpreted as hate. He highlights examples such as disproportionate state subsidies for solar manufacturing, exclusive contracts for Tesla chargers on state property, and Tesla’s high price-to-earnings ratio despite declining financial metrics. Evans contends that calls for Tesla to meet agreed-upon obligations or for a market correction are reasonable and not driven by irrational animosity. He suggests that the focus should shift toward other clean technology companies rather than continuing to idolize Tesla. The second perspective, from a user named Taycan, critiques Tesla’s recent management and product performance. They question Tesla’s lack of successful product launches in recent years and criticize CEO Elon Musk’s controversial actions and mismanagement, which they believe have damaged the company’s reputation and operations. Taycan notes that while Tesla’s early efforts helped establish the battery electric vehicle (BEV) sector, the company now faces challenges as the industry matures and competition intensifies. This view reflects growing skepticism even among Tesla’s former supporters, emphasizing the need for Tesla to prove its leadership through sustained innovation and sound management. Overall, the article underscores the complexity of public sentiment toward Tesla, balancing recognition of its early contributions to clean technology with calls for more objective evaluation of its current performance and governance. It encourages moving beyond polarized views to foster a broader focus on the evolving clean tech landscape.
energyclean-technologyTeslasolar-manufacturingelectric-vehiclesstate-subsidiescharging-infrastructureHating on Tesla vs. Objective Realism - CleanTechnica
The article from CleanTechnica reflects on Tesla's evolving trajectory over the past 13 years, highlighting a shift from its early days of visionary growth to recent challenges. Initially, Tesla experienced rapid expansion fueled by strong consumer demand for affordable, long-range electric vehicles like the Model 3 and Model Y, validating early optimistic coverage despite widespread skepticism. However, in recent years, Tesla's sales growth has stalled and even declined, with increasing competition eroding its market share. The article notes that Tesla fans often rationalize these setbacks with hopes for future breakthroughs, but the current reality suggests a departure from Tesla’s original growth story. Additionally, the article discusses Elon Musk’s increasingly controversial political involvement, which has alienated various groups, including both critics and some supporters. Musk’s public behavior and focus have shifted significantly compared to a decade ago, raising questions about his leadership and the company’s direction. While some remain hopeful about Tesla’s potential in emerging sectors like robotaxis, AI, and robotics, these represent a significant departure from Tesla’s initial business plan and require a leap of faith. The article emphasizes the importance of objective realism, acknowledging that Tesla and Musk have changed, and that recognizing current challenges is not hatred but a necessary assessment of the company’s status.
energyelectric-vehiclesTeslabattery-technologyrenewable-energyautomotive-innovationclean-technologyThe Bomb That Will Hit The US Solar Industry From The "Big Beautiful Bill" - CleanTechnica
The article from CleanTechnica critiques a Republican budget bill, labeling it a "Big Ugly Bill" that threatens the clean technology sector, particularly the solar industry. The author argues that the bill aims to undermine the progress made under President Biden by targeting electric vehicles, wind, and solar energy initiatives. The Solar Energy Industries Association (SEIA) warns that the legislation could lead to the loss of over 100,000 jobs in the solar and storage sectors across the U.S., with significant job losses projected in Republican-led states like Texas and Florida. The bill could also result in the closure of 331 factories and a loss of $286 billion in local investments. The article emphasizes the detrimental impact of the proposed legislation on American families and the economy, suggesting that it contradicts the notion of "Making America Great Again." It highlights the historical support of Republican politicians for fossil fuels over clean energy, indicating a lack of concern for the adverse effects on their constituents. While there is a slim possibility that some Republican lawmakers may advocate for pro-solar policies, the author expresses skepticism about any positive outcomes, suggesting that the situation is likely to worsen for the clean technology industry.
energysolar-industryclean-technologyjob-lossrenewable-energylegislationfossil-fuelsVolkswagen Sponsors Women’s EURO 2025, Features ID. Family - CleanTechnica
electric-vehiclesEVsrenewable-energyVolkswagenEURO-2025clean-technologyautomotive-industryFord F-150 is Top Selling Electric Truck in USA — in May and All Time - CleanTechnica
electric-vehiclesFord-F-150-Lightningenergyclean-technologyelectric-truckssustainable-transportationautomotive-innovationBYD Is Suing 37 Influencers - CleanTechnica
energyelectric-vehiclesBYDclean-technologyrenewable-energyautomotive-sectorlegal-actionAnother Electric Vehicle Benefit: No Motor Oil Leaks - CleanTechnica
energyelectric-vehiclespollutionmotor-oilenvironmental-impacttransmission-fluidclean-technologyTorque, Trails, & Tech: Bakcou’s Puma X22 & X24 Lead The E-Moto Pack - CleanTechnica
energyelectric-motorcycleslithium-ion-batterye-motoclean-technologysustainable-transportpowertrainFully Solar-Powered Off-Grid EV Charging Station in South Africa - CleanTechnica
solar-powerEV-chargingrenewable-energyoff-gridclean-technologyenergy-storagesolar-arrayWho and How Can Help Indonesia Clean Up Its Minerals Act - CleanTechnica
energymineralssustainabilitysupply-chainclean-technologyIndonesiaelectric-vehiclesLet’s Talk About Small Modular Reactors - CleanTechnica
nuclear-energysmall-modular-reactorsclean-technologyrenewable-energyenergy-productionclimate-changeelectricity-generationBeyond the Hydrogen Mirage: A Candid Conversation with Joe Romm - CleanTechnica
energyhydrogencarbon-capturesustainabilityclimate-solutionsmethaneclean-technologyBYD's Commercial Vehicle Sales Up 531% in May — CHARTS - CleanTechnica
energyelectric-vehiclescommercial-vehiclesBYDsales-growthclean-technologytransportationThe 1st Electrostate, BYD Enters Argentina, EPA's Attack on Science — Top 12 Stories of the Week - CleanTechnica
energyclean-technologyelectric-vehiclessolar-powerrenewable-energyBYDEPAB.C. climate action has reduced emissions, with economic success - Clean Energy Canada
energyemissions-reductionclean-technologyelectric-vehiclesclimate-actionrenewable-energycarbon-taxUS Hybrid Vehicle Sales Continue to Rise as Electric & Plug-in Vehicle Shares Remain Flat — GRAPHS - CleanTechnica
energyelectric-vehicleshybrid-vehiclesbattery-electric-vehiclesplug-in-hybridsclean-technologyautomotive-trendsRoad Tripping To A Cleaner Future: Your Company’s Gear Could Be Part Of Our Next Big Story! - CleanTechnica
energysustainable-livingelectric-vehiclesclean-technologyenergy-efficiencysolar-poweroutdoor-gearElectric Vehicles Top 5 Vehicle Classes in California — CHARTS - CleanTechnica
energyelectric-vehiclesEV-salesTeslaautomotive-industryclean-technologysustainable-transportationThe Basics of IRA Subsidies and Why It’s Stupid to Kill Them - CleanTechnica
energyelectric-vehiclessolar-powersubsidiesInflation-Reduction-Actclean-technologyfossil-fuelsIf Tesla Falls, Would That Hurt The EV Revolution? - CleanTechnica
robotEVTeslarobotaxisenergyclean-technologyautomotiveTrump’s Harvard Ban Echoes USSR’s Historic Mistake To China's Long-Term Gain - CleanTechnica
energyclean-technologysolar-energyelectric-vehiclesgeopolitical-influenceclimate-scienceenergy-storageThe Actual Reason the Tesla Cybertruck Has Failed? - CleanTechnica
energyelectric-vehiclesTeslaCybertrucksolid-state-batteriesElon-Muskclean-technologyPrime minister’s mandate letter creates clear opportunities for building a cleaner, more affordable Canada - Clean Energy Canada
clean-energyelectric-vehiclessustainable-constructioncarbon-pricingenergy-efficiencyrenewable-resourcesclean-technologySenate votes to revoke California’s ability to set air pollution standards
energyzero-emissionselectric-vehicleshydrogen-fuel-cellsCalifornia-emissions-standardsenvironmental-policyclean-technologyNew EV charging platform enhances vehicle-grid communication in US
EV-chargingvehicle-to-gridelectric-mobilityenergy-distributionsmart-chargersclean-technologybidirectional-chargingChina Dominates Global Trade of Battery Minerals - CleanTechnica
battery-mineralslithiumcobaltgraphitebattery-supply-chainenergy-storageclean-technologyCalifornia EV Sales Stay Strong, Model Choice Skyrockets - CleanTechnica
energyelectric-vehicleszero-emission-vehiclesCalifornia-EV-marketclean-technologyautomotive-trendssustainable-transportationNew CO₂-capturing battery stores 2.5x more energy, could power mars gear
energyCO₂-capturelithium-batteryrenewable-energyenergy-storageclean-technologyMars-explorationLegion44 CDR Movie Continues To Gather Global Momentum - CleanTechnica
energycarbon-removalclimate-changeclean-technologysustainabilityenvironmental-awarenessinnovationA New Flow Battery Takes On The Data Center Energy Crisis
energyflow-batteryrenewable-energyenergy-storagedata-centerssustainable-technologyclean-technologyTwo New Renewable Energy Technologies That Just Might Work - CleanTechnica
renewable-energyenergy-storagepumped-hydroocean-energyFraunhoferStEnSeaclean-technologyIs Xi Jinping Controlling Chinese Made Solar Panels In The US?
solar-panelsrenewable-energyIoTcommunication-deviceselectric-vehiclesover-the-air-updatesclean-technologyTesla Brand Image Plunges Amidst Regulatory Questions & Competitors’ Rising Approval Ratings
energyelectric-vehiclesTeslaautomotive-industryclean-technologyrenewable-energymarket-trendsUtility-Scale Outshining Rooftop Solar As Global Solar Market Explodes
energysolar-powerrenewable-energyutility-scale-solarelectricity-generationphotovoltaic-systemsclean-technologyThe Best Solar Power Countries in the World Will Shock You
solar-powerrenewable-energyphotovoltaicelectricity-generationenergy-independencesolar-capacityclean-technologyChinese Solar PV Market More Than 3 Times Bigger Than US & EU Markets Combined
solar-energyphotovoltaicrenewable-energyChinaenergy-marketsolar-marketclean-technologyUruguay EV Sales Report: At 17.6% BEV Market Share in April, We Have a New Leader in Latin America!
energyEVBEVmarket-shareelectric-vehiclesUruguayclean-technologyThe Hype Returns: Joe Romm & Michael Barnard Revisit Hydrogen, 20 Years Later
energyhydrogenclimate-changesustainabilityclean-technologyemissions-reductionrenewable-energyJob posting: Policy Analyst
clean-energyrenewable-energyclimate-actionenergy-policyclean-technologyenergy-transitionsustainabilityA Desert Journey With Heybike’s ALPHA Mid-Drive Fat Tire E-Bike
energye-bikemid-drive-motorelectric-bikesustainable-transportationfat-tire-bikeclean-technologyHow To Build A Non-Disposable EV
energyelectric-vehiclessustainabilitylongevityclean-technologyautomotive-innovationplanned-obsolescenceIEA Global EV Outlook 2025 Shows US Falling Further Behind On Electric Cars
energyelectric-vehiclesEV-salesrenewable-energyIEAclean-technologybattery-technologyVolvo’s 1st Extended-Range Electric Vehicle Coming Soon
energyelectric-vehicleplug-in-hybridVolvosustainable-transportationclean-technologyautomotive-innovationThúc đẩy chuyển dịch năng lượng tái tạo Việt Nam chủ động tìm lời giải công nghệ và chính sách
energyrenewable-energyVietnamenergy-policysustainable-developmentenergy-transitionclean-technologyWill Hydrogen Fuel Cell Trucks Just Follow The Hydrogen Car Storyline?
hydrogenfuel-cellstrucksbattery-electricenergytransportationclean-technologyThe EV Benefit on Road Trips You Really Can’t Talk About
energyelectric-vehiclesEV-chargingroad-tripsclean-technologysustainable-travelconvenienceWinners of Solar District Cup Class of 2024–2025 Announced
solar-energyrenewable-energyenergy-innovationenergy-managementsolar-storageclean-technologyenergy-competition4 Months with the Chery Omoda E5
energyelectric-vehiclebattery-managementclean-technologysustainable-transportationautomotive-technologyChery-Omoda-E5Tiny But Mighty: The MARBERO 30W Solar Panel Is A Steal At 59% Off
solar-energyrenewable-energysolar-panelenergy-efficiencyportable-chargerclean-technologysustainable-energyUK Startup IDs A New Hope For Algae Biofuel: Carbon-Negative Production
energybiofuelcarbon-capturerenewable-energymicroalgaeclean-technologygreenhouse-gas-emissionsSurging Solar Power, Booming EV Sales, & Robotaxi Safety — Top 12 Stories of the Week
robotIoTenergysolar-powerelectric-vehiclesrobotaxisclean-technologyMyths, Misinformation, & Misunderstandings About EV Charging & Range
energyEV-chargingbattery-managementelectric-vehiclescharging-mythsrange-misconceptionsclean-technologyThe Auto Industry Does Potentially Have A Sales Crisis Coming With EVs — But It’s Not What You Think
electric-vehiclesEV-salesautomotive-industrylong-term-reliabilityelectric-powertrainsclean-technologymarket-demandMercedes-Benz EV Fast Chargers Rolling Into A Town Near You
energyEV-chargingrenewable-energyclean-technologyMercedes-Benzelectric-vehiclescharging-networkThe Real Impact Of Power Station Alternator Chargers
energysolar-powerpower-stationclean-technologyhybrid-systemsvehicle-chargingoutdoor-recreationEVs take 97.4% share in Norway
energyelectric-vehiclesNorwaybattery-electric-vehiclesclean-technologyautomotive-industrysustainable-transportationWhat’s Required To Install A Source Hydropanel?
energywater-harvestingclean-technologysustainable-livingoff-grid-solutionshydropanelsinstallation-processEV Sales Trends in Europe & Globally, + Tesla’s Potential Sales Crises (VIDEO)
electric-vehiclesEV-trendsrenewable-energyTeslaBYDVolkswagenclean-technologyEcoFlow STREAM Ultra: A Game-Changer For Plug-&-Play Home Solar Systems
energysolarbattery-storageclean-technologyresidential-energymodular-designrenewable-energyU.S. Sustainable Aviation Fuel Production Takes Off As New Capacity Comes Online
energysustainable-aviation-fuelbiofuelsrenewable-energyU.S.-energy-policyclean-technologyalternative-fuelsMaking EU State Aid Work for Clean Manufacturing
energyclean-technologyindustrial-decarbonisationEU-state-aidclimate-neutralityrenewable-energysustainable-manufacturingGlobal EV Sales — EVs Now 21% of World Auto Sales in 2025
energyelectric-vehiclesEV-saleselectrificationbattery-electric-vehiclesautomotive-marketclean-technologyCosta Rica’s EV Market in 2024: A Review for the Leader of the Americas
energyelectric-vehiclesEV-marketbattery-electric-vehiclessustainable-transportationclean-technologyCosta-RicaDerelict Petrol Station Transforming Into An EV Charging Hub
electric-vehiclesEV-chargingsustainable-transportationrenewable-energyclean-technologyenergy-transitionurban-regenerationGreening My Life: What’s Done, & What’s Left To Do
energysolar-powerrenewable-energyenergy-efficiencyelectric-vehiclesnet-meteringclean-technologyHow Do You Sell an EV into Australia’s Crowded Market?
energyelectric-vehiclesEV-marketingfast-chargingclean-technologyAustralian-marketautomotive-innovationTesla Cybertruck Review After 15,000 Miles
robotIoTenergyautonomous-vehiclesTeslaCybertruckclean-technologyRevving Up Refurbished E-Bikes: Upway Expands With Los Angeles UpCenter
energye-bikessustainable-transportationcircular-mobilityurban-mobilityrefurbished-bikesclean-technologyTrump Attacks on Loan Program that Sustained Tesla, EV Charging Program, Fuel Economy Standards — What Next?
energyelectric-vehiclesclean-technologyrenewable-energyfossil-fuelsbattery-productionEV-chargingCosta Rica achieved the highest EV market share in the Americas for the third consecutive year in 2024
electric-vehiclesEV-marketCosta-Ricarenewable-energytransportationclean-technologymarket-shareXPENG Sales Up 313% in 2025!
electric-vehiclesXPENGsales-growthrenewable-energyADASurban-drivingclean-technologyEarly Owner Reviews of Volkswagen ID. Buzz — CleanTechnica Video
energyelectric-vehiclesVolkswagen-ID.-Buzzclean-technologyEV-chargingsustainable-transportationElectrify-AmericaSuper-Efficient Air Conditioning Technology Slashes Energy Costs
energyair-conditioningelectricity-consumptionCO2-emissionsclean-technologyclimate-changeenergy-efficiencyBidgely Surpasses 1.5 TWh of Energy Savings, Offsetting 1M Tons of CO2 Emissions
energyenergy-efficiencyCO2-emissionselectric-vehicleshome-energy-managementcustomer-engagementclean-technologyBYD Launches In Benin, Seychelles, Croatia, Slovakia, & Cambodia, Plus The World’s Largest Car Carrier!
energyelectric-vehiclesBYDclean-technologytransportationsustainable-mobilitymarket-expansionRepublicans Want A New $250 Tax On Electric Vehicles
energyelectric-vehiclestax-policytransportationclean-technology$2.5 Billion Says US Just Can’t Quit Renewable Energy
renewable-energyclean-powerwind-energysolar-energyUS-energy-policyenergy-marketclean-technology1 Millionth Electric Vehicle Rolls off the Production Line at the Volkswagen Plant in Zwickau
energyelectric-vehiclesVolkswagensustainable-transportationautomotive-industrye-mobilityclean-technologyBYD Seagull to Start Production in Brazil Next June
energyproductionBYDBrazilclean-technologyelectric-vehiclesmanufacturingPanasonic Steps Away From Solar & Storage, Ends EverVolt Line
energysolarbattery-storagePanasonicrenewable-energyclean-technologyresidential-energyWaymo & Toyota May Collaborate On Autonomous Cars
WaymoToyotaautonomous-vehiclesride-hailingcollaborationclean-technologyself-driving-carsBYD Dolphin Mini, The Car the US Will Never Have, Secures World Urban Car Award
BYDDolphin-MiniWorld-Car-Awardelectric-vehiclesautomotive-industryclean-technologyurban-mobilityLike It or Not, EVs are Going to Stay
EVselectric-vehiclesautomotive-industryclean-technologysustainabilityNew-York-International-Auto-Showtransportation-trendsHeybike Has Unbeatable Mother’s Day E-Bike Deals & Free Gifts
Mother's-Daye-bike-dealsHeybikeclean-technologygift-ideasonline-shoppingpromotionsImagining The Electric Miata
Electric-vehiclesMazda-Miatasports-carsclean-technologyautomotive-innovationelectric-conversionroadstersWhy Did Tesla Stock [TSLA] Rise Again?
TeslaTSLAstock-marketclean-technologyfinancial-analysiselectric-vehiclesinvestment-trendsCommunity Solar Could Spark $120 Billion In US Economic Growth
community-solareconomic-growthrenewable-energysolar-powerUS-economyclean-technologysustainabilityLow-Cost Electric Carshare Program Launched In Charlotte
electric-vehiclescarshare-programsustainable-transportationCharlotteclean-technologyurban-mobilitylow-cost-transportationVolvo Cars Starts Production of Best-Selling EX30 Electric SUV in Europe
VolvoEX30electric-SUVclean-technologyautomotive-industryEuropemanufacturingWaymo’s Not-So-Secret Weapon for Rapid Growth
Waymoautonomous-vehiclestechnologytransportationgrowth-strategyclean-technologymarket-shareEcoFlow Wave 3 & Glacier Classic: Cool Comfort, Anywhere You Go
EcoFlowportable-air-conditionerportable-refrigeratorclean-technologyrenewable-energyoutdoor-livingclimate-controlCan-Am Releases Two New Electric Motorcycles
Can-Amelectric-motorcyclessustainable-transportationelectric-vehiclesclean-technologyautomotive-innovationvehicle-electrificationDrone Swords Into Ploughshares: How Ukraine’s Wartime Expertise Can Reshape Farming
drone-technologyUkraineagriculturewartime-innovationfarming-solutionsclean-technologysustainability