Articles tagged with "energy"
Why HVDC Export Cables Are An Underappreciated Risk In Offshore Wind - CleanTechnica
The article highlights the often-overlooked risks associated with High Voltage Direct Current (HVDC) export cables in offshore wind projects. While much attention is given to turbines and their components, the HVDC export system—critical for transmitting power over long distances—carries significant delivery and recovery risks that are not adequately appreciated. As offshore wind farms grow larger and farther from shore, HVDC technology becomes necessary due to its efficiency over long subsea distances compared to HVAC. However, despite its technical maturity, HVDC cables are vulnerable to faults that can cause substantial outages, removing large portions of a wind farm’s output in a single event. Key data from industry surveys and European experience indicate that subsea HVDC cable faults, though infrequent (about 0.07 to 0.10 faults per 100 km-years), have long repair times averaging around 60 days. Over the typical lifespan of a 150 km export cable (about 25 years), this translates into an expected 2 to
energyoffshore-windHVDC-cablessubsea-transmissionrenewable-energypower-transmissionelectrical-infrastructureBallard’s 500 Fuel Cell Deal Meets A Hydrogen Bus Market That Never Arrived - CleanTechnica
The article discusses a recent announcement by Ballard Power and New Flyer regarding a commercial arrangement for 500 fuel cell engines intended for hydrogen transit buses starting in 2026. While this sounds like a significant market commitment, the deal is described more as an aspirational framework than a firm purchase order or backlog. The North American hydrogen transit bus market remains small and uneven, with annual orders peaking at 288 buses in 2023 but expected to decline sharply to 45 by 2025. This limited demand contrasts with the impression given by aggregated data sources that mix buses ordered, funded, delivered, or deployed, which tend to overstate market size and stability. The article highlights that the hydrogen bus market is heavily concentrated in California, which accounts for about 80% of the U.S. pipeline of fuel cell buses, with only a small number spread across other states. Despite subsidies like the U.S. Inflation Reduction Act supporting hydrogen technologies, enthusiasm and orders for hydrogen buses have cooled rapidly since
energyhydrogen-fuel-cellsfuel-cell-busesclean-energypublic-transportationsustainable-transporthydrogen-economyTrump Makes The Case For Maritime Wind Power Even Better
The article highlights how recent geopolitical tensions, specifically US President Donald Trump's conflict with Iran, have inadvertently strengthened the case for locally produced maritime wind power. Despite Trump's well-known opposition to wind turbines, the situation underscores the strategic need to reduce reliance on fossil fuels in shipping, thereby benefiting emerging wind propulsion technologies. These technologies, broadly categorized as "hard sails" or rigid sails, capture wind energy to propel cargo ships, reducing emissions and fossil fuel use. Among notable advancements, UK startup GT Wings has partnered with Chinese firm Zunsion Technology to mass-produce its Jet Sail system, branded as AirWing. This innovative hard sail improves performance by manipulating airflow and is designed to be space-efficient and operable even on ships with limited deck space. GT Wings emphasizes that wind-assisted propulsion systems not only reduce fuel consumption but also help ships comply with evolving EU and IMO environmental regulations, potentially avoiding costly penalties. Additionally, Finnish company Norsepower is advancing rotor sail technology, with its new third-generation Norsepower Wind
energywind-powermaritime-technologyrenewable-energyshipping-industrysustainable-propulsionclean-energyNew York Build Expo: Heat Pumps Take Center Stage - CleanTechnica
At the New York Build Expo held at the Javits Center, heat pumps emerged as the central technology trend, akin to the prominence of AI at CES. Major industry players such as Midea, GE/Haier, Gree, Daikin, and Bosch showcased a wide variety of heat pump systems designed to meet diverse building needs, from window units and interior-only systems to residential outdoor units and industrial-scale solutions for high rises. These products addressed challenges like the lack of ductwork in older buildings, aesthetic considerations, and replacing traditional radiators. Complementary technologies focused on upgrading air handlers, plumbing, and building insulation to optimize heat pump efficiency, particularly given their lower temperature output compared to steam or combustion heating. A significant driver behind the heat pump emphasis is New York City’s Local Law 97, which imposes strict carbon emission limits on large buildings and levies substantial fines for non-compliance, incentivizing building owners to adopt cleaner heating technologies. The law’s impact is expected to influence other regions
energyheat-pumpsclean-technologyHVACbuilding-insulationrenewable-energyenergy-efficiencyStellantis EVs Get Tesla Supercharger Access - CleanTechnica
Stellantis has expanded access for its North American battery-electric vehicle (BEV) owners—including Dodge, Jeep, Ram, FIAT, and Maserati models—to more than 27,500 Tesla Supercharger locations. Starting in 2024, these customers can use Tesla V3 and V4 Superchargers via a Free2move Charge North American Charging System (NACS)-CCS1 DC adapter, which is available for purchase at certified dealerships and Mopar.com. This move follows a broader industry trend where multiple automakers, prompted by Ford’s successful negotiation with Tesla, have agreed to open their EVs to Tesla’s Supercharger network, leveraging Tesla’s widely praised charging infrastructure. The compatibility covers various 2024 to 2026 model years across Stellantis brands, with the 2027 Dodge Charger Daytona being the first Stellantis vehicle to feature a built-in NACS charging port, eliminating the need for an adapter. This development marks a significant shift in the U.S. EV
energyelectric-vehiclesTesla-SuperchargerStellantisEV-chargingNorth-American-Charging-Standardbattery-electric-vehiclesScientists develop brain-inspired chip to cut AI energy use by 70%
Researchers at the University of Cambridge have developed a novel brain-inspired memristor chip using a specialized hafnium oxide thin film, which could reduce AI energy consumption by up to 70%. Unlike conventional computer chips that waste energy transferring data between memory and processors, this memristor mimics the brain’s synapse by processing and storing information in the same place. The device achieves this through stable, low-energy switching at an interface regulated by internal p-n junctions created with strontium and titanium, avoiding the unpredictable conductive filaments used in older memristors. This results in outstanding uniformity, reliability, and the ability to support hundreds of distinct electrical states necessary for advanced analog in-memory computing. The new memristor operates with switching currents a million times smaller than previous technologies and demonstrates durability over tens of thousands of cycles while retaining data for about a day. It also replicates biological learning processes like spike-timing dependent plasticity, enabling hardware that can learn and adapt rather than merely store information
energymaterials-sciencememristorneuromorphic-chipAI-hardwarelow-energy-computinghafnium-oxideMy College Dream Car Might Go Electric! - CleanTechnica
The article reflects on the author’s youthful admiration for the BMW Z4, a sporty, fun car that held personal significance but lacked environmental consideration at the time. The Z4, known for its front-engine, rear-wheel-drive layout, is now nearing the end of its current generation, with a “Final Edition” marking its phase-out. BMW has not announced a direct successor yet, and the future of the Z4 platform remains uncertain as both BMW and Toyota have discontinued related models. However, BMW Senior Vice President Bernd Körber hinted that electrification could be in the Z4’s future, stating that electric vehicles (EVs) have a place in sports cars, though an electric Z4 is not expected imminently. This suggests BMW may eventually release an electric version of the Z4, aligning with broader industry trends toward EVs, but likely not in the near term. The author expresses personal enthusiasm for the idea, noting the symbolic significance of an electric Z4 as a milestone, while
energyelectric-vehiclesBMWZ4sports-carsautomotive-technologyclean-energyThe Community Solar Lifeline Continues To Live On
The article discusses the ongoing growth and resilience of the community solar movement in the United States despite recent setbacks in federal energy policy. Community solar allows ratepayers—especially those who cannot install rooftop solar panels due to ownership, space, or financial constraints—to subscribe to locally sited solar arrays and save money on electricity bills. Since Colorado’s pioneering legislation in 2010, 43 states and the District of Columbia have authorized community solar projects, totaling 11 gigawatts (AC) as of 2024. The cost of solar panels and installation has significantly decreased, making community solar financially beneficial for subscribers, with some states adopting opt-out subscription models to increase participation. The article highlights a new development supporting low- and moderate-income (LMI) households through the U.S. Department of Energy’s “Energy Connector” community solar hub. The DOE recently contracted InClime, a veteran-owned small business experienced in renewable energy programs, to manage the hub in partnership with the Clean Energy States Alliance.
energycommunity-solarrenewable-energysolar-powerclean-energyenergy-policyenergy-accessJeff Bezos’ Blue Origin enters the space data center game
Blue Origin, the space company founded by Amazon chair Jeff Bezos, has requested U.S. government approval to launch a constellation of over 50,000 satellites intended to function as an orbital data center. While specific details about the computing capabilities of these satellites remain undisclosed, Blue Origin plans to leverage another proposed satellite network, Terawave, as a high-throughput communications backbone. The concept of space-based data centers is gaining traction due to the advantages of free solar energy and fewer regulatory constraints in orbit. Other major players like SpaceX, Starcloud, and Google are also pursuing similar projects, aiming to support widespread AI applications by outsourcing inference computing to space. Despite the enthusiasm, significant technical and economic challenges persist. These include developing affordable cooling solutions, efficient inter-satellite laser communications, and ensuring advanced chips can operate reliably in the high-radiation space environment. Launch costs remain a critical factor, with hopes pinned on SpaceX’s upcoming Starship rocket to reduce expenses. Blue Origin’s New Glenn
energyIoTsatellite-technologyspace-data-centerssolar-energyspace-communicationaerospace-materialsUltra-fast EV truck charger hits 1 MW using just 500 kW grid power
German researchers from Fraunhofer ISE and partners have developed an ultra-fast electric vehicle (EV) truck charging system capable of delivering over 1 megawatt (MW) of power with a record efficiency of 99.26%. The system, created under the HV-MELA-BAT project, integrates ultra-efficient power electronics, including a modular, galvanically isolated DC/DC converter rated at 250 kW each, combined to reach the megawatt level. A key innovation is the use of a buffer storage unit made from second-life passenger car batteries, which allows the charger to supply 1 MW of power while drawing only 500 kW from the grid, thereby reducing grid load and enabling rapid charging of heavy-duty electric trucks and buses. The system supports the new Megawatt Charging System (MCS) standard while maintaining backward compatibility with the existing Combined Charging System (CCS). It features a robust high-current contact interface designed to safely handle extreme voltages and charging loads. Additionally,
energyelectric-vehiclesEV-chargingmegawatt-charging-systempower-electronicsrenewable-energy-integrationbattery-storageIran War Puts Global Energy Markets on the Brink of a Worst-Case Scenario
The escalating conflict in Iran has pushed global energy markets toward a potentially catastrophic scenario, with significant implications for oil and gas supplies. Recent attacks have effectively closed the Strait of Hormuz, a critical shipping route for Middle Eastern oil and gas exports, causing oil prices to surge above $100 per barrel. While initial disruptions mainly involved halted shipments and storage issues, recent missile strikes—particularly by Israel on key facilities like the South Pars gas field and Iran’s retaliatory strikes on Qatar’s largest oil export terminal—have inflicted damage on vital energy infrastructure. Qatar, responsible for about 20% of the world’s liquefied natural gas supply, faces risks of long-term production losses, which could sustain elevated oil prices even after hostilities cease. Experts describe the situation as unprecedented and severe, likening it to a real-world war game with extreme consequences. The closure of the Strait of Hormuz and ongoing attacks threaten to remove from the market an amount of oil and gas comparable to the demand drop seen during the
energyoil-marketsMiddle-East-conflictStrait-of-Hormuznatural-gasOPECenergy-infrastructureNew US Navy contract speeds up stealth nuclear submarine program
The US Navy has awarded General Dynamics Electric Boat a $15.38 billion contract modification to accelerate the Columbia-class nuclear-powered ballistic missile submarine (SSBN) program. This funding aims to address supply chain disruptions and delays that have slowed the delivery of the first submarines in the 12-vessel fleet, which is set to replace the aging Ohio-class submarines by the 2030s. The Columbia-class submarines, measuring 560 feet in length and capable of speeds over 20 knots with a diving depth exceeding 800 feet, will be the largest in the Navy’s history. They are armed with 16 Trident D5 ballistic missiles and feature advanced stealth technologies, including noise-reducing propulsion and acoustic coatings. The program has faced challenges such as supply chain disruptions linked to the COVID-19 pandemic, delayed material deliveries, and redesign efforts. Additionally, the US submarine supplier base has significantly contracted from about 17,000 suppliers in 1980 to 3,500 in
energynuclear-powersubmarine-technologydefensesupply-chainstealth-technologypropulsion-systemsSix EV Chargers That Offer Free Charging In North Carolina - CleanTechnica
Waynesville, North Carolina, has installed six new Level 2 electric vehicle (EV) chargers at the Waynesville Recreation Park tennis courts, offering free charging to the public. This initiative aligns with the town’s goal to achieve carbon neutrality by 2050, as stated by William Hite, the town’s environmental sustainability chairman. The chargers, likely using CCS1 or J1772 connectors, support local efforts to reduce transportation-related pollution, which is the largest source of emissions in Western North Carolina. Council Member Chuck Dickson emphasized the benefits of EV adoption, noting that most people who switch to electric vehicles do not revert to gasoline-powered cars. The chargers, costing about $700 each and donated by Hite, were installed at a total town expense of under $20,000 after accounting for a federal tax credit. These Level 2 chargers provide roughly 30–40 miles of driving range per hour of charging, making them ideal for visitors engaging in recreational activities at the park, such
energyelectric-vehiclesEV-chargersrenewable-energycarbon-neutralitybattery-storagesustainabilityB.C.’s EV sales regulation ensures British Columbians can access the cost-saving EVs they want—and should be revised, not repealed - Clean Energy Canada
The article highlights the importance of British Columbia’s zero-emission vehicle (ZEV) sales regulation amid rising gas prices, emphasizing that electric vehicles (EVs) offer significant cost savings compared to gasoline cars. Joanna Kyriazis of Clean Energy Canada notes that typical EV drivers in B.C. save between $2,600 and $3,400 annually, or up to $34,000 over a decade, due to lower fueling costs. Consumer demand for EVs is strong, with over half of British Columbians expressing a preference for EVs in their next vehicle purchase, particularly in Metro Vancouver. This demand is reflected in sales, with EVs making up a growing share of new vehicle sales even before federal rebates resumed. B.C. is recognized as a leading EV market in North America, having nearly met its 2026 EV sales targets by 2024, supported by expanding public charging infrastructure. Clean Energy Canada recommends that B.C. maintain ambitious ZEV sales targets—at least 55
energyelectric-vehicleszero-emission-vehiclesclean-energytransportation-policyEV-sales-regulationcarbon-emissions-reductionThe best AI investment might be in energy tech
The article highlights a shift in venture capital interest from AI startups themselves toward energy technologies that support AI infrastructure, particularly data centers. While AI investment has surged over the past five years, the growing power demands of AI-driven data centers—expected to increase by 175% by 2030—are creating significant energy supply challenges. Data center construction is slowing, with many projects delayed due to power constraints and grid limitations, presenting an opportunity for investors to focus on energy innovations that can alleviate these bottlenecks. Major tech companies like Google, Meta, Amazon, and Oracle are actively investing in renewable energy projects (solar, wind, nuclear) and emerging power technologies to reduce reliance on the traditional grid. They are exploring on-site and hybrid power solutions, including grid-scale batteries and new rate structures with utilities, to manage rising electricity costs and grid shortages. Notably, Google’s partnership with Form Energy for advanced battery storage exemplifies this trend. Additionally, the article points out the need for modernizing power management
energyAI-investmentdata-centersrenewable-energygrid-alternativesbattery-storagepower-managementNew 26% efficient solar cells can work in extreme space conditions
Researchers at Ludwig Maximilian University of Munich have developed a new method to enhance the durability and efficiency of perovskite solar cells for use in extreme space conditions. These solar cells face significant challenges in Low Earth Orbit (LEO) due to rapid temperature fluctuations between -80°C and +80°C, which cause mechanical stress, cracking, and layer delamination, leading to power loss. The team, led by Dr. Erkan Aydin, introduced a dual-reinforcement strategy using molecular "glue" to stabilize both the internal grain structure and the interface between the solar cell and its substrate. This involves infusing the perovskite layer with alpha-lipoic acid to form a polymer network that prevents internal cracking, and applying a molecule called DMSLA to chemically anchor the perovskite to the electrode. This innovative approach resulted in perovskite solar cells achieving 26% efficiency while retaining 84% of their original power after 16 thermal cycles between -
solar-cellsperovskiteenergyspace-technologythermal-fatiguematerials-sciencerenewable-energyHydrogen-electric plane's design review finalized, industrial execution soon
Beyond Aero, a Paris-based company, has completed the Preliminary Design Review (PDR) of its hydrogen-electric business aircraft, marking a key milestone that transitions the project from conceptual design to detailed engineering and development. The aircraft employs hydrogen fuel cells for propulsion, producing only water as a by-product, which significantly reduces aviation emissions compared to traditional jet fuel combustion. The company is targeting the business aviation sector, known for its high carbon footprint per passenger, aiming to demonstrate the viability and sustainability of hydrogen-powered flight. The PDR confirms that the aircraft’s major systems—including propulsion, hydrogen storage, aerodynamics, and avionics—have reached a maturity level suitable for certification and production. Beyond Aero is designing the aircraft to meet stringent safety and regulatory standards, collaborating early with regulators like the European Union Aviation Safety Agency to facilitate certification. The company has conducted extensive prototype testing and ground evaluations to refine the technology and reduce risks. Additionally, Beyond Aero is actively developing the broader hydrogen aviation ecosystem by partnering with industry stakeholders and
energyhydrogen-fuel-cellshydrogen-electric-propulsionaviation-technologysustainable-aviationclean-energyaircraft-designChinese Electric Truckmakers Eyeing Europe - CleanTechnica
The article discusses the growing interest of Chinese electric heavy-duty truck manufacturers in entering the European market, which is increasingly focused on reducing CO2 emissions through electrification of transport. While Europe has made significant strides in electrifying passenger cars, heavy-duty trucking remains largely dominated by diesel vehicles, with electric trucks accounting for only 4.2% of sales in 2025, up from 2.3% in 2024. The sector faces challenges due to the heavy weight, long distances, and high speeds typical of trucks, but advances in battery technology are making electrification more viable. China leads globally in electric truck adoption, with zero-emission trucks making up 29% of its heavy-duty truck sales, benefiting from a well-developed supply chain and cost advantages. More than six Chinese companies, including BYD, Farizon, Windrose Technology, and SuperPanther, plan to enter the European market, leveraging their strengths in cost, supply chains, and product performance. Chinese electric trucks could
energyelectric-trucksheavy-duty-vehiclesbattery-technologyclean-transportationChinaEurope-electric-vehicle-marketBe Careful What You Wish For: Alberta’s Gas Price Shift - CleanTechnica
The article from CleanTechnica discusses Alberta’s evolving natural gas pricing landscape, driven largely by the province’s increasing integration into global LNG export markets. Historically, Alberta’s natural gas prices were low due to geographic isolation and limited market outlets, which benefited local producers but also acted as an industrial subsidy for gas-intensive sectors like fertilizer production, chemical manufacturing, and gas-fired electricity. However, with the operation and expansion of LNG export facilities such as LNG Canada, Woodfibre, Cedar, and potentially Ksi Lisims, Alberta’s gas prices are shifting upward as the province’s gas market becomes more closely linked to global LNG demand. This transition means Alberta is moving from a captive-basin pricing model to one influenced by global market dynamics, resulting in steadily rising gas prices over the next decade. The Alberta Energy Regulator (AER) projects AECO-C prices rising from $1.45/GJ in 2024 to between $4.5 and $6/GJ by 2030, representing
energynatural-gasLNGAlberta-energy-marketgas-pricesLNG-exportenergy-infrastructureLego plans 30,700-panel solar array at its new Virginia factory site
The LEGO Group is advancing its commitment to clean energy with the development of its first U.S. manufacturing facility in Chesterfield County, Virginia. Central to this effort is the installation of a large-scale solar array spanning nearly 80 acres and comprising over 30,700 ground-mounted panels, delivering a peak capacity of 22 megawatts. Additionally, rooftop solar systems with 10,080 panels will add 6.11 MWp, creating a hybrid on-site energy model designed to power the factory entirely with renewable energy. Smart energy management systems will optimize solar output and energy use, reducing reliance on the grid and enhancing operational resilience. The $1.5 billion Virginia site covers 340 acres and includes 13 buildings with molding, packing, office spaces, an energy center, and an automated high-bay warehouse. LEGO aims for the factory to be carbon-neutral by matching 100% of its energy consumption with renewable sources and incorporating energy efficiency measures such as optimized building orientation, insulation, and advanced
energyrenewable-energysolar-powerclean-energysustainabilityenergy-managementmaterialsDiesel at $5: Clean Transport Advocates Call on Truck Manufacturers to Help U.S. Trucking Switch to Electric - CleanTechnica
The article highlights the urgent call from clean transport advocates for U.S. truck manufacturers to accelerate the transition to electric trucks amid soaring diesel prices, which surpassed $5.10 per gallon in March. Rising diesel costs are driving up expenses across the supply chain, affecting trucking, shipping, and grocery prices. Industry experts criticize the four major truck manufacturers—Daimler, Volvo Group, Paccar, and International Motors—for lobbying against clean truck regulations and suing California to avoid commitments to zero-emission truck standards. This opposition is contributing to a 49% year-over-year decline in zero-emission truck deployment growth in the U.S., contrasting with increasing electric truck sales in markets like China and Europe. The article also points out that electric trucks in the U.S. remain significantly more expensive than their European counterparts, with prices for Class 8 electric trucks rising 27% since 2020 in the U.S., while similar trucks in Europe have decreased by 32%. Advocates argue that manufacturers possess
energyelectric-trucksclean-transportationzero-emission-vehiclesdiesel-pricestrucking-industryvehicle-electrificationJoint Position Paper on the Decarbonisation of the Fleets of Large Companies - CleanTechnica
The joint position paper published by European businesses, major cities, and civil society strongly supports the EU Clean Corporate Vehicles Regulation as a key instrument for decarbonizing large company fleets. They commend the European Commission for setting binding, differentiated targets for Member States rather than imposing uniform company-level mandates, allowing tailored approaches to green fleet transitions. This regulation is seen as a critical demand-side measure to help European automakers meet their 2030 CO2 emission reduction goals and foster a smart, green industrial and social policy across Europe. However, the signatories warn that the current draft regulation risks underperformance and call for three major improvements: raising the ambition level beyond the current 45% zero-emission vehicle (ZEV) target for 2030 to at least 65%, excluding low-emission vehicles like plug-in hybrids due to their higher real-world emissions and costs, and strengthening monitoring and reporting frameworks to ensure compliance and market confidence. They also urge the inclusion of all corporate fleets, such as taxis and
energydecarbonisationzero-emission-vehicleselectric-vehiclesEU-regulationfleet-managementsustainable-transportationT&E’s Response to the European Commission's Revision of the Governance Regulation - CleanTechnica
Transport & Environment (T&E) has responded positively to the European Commission’s revision of the Governance Regulation, which governs the EU’s Energy Union and Climate Action framework. T&E acknowledges the 2018 Regulation’s role in coordinating Member States’ planning and monitoring toward the 2030 climate and energy targets but emphasizes the need for a more strategic and forward-looking framework. This updated framework should guide Europe’s energy system transformation beyond 2030, aligning with the EU’s 2040 climate goals and the 2050 climate neutrality target under the Paris Agreement. T&E highlights that recent geopolitical crises, such as Russia’s war against Ukraine and conflicts involving the US, Israel, and Iran, have underscored Europe’s vulnerability due to its dependence on volatile fossil fuel markets and external suppliers. These events reinforce the importance of energy security alongside decarbonization in the EU’s future energy policy. To strengthen Europe’s energy sovereignty, T&E supports accelerating the shift to domestically produced renewable energy and enhancing system
energyrenewable-energyenergy-transitionclimate-actionEU-energy-policyenergy-securitydecarbonizationVW ID. Cross Could Be Huge Hit on European Market - CleanTechnica
Volkswagen is set to launch the ID. Cross, a new electric vehicle targeting the European market, with a starting price of around €28,000. The ID. Cross is a compact SUV/crossover designed to meet the needs of average families seeking affordable, practical electric mobility. It features Volkswagen’s new Pure Positive design language, combining clear lines and balanced proportions with a high-quality, understated appearance. The interior emphasizes calmness and clarity, with premium materials, intuitive controls, large displays, and efficient use of space for five passengers. The ID. Cross offers flexible powertrain options, including three power levels (85 kW, 99 kW, and 155 kW) and two battery sizes (37 kWh and 52 kWh net capacity), catering to a range of driving profiles from urban commuting to longer trips. It supports modern driver assistance systems and fast DC charging up to 90 kW (105 kW with the larger battery), ensuring convenience and future-proofing. Given
energyelectric-vehiclesVolkswagen-ID-Crossbattery-technologyDC-quick-chargingrenewable-energyEV-marketBMW i3 Delivers Impressive 440-Mile Estimated EPA Range - CleanTechnica
BMW has announced the new i3 sedan as part of its Neue Klasse lineup, marking a significant departure from the original i3’s quirky design and limited range. This new i3 is a traditional sedan roughly the size of a Tesla Model 3 but features a unique "2.5 box" design that blends the passenger and trunk compartments. The standout feature is its estimated EPA range of 440 miles, positioning it as the longest-range production EV sedan currently available. The vehicle employs advanced cell-to-pack battery technology for a lower profile and better aerodynamics, though specific battery details remain undisclosed. Powertrain-wise, the i3 uses BMW’s sixth-generation eDrive technology with two electric motors—an electrically excited synchronous motor powering the rear wheels and an asynchronous motor in the front—delivering a combined 463 hp and 476 ft-lb of torque. The car integrates modern tech such as a panoramic glass roof, a 17.9-inch central trapezoidal touchscreen angled toward the driver,
energyelectric-vehiclesbattery-technologyBMW-i3eDrive-technologyelectric-motorsautomotive-innovationTrump Administration Considers Endangered Species Act Exemption to Support Oil & Gas Activities in Gulf of Mexico - CleanTechnica
The Trump Administration is considering invoking an exemption under the Endangered Species Act (ESA) to support oil and gas activities in the Gulf of Mexico. Interior Secretary Doug Burgum announced that the Endangered Species Committee, often called the “God Squad,” will meet on March 31 to discuss this potential exemption. This committee has the authority to override ESA protections, which is significant given that the Gulf of Mexico is home to the critically endangered Rice’s whale, with fewer than 100 individuals estimated to remain. The National Marine Fisheries Service has previously found that oil and gas operations in the region are likely to jeopardize the whale’s survival. Environmental groups, including the Sierra Club, strongly oppose this move. They argue that the ESA is meant to prevent extinctions, not to be circumvented to benefit corporate interests. The Sierra Club’s National Wildlife Campaign Manager, Ben Greuel, criticized the administration for prioritizing oil and gas profits over the survival of vulnerable species, warning that such actions could push the Rice
energyoil-and-gasendangered-speciesenvironmental-policyGulf-of-Mexicoconservationwildlife-protectionAnother EV Bites the Dust in USA - CleanTechnica
The article from CleanTechnica highlights the negative impact of recent Republican policy decisions on the US electric vehicle (EV) market. The elimination of EV incentives and the rollback of automaker fuel economy and CO2 emission standards have led to a decline in EV sales, the cancellation of major production investments, and the withdrawal of several EV models from the US market. Notably, Volvo has canceled the US release of its EX30 model, joining other manufacturers like Ford, Hyundai, and Honda, who have also pulled or canceled EV models in the US. A key factor contributing to the EX30’s failure in the US is the 100% tariff on EVs manufactured in China, which pushed the vehicle’s price to an uncompetitive level—starting around $50,000 and later dropping to $40,000—making it unattractive to American consumers. Despite this setback, Volvo plans to continue selling larger electric vehicles in the US market, such as the EX60 and EX90, aligning with American preferences
energyelectric-vehiclesEV-marketautomotive-industryrenewable-energyUS-marketclean-technologyLong-life radiovoltaic batteries target space and ocean missions
A DARPA-funded project led by the University of Missouri, with collaborators including the University of Toledo, Pennsylvania State University, University of Houston, and the Naval Research Laboratory, is developing nuclear-powered radiovoltaic micro-batteries designed for long-duration missions in extreme environments such as deep oceans and outer space. These batteries convert nuclear radiation directly into electricity, enabling continuous, maintenance-free power supply where solar energy is unavailable or unreliable. The project aims to achieve a power density of 10 watts per kilogram, significantly surpassing current radiovoltaic systems. The technology relies on gallium oxide semiconductors, which offer superior radiation tolerance compared to conventional materials, potentially enhancing both efficiency and operational lifespan. Researchers at the University of Toledo are conducting finite element modeling to simulate and optimize device designs before fabrication, facilitating iterative improvements. This approach targets applications in buoys, spacecraft, and remote sensors, where replacing or recharging batteries is challenging, thus advancing radiovoltaic technology toward practical deployment in demanding, long-term missions
energyradiovoltaic-batteriesnuclear-micro-batterieslong-duration-powergallium-oxidespace-missionsocean-sensorsGeothermal startup Fervo catapults itself over the ‘valley of death’
Fervo Energy, a geothermal startup specializing in enhanced geothermal technology, has made a significant breakthrough by securing a $421 million non-recourse loan for its Cape Station power plant project in Utah. This type of financing, where the loan liability is tied solely to the project rather than the company, is a key indicator that Fervo has moved beyond the challenging "valley of death" phase—a stage where startups have proven their technology but struggle to raise sufficient funds to scale profitably. The Cape Station plant is set to begin operations in 2026, scaling to 100 megawatts early in 2027 and eventually reaching 500 megawatts, with all generated power already sold. Fervo’s ability to obtain non-recourse project finance is notable because such financing is rarely granted to first-of-a-kind facilities, underscoring the confidence lenders have in the project. This confidence is bolstered by Fervo’s extensive data from over a dozen wells drilled at the site, which helped mitigate risks
energygeothermal-energyrenewable-energyenergy-startuppower-plantproject-financeclean-energyThermal battery hits 4,350°F, stores electricity as heat for 100 hours
Researchers at Fourth Power, an MIT spinout led by Professor Asegun Henry, have developed a novel thermal battery that stores electricity as heat in carbon blocks heated to approximately 4,350°F (2,400°C), nearly half the temperature of the Sun’s surface. This system uses molten tin to transfer heat and thermophotovoltaic (TPV) cells to convert the intense light emitted by the white-hot carbon blocks back into electricity with over 40% efficiency—a record for TPV technology. Operating at such high temperatures allows for higher power density, reducing system size and costs compared to conventional energy storage solutions like lithium-ion batteries. The thermal battery offers long-duration energy storage, capable of providing power for 10 to over 100 hours with minimal heat loss (about 1% per day), making it suitable for utilities, renewable energy integration, and data centers. Its modular design enables scaling by adding storage or power modules, with plans to demonstrate a one-megawatt-hour system
energythermal-batteryenergy-storagecarbon-materialsthermophotovoltaic-cellsmolten-tinclean-energyPhotos: BMW unveils new electric sedan with 469 horsepower and smart driving features
BMW has officially unveiled its all-new 2027 i3 electric sedan, marking a significant advancement in the brand’s electric vehicle lineup as the second model built on the Neue Klasse platform. Production is slated to begin in August 2026 in Munich. The i3 features a modern, clean design with a full-width front lighting system integrated into the grille area, balanced proportions with a long wheelbase (114.1 inches), and subtle styling cues that nod to BMW heritage. Measuring 187.4 inches long and 73.4 inches wide, the sedan offers improved interior space and a sporty, low profile despite being fully electric. The cabin emphasizes openness and simplicity, highlighted by a wraparound dashboard and a panoramic roof option. Technology is central, with a 17.9-inch driver-focused display, additional screens, and retained physical buttons for key controls. Performance comes from a dual-motor setup producing 469 horsepower and 476 lb-ft of torque, utilizing an excited synchronous rear motor and an
energyelectric-vehiclebattery-technologyfast-chargingBMW-i3electric-sedanautomotive-innovationThe Real, Live Microbial Fuel Cells Behind Astrophage - CleanTechnica
The article explores the connection between the fictional Astrophage from the movie Project Hail Mary and real-world microbial fuel cells (MFCs). Astrophage, a supercharged bacterium central to the film’s plot, inspires discussion about whether such organisms could be based on actual microbial fuel cells, which harness energy from microbes. MFCs are not new; they were first demonstrated in 1911 using soil bacteria, and research into bio-based energy from microbes has been ongoing, with notable contributions from microbiologists like Derek Lovely, who identified electricity-producing bacteria such as Geobacter. Recent advancements in MFC technology highlight their potential for practical applications. In 2023, a team at Binghamton University developed a dime-sized biobattery that could remain dormant for 100 years and be reactivated by moisture to produce electricity sufficient to power small devices. Although not yet powerful enough for military use, this represents a significant step toward commercial viability. In 2024, Northwestern University researchers created a
energymicrobial-fuel-cellsbioenergybiobatteryrenewable-energybiotechnologyclean-energyThe Hormuz Shock & The Rise Of The Electrostate - CleanTechnica
The article "The Hormuz Shock & The Rise Of The Electrostate" from CleanTechnica discusses the strategic and economic implications of disruptions in the Strait of Hormuz, a critical chokepoint through which a significant portion of the world’s crude oil, LNG, and fertilizer feedstocks are transported. While historically treated as a geopolitical abstraction, recent conflicts have turned Hormuz into a tangible operating constraint, exposing the global economy's heavy dependence on a few key marine corridors, producer states, and molecular commodities. The article emphasizes that such disruptions are not merely about oil price spikes but represent broader shocks affecting food, industry, transport, and finance, particularly impacting countries reliant on imports of these resources, mostly in Asia. The piece highlights that about 20 million barrels per day of crude and refined products, alongside a substantial share of global LNG and fertilizers, transit Hormuz, with roughly 80-90% destined for Asian markets including Japan, South Korea, Taiwan, India, Pakistan, Bangladesh, and China
energyoilLNGdecarbonizationclean-energyelectric-economyenergy-transitionBusiness Provides Over 50 EV Chargers Onsite For Employees - CleanTechnica
The article highlights how the Salt Lake City company Packsize supports electric vehicle (EV) adoption among its employees by providing over 50 onsite EV chargers for approximately 100 staff members. Initially starting with just three chargers, the company expanded its infrastructure as more employees acquired EVs, reaching a nearly 30% EV adoption rate. Packsize’s founder, Hanko Kissener, emphasizes that installing charging infrastructure first is key to encouraging employees to switch to EVs. The availability of onsite EV charging is framed as an employee perk that can aid retention and reduce turnover costs, aligning with research showing that companies investing in employee well-being tend to perform better financially. Beyond environmental benefits, the article notes that EVs also improve human health by eliminating direct emissions of harmful air pollutants such as particulate matter and nitrogen oxides, which are linked to respiratory issues like asthma. Kissener’s personal experience with asthma after moving to Salt Lake City motivated the company’s commitment to cleaner transportation options. Additionally, Packsize uses renewable energy
energyelectric-vehiclesEV-chargersrenewable-energyworkplace-sustainabilityair-pollution-reductionemployee-benefitsK2 to launch its first high-powered satellite for space compute
K2, a satellite startup founded in 2022 by former SpaceX engineers Karan and Neel Kunjur, is preparing to launch Gravitas, one of the highest-powered satellites ever built, aboard a SpaceX Falcon 9 rocket by the end of the month. Gravitas weighs two metric tons and features a 40-meter wingspan solar array capable of generating 20 kW of power, enabling it to support advanced payloads such as sensors, transceivers, and onboard computers. This power output approaches that of much larger and more expensive satellites like ViaSat-3 and Starlink V2, which produce around 25-28 kW, while most satellites generate only a few kilowatts. The mission will carry 12 undisclosed payloads, including a 20 kW electric thruster that K2 expects to be the most powerful ever flown in space. The company aims to demonstrate deployment, power generation, payload operation, and orbital raising capabilities as part of an
energysatellite-technologyspace-computingsolar-powerelectric-thrusterspace-data-centershigh-powered-spacecraftWorld-first: GE Vernova, IHI run gas turbine fully on 100% ammonia fuel
GE Vernova and Japan’s IHI Corporation have achieved a world-first by successfully testing 100% ammonia combustion in GE Vernova’s F-class gas turbines, marking a significant step toward decarbonizing the energy sector. The test, conducted at IHI’s Large-Scale Combustion Test facility in Japan, demonstrated that ammonia can power gas turbines without carbon emissions, addressing a major technical barrier to carbon-free dispatchable power. While specific emission and efficiency data were not disclosed, the results aligned with the companies’ internal roadmap, which aims for commercial availability of 100% ammonia-fired F-class turbines by 2030. Ammonia presents advantages over hydrogen as a carbon-free fuel, including easier storage at −33°C compared to hydrogen’s −253°C and the benefit of existing shipping infrastructure handling about 10% of annual ammonia production. However, challenges remain due to ammonia’s slower burn rate affecting ignition and stability, as well as safety concerns related to its toxicity. The collaboration between GE
energyammonia-fuelgas-turbinedecarbonizationGE-VernovaIHI-Corpcarbon-free-combustionSafer nuclear fuel transportation solution achieves design milestone
NANO Nuclear Energy, a New York-based company, has reached a significant conceptual design milestone for an advanced, proprietary transportation package specifically designed for High-Assay Low-Enriched Uranium (HALEU) fuel. This development supports next-generation nuclear reactors and leverages NANO Nuclear’s exclusively licensed nuclear fuel transportation basket technology, created with technical support from Gesellschaft für Nuklear-Service mbH (GNS), a global leader in radioactive material transport and storage. The collaboration combines NANO Nuclear’s innovative fuel basket design with GNS’s extensive expertise in nuclear transportation, licensing, and manufacturing. The HALEU transportation package under development is designed to accommodate multiple advanced nuclear fuel types, including uranium oxide, TRISO particle fuels, uranium-zirconium hydride, uranium mononitride, and molten salt reactor fuels. This broad compatibility aims to support diverse fuel requirements for emerging microreactors, small modular reactors (SMRs), and advanced reactor technologies. NANO Nuclear has completed key early engineering milestones
energynuclear-fuelHALEUnuclear-transportationadvanced-reactorssmall-modular-reactorsnuclear-materialsCan Offshore Wind Win The Trump Disinformation War? - CleanTechnica
The article from CleanTechnica highlights the ongoing battle between offshore wind energy advocates and the disinformation campaigns led by the Trump administration and its fossil fuel allies. Despite the Trump administration’s efforts to halt offshore wind projects—such as issuing stop-work orders on Vineyard Wind and other projects, freezing new permits, and attempting to end leasing for wind projects on federal lands—the offshore wind sector continues to make significant progress. The administration’s rhetoric and policies, including Project 2025, aimed to undermine renewables by promoting myths about their reliability and subsidy dependence, while favoring fossil fuels. Experts argue that these actions were a quid pro quo benefiting fossil fuel interests and delaying the clean energy transition. Despite these obstacles, offshore wind is proving to be a cost-effective and rapidly deployable clean energy source, with the US East Coast seeing tangible benefits. Vineyard Wind, a flagship project off the New England coast, has overcome federal suspension and legal challenges to complete installation of its turbines, with commissioning and testing underway. This milestone
energyoffshore-windrenewable-energyclean-energywind-powerdecarbonizationclimate-changeArc expands into electric commercial and defense boats with $50M raise
Arc Boat Company, a Los Angeles-based startup, has raised $50 million in a Series C funding round led by investors including Eclipse, a16z, and Menlo Ventures to expand its electric propulsion technology into commercial and defense maritime markets. Founded by Mitch Lee, the company aims to "electrify everything on the water" by leveraging its existing consumer sport boat business, which generates significant revenue and serves as a proving ground for the durability and capability of its technology. This strategy mirrors Tesla’s approach of starting with high-end consumer products before moving into commercial sectors, a method endorsed by Greg Reichow, a former Tesla VP and Eclipse partner. Arc plans to supply electric propulsion systems rather than build entire boats for commercial and defense customers. For commercial vessels, Arc collaborates with shipyards, as demonstrated by its hybrid tugboat project with Curtin Maritime and Snow & Co. In the defense sector, Arc intends to be a direct supplier of electric powertrains to prime contractors, addressing a critical need
energyelectric-propulsioncommercial-boatsdefense-technologyelectric-powertrainssustainable-transportationmarine-technologyNuclear-powered 100,000-ton USS Ford exits Iran war after onboard fire
The USS Gerald R. Ford, the U.S. Navy’s most advanced nuclear-powered aircraft carrier, is withdrawing from the Red Sea to Naval Support Activity Souda Bay in Crete following a fire on March 12 in its aft laundry facility. The fire, which was non-combat-related, spread through ventilation into adjacent berthing areas, destroying over 100 beds and displacing more than 600 sailors. Two sailors sustained non-life-threatening injuries, with one evacuated ashore, and over 200 others treated for smoke inhalation. The Navy airlifted replacement mattresses and clothing from the USS John F. Kennedy to support the affected crew. Although damage control lasted over a day, the fire itself did not burn continuously for 30 hours, a period that included firefighting and cleanup efforts. The Navy is investigating whether the fire was deliberately set by sailors aboard the Ford. The Ford’s deployment, which began in June 2025, has been marked by extensive operations across the Caribbean, Mediterranean,
energynuclear-powernaval-technologymilitary-technologyaircraft-carriership-safetymaritime-energy-systemsInside a $1.1B deal to reshore critical minerals refining
The U.S. and Europe face significant challenges in nickel mining and refining, critical for batteries, electronics, and defense, due to permitting and environmental concerns. Currently, Indonesia and China dominate nickel refining, with Chinese companies controlling about 75% of Indonesia’s refining capacity, effectively controlling over half the global supply. This geopolitical dependence has prompted companies to explore domestic refining solutions. One such company, Nth Cycle, has developed a modular electrochemical system to refine nickel and other critical minerals from scrap and waste sources. After starting production in Ohio with a capacity of 3,100 metric tons, Nth Cycle secured a $1.1 billion deal with commodity trader Trafigura to quadruple its output, signaling a shift toward reshoring critical mineral refining and recycling. Nth Cycle’s technology contrasts with traditional large-scale refineries by being smaller, less capital-intensive, and scalable, allowing profitable operation at lower volumes (as low as 6,000 metric tons per year). This modular approach is particularly suited
energymaterialsbattery-recyclingnickel-refiningcritical-mineralselectrochemical-systemsupply-chainFrance to deploy 78,000-ton 'France Libre' aircraft carrier by 2038
French President Emmanuel Macron has announced the name of France’s next-generation nuclear-powered aircraft carrier as France Libre, with an expected entry into service by 2038. This vessel will be Europe’s largest warship, displacing approximately 78,000 tons and measuring about 1,017 feet in length, significantly larger than the current flagship, Charles de Gaulle. France Libre will carry over 40 aircraft, including Rafale M fighters, E-2D Hawkeye early warning planes, and next-generation combat drones. It will feature advanced electromagnetic catapults replacing steam systems, enabling more precise launches and the handling of heavier, more advanced aircraft. The carrier’s propulsion system represents a major technological leap, powered by two next-generation K22 nuclear reactors coupled with nuclear-electric propulsion. This will provide enhanced efficiency and substantial onboard electrical capacity to support modern and future systems such as directed-energy weapons and autonomous aircraft operations. France Libre will also have improved defensive capabilities, including vertical launch systems for advanced Aster missiles and
energynuclear-propulsionaircraft-carrierelectromagnetic-catapultdefense-systemsdirected-energy-weaponsautonomous-aircraftGet Ready for a Year of Chaotic Weather in the US
The article highlights that despite 2025 being the third-hottest year on record, wildfire activity measured by acres burned was below the 10-year average. However, the western US is currently facing a record-breaking heat wave driven by a strong high-pressure ridge, with temperatures expected to break records across multiple states, including California, Arizona, Nevada, Missouri, and Tennessee. This heat wave is unusually prolonged, lasting at least one to two weeks, and is intensifying an already warm winter marked by historically low snowpack levels—below 50 percent of average in many Western states. Low snowpack threatens water supplies, particularly from the Colorado River, which serves 40 million people, and raises concerns about a severe upcoming wildfire season due to dry soil and stressed vegetation. Adding to the climatic challenges, a strong El Niño event is predicted to develop later this year. El Niño, a natural climate cycle originating in the tropical Pacific, typically raises global temperatures and influences weather patterns worldwide. While its exact impacts are
energyclimate-changeheat-wavewildfirewater-resourcessnowpackdroughtGroups Take Trump Administration to Court Over Illegal Craig Coal Plant Extension - CleanTechnica
Public interest groups and the state of Colorado have filed legal challenges against the Trump administration’s emergency order extending the operation of Colorado’s Craig Unit 1 coal-fired power plant. The Department of Energy (DOE) issued a December 2025 order under Section 202(c) to prevent the plant’s planned retirement, forcing it to remain available for 90 days with possible renewal. The plant had already been out of service due to a valve failure and was scheduled to retire the day after the order. Critics argue that the extension is illegal, unnecessary, and harmful, as it raises electricity costs for consumers and worsens air quality in surrounding communities. Opponents, including environmental groups and the plant’s co-owners Tri-State and Platte River, contend that the DOE order was not requested by any state regulators or owners and amounts to an unlawful taking of private property. They warn that the order imposes significant repair, maintenance, and staffing costs that will ultimately be passed on to ratepayers. Advocates
energycoal-powerclean-energyrenewable-energyelectricity-gridenergy-policyenvironmental-impactSierra Club & Partners Challenge Trump Administration’s Illegal Efforts to Block the Retirement of Indiana Coal Plants - CleanTechnica
The Sierra Club, along with partners including the Environmental Law and Policy Center (ELPC), Earthjustice, Citizens Action Coalition of Indiana, Just Transition Northwest Indiana, and the Hoosier Environmental Council, has filed a legal challenge against the Trump administration’s Department of Energy (DOE) “emergency” orders. These orders, issued in December 2020, forced the continued operation of two Indiana coal-fired power plants—the R.M. Schahfer plant and one unit at the F.B. Culley generating station—beyond their planned retirement dates. The coalition argues that these orders are illegal, override decisions made by power companies, grid operators, and state regulators, and impose unnecessary costs on Indiana residents and neighboring states by requiring repairs and continued operation of uneconomic, polluting coal plants. The coalition’s attorneys and leaders emphasize that the DOE’s actions lack legal justification and harm consumers by increasing electricity prices, which are already among the highest in Indiana. They contend that the federal government has no authority
energycoal-powerpower-plantsenergy-policyenvironmental-lawenergy-costsgrid-stabilityEarthjustice & Sierra Club Blast Trump Administration Order to Keep Washington’s Last Coal Plant Open - CleanTechnica
The article reports on the opposition from Earthjustice and the Sierra Club to a Department of Energy (DOE) order under the Trump administration that forces the TransAlta coal plant in Centralia, Washington—the state’s last coal-fired power plant—to remain operational. Both environmental groups argue that the DOE’s order is unlawful and contradicts the interests of Washington residents, who favor cleaner, more affordable, and reliable energy sources. They contend that the administration is misusing Section 202(c) of the Federal Power Act, which is intended for short-term emergency power needs, to prolong the operation of an outdated and polluting coal plant, thereby undermining planned energy transitions and increasing costs for consumers. The legal challenge, supported by Earthjustice on behalf of several environmental organizations and the State of Washington, asserts that the Trump administration’s intervention disrupts regional energy planning and prioritizes coal despite its inefficiency and environmental harm. The Sierra Club emphasizes that the administration’s interference poses a greater risk to energy reliability in the Northwest than
energycoal-powerclean-energyenergy-policyenvironmental-lawpower-plantsenergy-transitionSierra Club Statement on Western Arctic Oil & Gas Lease Sale - CleanTechnica
The article reports on a recent oil and gas lease sale conducted by the Trump Administration in the Western Arctic, covering over 1.3 million acres of public lands. This area, totaling more than 23 million acres and roughly the size of Indiana, is the largest contiguous expanse of national public lands in the U.S. It includes critical habitats for wildlife, including migratory birds and threatened Arctic species, as well as lands integral to the subsistence traditions of the Iñupiat communities. The lease sale was enabled by the One Big Beautiful Bill Act and follows the administration’s recent revocation of protections on over 2 million acres in northern Alaska, facilitating potential privatization. In response, Mike Scott, Sierra Club’s oil and gas campaign manager, condemned the sale, emphasizing the environmental risks and cultural impacts. He criticized the administration for prioritizing oil industry profits over the preservation of one of the country’s last wild places, warning that drilling in the Arctic would cause irreversible damage without addressing the energy
energyoil-and-gasArctic-drillingenvironmental-impactpublic-landsclean-energywildlife-conservationTesla Shines Amid EV Slowdown in China — February 2026 Sales Report - CleanTechnica
In February 2026, China’s electric vehicle (EV) market experienced a notable slowdown, with overall EV sales dropping 32% year-over-year (YoY) to around one million units, reflecting a broader market decline of 25%. Battery electric vehicles (BEVs) fell 35% YoY to 278,000 units, and plug-in hybrid electric vehicles (PHEVs) also saw a sharp 31% decrease. Extended-range electric vehicles (EREVs), particularly popular in large SUVs, were less affected, declining only 16% YoY. Despite the dip, plugin vehicles still captured a 45% market share in February, down 5 percentage points from the previous year, with BEVs alone accounting for 27% of auto sales. The year-to-date (YTD) total reached approximately 1.1 million units, with expectations that Q1 2026 sales will close between 1.5 and 2 million units, potentially pushing plugin vehicle market
energyelectric-vehiclesTeslabattery-electric-vehiclesplug-in-hybridsChina-EV-marketclean-energyHydrogen Paste Meets Reality: Energy In, Energy Out, And What’s Missing - CleanTechnica
The article critically examines Powerpaste, a hydrogen carrier developed by Fraunhofer IFAM that uses magnesium hydride in a paste form to generate hydrogen by reacting with water. This approach aims to address the safety and cost challenges of traditional hydrogen storage methods, such as high-pressure compressed hydrogen and cryogenic liquid hydrogen. Powerpaste offers the advantage of ambient temperature storage and claims higher volumetric energy density than compressed hydrogen, packaged as an easy-to-handle cartridge system. However, the article highlights that the system is not a simple storage medium but a chemical reaction system requiring both the paste and a significant amount of water—about 9 kg per kg of hydrogen produced—making the total input mass roughly 19 kg for 1 kg of hydrogen. When considering the full system—including the fuel cell, reactor, pumps, and other components—the effective energy density drops substantially to about 0.3 to 0.4 kWh per kg, comparable to modern batteries and far below the claims made by Fraun
energyhydrogen-storagepowerpastefuel-cellsmagnesium-hydrideclean-energyenergy-densityNew process revives uranium purification at Y-12 after 20 years
The National Nuclear Security Administration (NNSA) has resumed uranium purification at the Y-12 National Security Complex using a new electrorefining process, marking the first such capability at the site in over 20 years. This restart is significant for maintaining the United States’ nuclear materials infrastructure and represents the first new nuclear processing capability initiated at Y-12 in two decades. Electrorefining employs electrochemical techniques to separate and purify uranium metal, offering a safer, more efficient alternative to older chemical methods. The purified uranium produced will support critical national security missions, including nuclear weapons production and fueling reactors for U.S. Navy aircraft carriers and submarines. The electrorefining process, developed initially at Argonne National Laboratory and advanced at Y-12, converts impure uranium into purified metal through controlled electrochemical reactions, enabling a more stable and manageable workflow. This method facilitates the transition away from hazardous legacy processing systems, improving operational safety while maintaining production capabilities. Authorized for startup in 2025, the system
energynuclear-energyuranium-purificationelectrorefiningnuclear-materialsnuclear-securitynuclear-infrastructureSilicon-graphene Li-ion anodes retain 98% capacity after 2,000 cycles
Scientists at Tel Aviv University have developed a novel silicon-graphene anode for lithium-ion batteries using a one-step laser process that simultaneously synthesizes and prelithiates silicon nanoparticles within a conductive graphene matrix. This ambient, solid-state method employs common lithium salts and simple precursors, eliminating complex fabrication steps and the need for reactive lithium metal. The resulting material features a core-shell structure of partially lithiated silicon nanoparticles coated with lithium silicate, embedded in a porous laser-induced graphene framework that stabilizes interfaces and buffers volume expansion—addressing key challenges that have limited silicon anode performance. Testing demonstrated that the silicon-graphene anode retains over 98% of its capacity after more than 2,000 charge cycles at a high current density (5 A g⁻¹), with initial coulombic efficiency above 97% and capacities exceeding 1,700 mAh/g. The anode also exhibits ultrafast charging capability, maintaining 63% capacity at 10 A g
energylithium-ion-batteriessilicon-graphene-anodesbattery-materialsfast-chargingelectric-vehiclesmaterials-scienceAudi A2 e-tron Coming This Fall - CleanTechnica
The original Audi A2, produced from 1999 to 2005, was a pioneering compact car notable for its lightweight aluminum construction and exceptional fuel efficiency. Despite winning design awards and introducing innovations such as an aluminum space frame and a diesel “3L” version achieving under 3 liters per 100 km fuel consumption, the A2 struggled commercially. Its high production costs made it expensive compared to competitors like the Mercedes A-Class, which offered similar size at a lower price, leading to limited sales and eventual discontinuation. The A2 was never sold in the US and remained relatively unknown even in Europe. Audi has announced the upcoming release of the A2 e-tron, an all-electric compact model set to launch in fall 2026. Positioned as an entry-level electric Audi, the A2 e-tron aims to combine premium electric mobility with everyday usability, sustainability, and digital connectivity, targeting urban customers and younger demographics. Audi emphasizes that the new A2 e-tron continues the legacy
energyelectric-vehiclesAudi-A2-e-tronaluminum-materialsfuel-economyelectric-mobilityautomotive-innovationNew flat thermoelectric device converts body heat into electricity
Researchers at Seoul National University College of Engineering have developed a novel flat, flexible thermoelectric device that generates electricity directly from body heat without adding bulk or compromising comfort. Led by Prof. Jeonghun Kwak, the team addressed a key challenge in wearable thermoelectric generators: maintaining a temperature difference in thin, flat devices. Traditional flat wearables allow heat to pass straight through to the air, eliminating the temperature gradient needed for power generation. Previous solutions involved bending or creating 3D structures, which increased thickness and reduced comfort. The breakthrough came from redesigning heat flow rather than device shape. The researchers created a “dual thermal conductivity substrate” by embedding copper nanoparticles into specific regions of a stretchable silicone base, forming zones with different thermal conductivities within a single flat layer. This design directs heat to flow laterally along high-conductivity paths, creating temperature differences across the surface and enabling power generation in a thin, planar form. The device, produced via an ink-based printing method,
energythermoelectric-generatorwearable-technologyflexible-electronicsbody-heat-powermaterials-scienceenergy-harvestingNew sodium battery cathode keeps 80% capacity after 200 cycles
Researchers at Central South University have developed a novel sodium-ion battery cathode with a radial gradient structure that significantly improves air stability and cycling durability. Sodium-ion batteries, valued for their low cost and potential in large-scale energy storage, have been hindered by cathode degradation caused by exposure to moisture and carbon dioxide. The team addressed this by creating a cathode with a mixed-phase outer layer that increases the oxidation state of transition metals, forming a protective barrier against environmental damage, while maintaining a stable inner core for strong sodium storage capacity. This design enables the cathode to retain about 80% of its capacity after 200 charge-discharge cycles, compared to only 21% for conventional cathodes. The new cathode also demonstrated enhanced resistance to real-world conditions, maintaining over 103 mAh/g capacity after 10 hours in humid air with carbon dioxide, with capacity loss reduced from over 50% in standard materials to just above 12%. The gradient structure facilitates faster sodium-ion transport, improving
energysodium-ion-batterybattery-cathodematerials-scienceenergy-storagebattery-technologyelectrochemical-stabilityTrump Tries To Bribe Away His Offshore Wind Demons
The article discusses former President Donald Trump's efforts to halt offshore wind energy projects in the Atlantic Ocean, focusing on two leases held by the French company TotalEnergies. These leases, awarded through competitive auctions in 2022, cover large areas off the coasts of New York (the New York Bight) and the Carolinas, with a combined potential capacity of approximately 4.3 gigawatts of offshore wind power. TotalEnergies has no immediate plans to develop turbines on these sites while Trump remains in office. The projects promise significant cost savings for local electricity ratepayers, as offshore wind can mitigate price spikes in natural gas and other energy sources. Despite judicial rulings limiting Trump's ability to halt projects already underway, he has pursued a settlement to cancel these two leases. Under the proposed agreement reported by The New York Times, the U.S. Interior Department would cancel the leases, and the Justice Department would pay TotalEnergies over $928 million to reimburse their winning bids. In exchange,
energyoffshore-windrenewable-energyTotalEnergieswind-farmselectricityUS-energy-policy300,000 New EV Chargers Planned For Latin America - CleanTechnica
ZapCharge, the international brand of the Chinese company Shaanxi Fast Charger New Energy Co., Ltd., has announced plans to install 300,000 new electric vehicle (EV) chargers across Latin America by 2030. The company aims to deploy 50,000 charging stations by 2027 as part of building an interconnected EV charging network that serves both urban and rural areas. This ambitious target significantly exceeds typical installation scales, reflecting a major push to expand EV infrastructure in the region. The scale of ZapCharge’s plan is notable given the current state of Latin America’s EV charging market, where many countries only have a few thousand public chargers. Industry experts estimate that between 400,000 and 800,000 charging points will be needed to meet future demand, with each EV owner requiring approximately 1.5 charging points in various daily locations. If ZapCharge succeeds, it could become the dominant player in Latin America’s emerging EV charging market, potentially leveraging this position to support Chinese EV manufacturers
energyelectric-vehiclesEV-chargerscharging-infrastructureclean-energyLatin-Americarenewable-energyScandlines Races To Fully Electrify Ferry Services As Fehmarn Tunnel Stalls - CleanTechnica
Danish-German shipping company Scandlines has launched Baltic Whale, a zero-emission, all-electric freight ferry operating on the Puttgarden–Rødby route between Germany and Denmark. This vessel, equipped with a 10 MWh battery and rapid automated charging system, increases freight capacity by 27% and reduces truck wait times despite high traffic volumes. Baltic Whale complements Scandlines’ existing hybrid Ro-Pax ferries, which carry passengers, cars, and freight, enabling the company to shift heavy truck traffic onto a specialized platform and enhance operational efficiency on this key Baltic Sea corridor. Scandlines’ electrification efforts come amid delays to the Fehmarn Belt Fixed Link, an 18-kilometer immersed tunnel designed to replace ferry services by providing faster road and rail crossings. Originally slated for completion in 2029, the tunnel project now faces at least a two-year delay due to logistical challenges with immersion vessels and rail infrastructure development, pushing the opening to 2031 or
energyelectric-ferrybattery-technologyhybrid-vesselsmaritime-electrificationrapid-chargingsustainable-transportThe Baltic Whale Enters Battery-Electric Freight Service On The Fehmarn Belt - CleanTechnica
Scandlines has introduced the Baltic Whale, a high-capacity battery-electric freight ferry, on the 18.5-kilometer Puttgarden–Rødby corridor across the Fehmarn Belt. The vessel began commercial service on March 10th, marking a significant advancement in zero-emission short-sea freight transport. Built over four years at Cemre Shipyard, the ferry features a 10 MWh lithium-ion battery system integrated with high-capacity shore power infrastructure at both ports, enabling rapid charging cycles of about 12 minutes. This fast shore charging supports a high-frequency turnaround model, allowing crossing times of approximately 45 minutes when charging at both terminals or about 60 minutes with single-port charging to optimize battery use and maintain schedule reliability. Designed specifically as a freight platform rather than a mixed passenger vessel, the Baltic Whale measures 147.4 meters in length and 25.4 meters in beam, with two cargo decks accommodating 66 freight units. Port upgrades at P
energybattery-electric-ferrylithium-ion-batteryshore-power-infrastructuremaritime-energy-managementelectric-propulsionclean-transportationUS’ nuclear firm gets safety design approval for isotope reactor initiative
California-based nuclear company Oklo Inc. has achieved a significant milestone by receiving approval from the U.S. Department of Energy (DOE) for a Nuclear Safety Design Agreement (NSDA) related to its Groves Isotopes Test Reactor. This approval allows Oklo, through its subsidiary Atomic Alchemy, to proceed with detailed safety design work under the DOE’s Reactor Pilot Program (RPP), marking a transition from early planning to advanced technical development. The Groves Isotopes Test Reactor differs from traditional nuclear plants as it focuses on producing vital radioisotopes used in medical imaging, cancer therapies, scientific research, and national security, rather than electricity generation. The NSDA approval is a critical step in the DOE’s RPP authorization pathway, which aims to accelerate the deployment of innovative nuclear technologies and expand U.S. industrial capacity. Following this approval, Oklo will submit its Preliminary Documented Safety Analysis (PDSA) for DOE review, further refining the reactor’s safety framework—a prerequisite
energynuclear-energyisotope-reactorsafety-designDepartment-of-Energyadvanced-nuclear-technologyreactor-pilot-programProjectile strikes near Iran's only nuclear plant, no damage reported
A projectile struck the grounds of Iran’s Bushehr Nuclear Power Plant (NPP) on Tuesday evening, according to the International Atomic Energy Agency (IAEA). The Vienna-based agency confirmed there were no injuries or damage to the reactor or plant infrastructure, and the Bushehr reactor remains fully operational with safety systems intact. IAEA Director General Rafael Grossi called for restraint amid ongoing conflicts to avoid any risk of a nuclear accident, emphasizing the need for calm. The Bushehr plant, Iran’s only operational nuclear facility since 2011, is a critical energy asset connected to the national power grid. The incident occurs amid heightened tensions following the U.S. withdrawal from the 2015 nuclear deal in 2018, which led to stringent sanctions on Iran’s economy. Despite international concerns, Iran insists its nuclear program is solely for peaceful purposes, focusing on energy generation and scientific research. The IAEA and global observers continue to monitor the situation closely due to the potential risks of military actions near
energynuclear-powerIranBushehr-Nuclear-Power-PlantIAEAnuclear-safetynuclear-energyBrazil Fuels BYD Growth in the Americas, Mexico & Argentina Place 100,000 Orders - CleanTechnica
The article highlights BYD's significant growth in the Americas, particularly fueled by strong sales in Brazil, Mexico, and Argentina. In Brazil, the BYD Dolphin Mini (also known as Seagull) became the top-selling vehicle in February 2025, marking the first time an electric vehicle (EV) or Chinese brand achieved this milestone in the country. BYD sold approximately 112,900 vehicles in Brazil in 2025 and aims to reach 250,000 sales this year. The company is producing several models at its Bahia plant, including the Seagull, Sealion 05, and Atto 3, and is expanding production capacity with a goal of 600,000 units, potentially accelerating faster than expected. BYD's growth strategy also involves leveraging Mercosur trade agreements to bypass import quotas on Chinese vehicles, enabling broader market penetration in South America. Despite political and regulatory challenges in some regions—such as EU restrictions on imported batteries affecting corporate fleet sales—BYD continues
energyelectric-vehiclesBYDautomotive-industryclean-technologybattery-technologyEV-market-growthHydrogen at Sea Just Got Even More Expensive: What DNV’s Safety Findings Mean - CleanTechnica
The article discusses recent safety findings by DNV regarding hydrogen as a marine fuel and their implications for the cost and engineering challenges of hydrogen-powered ships. DNV emphasizes that hydrogen requires a more stringent, design-based safety regime than LNG, alcohol fuels, or batteries, involving multiple layers of containment, detection, and operational controls. These safety measures are not merely regulatory details but represent significant capital and operational costs embedded in ship design, maintenance, and procedures. The European Maritime Safety Agency’s (EMSA) guidance, while non-mandatory, recommends secondary enclosures for all hydrogen leak sources, signaling a conservative approach that moves beyond relying on buoyancy and open-air dispersion alone. This shift increases the baseline cost of hydrogen fuel systems in maritime applications. The engineering challenges stem from hydrogen’s unique properties: it leaks easily, ignites with minimal energy, and can rapidly form explosive concentrations, making incidents escalate faster than detection and response can manage. Consequently, passive and automatic safety protections are necessary, which add complexity and
energyhydrogen-fuelmaritime-safetyDNVship-designdecarbonizationfuel-technologyEurope Must Not Let Airlines Sabotage Clean Aviation Fuels - CleanTechnica
The article from CleanTechnica highlights concerns over European airlines, notably Lufthansa and the Airlines for Europe (A4E) lobby group, attempting to delay or weaken the 2030 target for synthetic aviation fuels (e-SAFs) derived from green hydrogen. Airlines argue that financial and market challenges justify postponing the 1.2% e-SAF mandate, but this risks undermining Europe’s emerging clean aviation fuel industry at a critical time. The article warns that delaying these targets would shift demand toward biofuels, which Europe cannot sustainably supply in sufficient quantities, or worse, increase reliance on fossil kerosene imports. This would raise emissions, weaken Europe’s energy sovereignty, and jeopardize climate goals. The piece underscores that the SAF mandate is already proving effective, citing the UK’s SAF usage exceeding targets and significant SAF production capacity under construction in Europe. It also notes that while startups are driving e-SAF development, major fuel suppliers and oil companies have yet to meaningfully invest in this
energyclean-aviation-fuelssynthetic-fuelsgreen-hydrogensustainable-aviation-fuelenergy-securityclimate-policyGreece Risks Becoming Trump’s Trojan Horse in the Fight to Decarbonise Shipping - CleanTechnica
The article discusses Greece’s recent divergence from the European Union’s unified stance on decarbonizing shipping under the International Maritime Organization (IMO). While the EU had developed a coordinated climate position to reduce CO2 emissions from shipping, Greece abstained from supporting this in a key IMO vote and has since aligned itself with Saudi Arabia to develop a joint position. This move bypasses the EU’s collective approach and risks triggering an infringement procedure by the European Commission. The Greek government claims it remains committed to the EU’s position, but its cooperation with Saudi Arabia and alignment with US-backed interests—who oppose EU carbon pricing and the IMO’s Net-Zero Framework—raises concerns about undermining Europe’s climate leadership. The article highlights that Greece’s stance is influenced by its large shipping industry, heavily involved in transporting fossil fuels, which benefits Greek shipowners and overseas oil companies. However, this position is seen as short-sighted given the global transition away from fossil fuels and the growing importance of green shipping fuels. The
energydecarbonizationshippinggreen-fuelsclimate-policyEU-energy-securitycarbon-emissionsIndustry & Civil Society Groups Call for a New European investment Plan - CleanTechnica
The article highlights a joint call from industry and civil society leaders urging European Union policymakers to establish a new, large-scale European investment plan to address pressing economic, geopolitical, climate, and technological challenges. The authors emphasize that incremental or national-level solutions are insufficient, given Europe's chronic underinvestment and declining industrial output since 2019. They cite an €800 billion annual investment gap identified by Mario Draghi, with about one-third needing public financing. The imminent end of the Next Generation EU fund risks a sharp decline in productive investment at a critical time when Europe must accelerate decarbonization, enhance defense, secure raw materials, modernize industry, and ensure affordable energy and quality public services. The letter argues that Europe's industrial sovereignty depends on collective investment capacity supported by reformed fiscal rules that allow sustained public spending aligned with modern economic realities. It contrasts Europe's current fiscal constraints with the expansive public investment strategies of the US and China, which use a combination of procurement, tax incentives, production aid, and coordinated planning
energyEuropean-investmentdecarbonisationindustrial-policyenergy-securitypublic-financinginnovationIran Conflict Set to Hit Petrol Drivers 5 Times Harder than EV Drivers — Analysis - CleanTechnica
The article from CleanTechnica highlights new research showing that petrol drivers in the EU will be disproportionately affected by rising fuel costs stemming from the Iran conflict, paying up to five times more than electric vehicle (EV) drivers for equivalent travel distances. With oil prices exceeding $100 per barrel, fueling a petrol car is expected to increase by €3.80 per 100 km, compared to just a €0.70 rise in electricity costs for EVs. For high-mileage company cars, this translates into an additional €89 per month for petrol vehicles versus only €16 for EVs. The analysis emphasizes that accelerating EV adoption is critical to reducing dependence on volatile oil markets and shielding drivers from fuel price shocks. The EU currently spends €67 billion annually on oil imports for cars, but the 8 million EVs on European roads have already saved 46 million barrels of oil worth €2.9 billion. However, political resistance from some EU leaders and the car industry to strengthening CO2 emissions and
energyelectric-vehiclesoil-pricesEU-energy-policyfuel-costsEV-adoptionCO2-targetsHow Electric Cars Cut Oil Dependence & Drive Energy Security - CleanTechnica
The article from CleanTechnica emphasizes the critical role electric cars play in reducing the European Union's dependence on imported oil, especially amid the energy price surges triggered by conflicts in the Middle East. Road transport is identified as the largest contributor to Europe’s oil consumption, costing the EU €67 billion in oil imports by 2025. With nearly 8 million electric vehicles (EVs) already on EU roads, the region is projected to save around 46 million barrels of oil in 2025 alone, equating to €2.9 billion in avoided import costs. The analysis warns that weakening EU electrification targets could significantly increase oil imports and associated costs, potentially adding €45 billion in expenses between 2026 and 2035. Conversely, ambitious electrification policies could save Europe approximately €150 billion in fuel costs over the next decade. The article also highlights the economic advantages of EVs during energy crises, noting that driving petrol cars is expected to be more than twice as expensive as driving
energyelectric-carsoil-dependenceenergy-securityvehicle-electrificationEU-energy-policyclean-powerOp-Ed: What China Did Right—And What India Is Doing Differently - CleanTechnica
The article contrasts China’s and India’s approaches to electric vehicle (EV) adoption, highlighting how each country’s strategy reflects its political and economic context. China rapidly scaled its EV industry through centralized industrial policy, massive subsidies, and local government coordination starting in the late 2000s. This approach prioritized manufacturing scale, infrastructure development, and platform dominance, enabling China to become the world’s largest EV market and a technology exporter. However, China’s model also led to subsidy dependence, market distortions, and overcapacity, relying heavily on centralized fiscal power that India neither possesses nor politically tolerates. In contrast, India’s EV transition has been slower and more fragmented but is evolving into a distinct, federally coordinated ecosystem optimized for affordability and mass-market mobility rather than export dominance. India’s strategy leverages a “double-incentive” framework combining central government schemes like PM E-DRIVE and the Production Linked Incentive (PLI) with state-level experimentation and policy innovation. The central government focuses on system
energyelectric-vehiclesEV-adoptionChina-EV-marketIndia-EV-ecosystembattery-supply-chainclean-energy-transitionTesla signs $4.3 billion deal with LG to boost energy storage push
Tesla has entered a $4.3 billion agreement with LG Energy Solution to supply battery cells for its expanding energy storage business. The batteries will be produced at LG’s Lansing, Michigan facility, which was originally a joint venture with General Motors but has since been retooled to manufacture lithium iron phosphate (LFP) prismatic cells. These domestically produced cells will power Tesla’s Megapack 3 energy storage systems made in Houston, supporting the company’s strategy to localize its battery supply chain and reduce reliance on imports, particularly from China. This move aligns with broader U.S. government efforts to boost domestic manufacturing and secure energy infrastructure amid rising electricity demand driven by data centers and electrification. Tesla’s energy storage division is growing rapidly, generating $12.8 billion in revenue last year and accounting for 13% of the company’s total revenue, even as its automotive segment faced declines. The Megapack systems help utilities store renewable energy and manage grid demand fluctuations. Meanwhile, LG Energy
energyenergy-storagebattery-technologyTeslaLG-Energy-Solutionlithium-iron-phosphaterenewable-energyPerovskite-silicon solar cells cross 30% efficiency, set new record
Researchers at EPFL and CSEM have developed a triple-junction solar cell combining a silicon bottom cell with two perovskite thin-film layers, achieving a certified efficiency of 30.02%, surpassing the previous record of 27.1%. This breakthrough is notable not only for its high performance but also for its focus on scalability and cost-effectiveness, aiming to make high-efficiency solar technology practical for widespread terrestrial use. Unlike traditional high-efficiency cells that rely on expensive III-V semiconductors used mainly in space applications, this design leverages more affordable materials, potentially reducing costs by a factor of 1,000 per watt. The team addressed key technical challenges by introducing a molecule to improve perovskite crystal formation, boosting the top cell voltage to 1.4 volts, and employing a new three-step fabrication method to enhance near-infrared absorption in the middle layer. Additionally, nanoparticles were incorporated to reflect light back into the middle cell, increasing current. The researchers
energysolar-cellsperovskitesiliconphotovoltaicsrenewable-energymulti-junction-solar-cellsAbandoned coal station set to house UK's first fusion power plant
The UK is set to transform the former West Burton coal-fired power station into the nation’s first fusion power plant, marking a major advance in clean energy development. The USD 266 million (GBP 200 million) project, part of the Spherical Tokamak for Energy Production (STEP) program, aims to demonstrate how fusion can provide reliable, low-carbon power. This redevelopment will shift the UK’s fusion efforts from research to full delivery, supporting up to 8,000 jobs during peak construction and creating long-term roles in engineering, operations, and supply chains. The initiative is seen as a key step toward establishing a commercial fusion industry in the UK by around 2040. The project aligns with the UK government’s broader Fusion Strategy, which seeks to attract private investment and build a home-grown fusion energy sector, enhancing energy independence amid rising fossil fuel prices due to global conflicts. Local authorities have welcomed the redevelopment, highlighting its potential to drive regional economic growth, innovation, and skills development. Training pathways
energyfusion-powerclean-energyUK-energy-innovationfusion-energy-industryenergy-independencesustainable-power-generationAs Fossil Fuel Costs Rise, Renewable Energy And Storage Shine
The article highlights the growing prominence of renewable energy and energy storage in the U.S. as fossil fuel prices rise due to global market volatility. Unlike in the past, energy consumers now have more options to mitigate the impact of fossil fuel price spikes, largely because renewable energy and storage dominate new utility-scale power capacity. While federal energy policy has been slow to act, several states are proactively advancing renewable energy initiatives and storage solutions to stabilize electricity costs and support grid reliability. New York State is spotlighted for its robust renewable energy growth, including incentives for homeowners to install home battery systems that can qualify for about $3,000 in upfront rebates and save roughly $200 annually through utility demand-response programs. These programs leverage virtual power plants (VPPs), which use grid software to coordinate distributed energy resources like batteries and solar panels, helping utilities avoid expensive gas peaker plants. New York is also expanding its wind and solar portfolios and collaborating with Canada on cross-border energy projects. New Jersey, despite setbacks in offshore
energyrenewable-energyenergy-storagevirtual-power-plantssolar-powersmart-gridenergy-incentivesBYD, Kia, & Volkswagen Show EV Revolution Is Still Going Strong - CleanTechnica
The article highlights ongoing momentum in the electric vehicle (EV) market despite some setbacks, such as Volvo withdrawing its EX30 from the U.S. due to governmental resistance to EVs. It contrasts this with the global push toward electrification, emphasizing BYD’s expanding international presence. BYD is actively exploring acquisitions and joint ventures, particularly in Canada, though its CEO Li Bin is skeptical about joint ventures and cautious about acquisitions. BYD is growing its manufacturing footprint with new factories in Hungary and planned facilities in Turkey, while exporting more vehicles than it sells domestically in China. The article notes the potential impact of BYD producing competitively priced EVs in Canada, which could legally be sold in the U.S. market, potentially disrupting established manufacturers. In Europe, Kia has announced pricing and features for its new entry-level EV, the EV2, which will be available starting July with two battery options and a range up to 448 km. The base model, despite its shorter range, comes well
energyelectric-vehiclesBYDKiaVolkswagenEV-marketautomotive-industryAsia-Pacific Takes the Lead in Global Wind Expansion As The Philippines Moves Into The Investment Spotlight - CleanTechnica
The Asia-Pacific region is rapidly becoming the central driver of global wind energy expansion, surpassing its previous status as an emerging contributor. According to the Global Wind Energy Council (GWEC), the region is on track to add roughly 150 gigawatts of new wind capacity in 2025—the highest annual total ever recorded—signaling a structural shift in where wind projects are developed and where investment capital is flowing. China remains the largest market by volume, but other Asia-Pacific countries, including India and Southeast Asian nations, are moving from policy formulation to project execution. This momentum is expected to push total global wind installations beyond two terawatts by the end of the decade, reflecting wind power’s growing role in industrial strategy, energy security, and economic development, especially in fast-growing Asian economies with rising electricity demand. Within this regional transformation, the Philippines is emerging as a key market transitioning from potential to active development. Historically recognized for its offshore wind resources but hindered by regulatory and infrastructure challenges, recent
energywind-energyrenewable-energyAsia-Pacificclean-energyoffshore-windenergy-investmentGoogle’s data center power playbook comes into focus
Google is advancing its strategy to power new data centers with clean energy, exemplified by a recent agreement with Michigan utility DTE to add 2.7 gigawatts of new energy resources near Detroit. This plan includes 1.6 GW of solar power, 400 MW of four-hour energy storage, 50 MW of long-duration storage, and 300 MW of unspecified “additional clean resources” such as wind, hydro, nuclear, or geothermal. The remaining 350 MW will come from demand response programs, where electricity use is temporarily reduced during peak demand. While some details remain unclear—such as the exact makeup of the “clean resources” and how demand response will be implemented—Google is leveraging its Clean Transition Tariff to pay a premium for specific power types and encourage utilities to integrate these technologies into long-term planning. This initiative follows a similar approach used in a Minnesota data center project and reflects a shift in Google’s practice: power projects are now announced alongside data center developments rather than
energydata-centersrenewable-energyenergy-storageclean-energypower-purchase-agreementsenergy-efficiencyChery Once Tried Canada and Never Got to First Base, Could this Comeback be a Home Run? - CleanTechnica
The article discusses Chery Automobile's historical and potential future presence in the Canadian electric vehicle (EV) market. Chery, one of three leading Chinese automakers alongside BYD and Geely poised to enter Canada under a new quota system, may have a unique advantage due to its prior attempt to enter the Canadian market nearly two decades ago. Canada's new regulatory framework allows up to approximately 49,000 Chinese-built EVs annually, with manufacturers needing to meet Transport Canada’s safety standards and obtain import approvals. Chery's previous experience with vehicle registration and pre-clearance could enable it to navigate these requirements more swiftly than newcomers. Between 2006 and 2010, Chery aggressively expanded globally, transitioning from a regional manufacturer to a global brand by exporting vehicles and establishing localized assembly hubs in countries like Russia, Ukraine, and Egypt. Their strategy focused on price-sensitive developing markets, leveraging Complete Knock-Down (CKD) kits to reduce tariffs and costs. Chery found success in Eastern Europe,
energyelectric-vehiclesautomotive-industryChinese-automakersvehicle-exportmarket-expansionregulatory-complianceNew ion pump technology promises more efficient water desalination
Researchers from the University of California, Irvine, and Tel Aviv University have developed a novel ion pump that efficiently removes salt and heavy metals from water using a low-voltage electrical signal without any moving parts, fuel, or chemical reactions. This ratchet-based ion pump operates via a rapid electrical pulsing that creates a directional flow of ions through a nanoporous membrane sandwiched between ultrathin metal layers. Unlike traditional desalination methods that rely on energy-intensive electrochemical reactions, this solid-state device harnesses structural asymmetry and nanoscale metal-electrolyte interfaces to achieve a steady ion flux with significantly lower energy consumption. In proof-of-concept tests, the system successfully removed 50 percent of salt from water at minimal voltage and maintained ion flow even against opposing forces by integrating ion-selective membranes. The technology’s precision also allows selective removal of toxic heavy metals like lead at trace concentrations without depleting essential minerals, making it highly promising for applications beyond water purification. Potential uses include lithium harvesting
energymaterialsion-pumpwater-desalinationnanoporous-membranesolid-state-devicelow-voltage-technologyLenovo unveils world-first 1,000Wh/L silicon-anode battery for laptops
Lenovo has unveiled a groundbreaking silicon-anode battery for laptops, achieving the world’s first energy density of 1,000Wh/L. This proof-of-concept battery, developed in collaboration with Shanghai Jiao Tong University, offers over a 10% improvement in energy density compared to previous generations, with a capacity of up to 99.9Whr without increasing the battery’s physical size. This advancement promises longer battery life and enhanced performance for future Lenovo notebooks and workstations while maintaining existing device form factors, setting a new standard for portable computing energy storage. In addition to the battery innovation, Lenovo announced its latest generation of AI-ready workstations, which will be showcased at NVIDIA GTC 2026. These include the ThinkPad P14s Gen 7, P16s Gen 5, P1 Gen 9, and the ThinkStation P5 Gen 2 desktop, designed to meet the needs of students, engineers, data scientists, and professionals requiring high-performance computing for workflows
energybattery-technologysilicon-anode-batteryLenovolaptopsenergy-densityportable-computing484 New Electric Buses Funded By UK Government - CleanTechnica
The UK government has allocated funding to purchase approximately 484 new electric buses, aiming to replace polluting diesel buses and improve public transportation in several regions. This investment focuses primarily on South Yorkshire (£33.4 million for 186 buses), Tees Valley (£11 million for 82 buses), and Devon (£7.53 million for 90 buses). Officials emphasize that electric buses will enhance connectivity for residents, provide cleaner air, and offer a more reliable and pleasant transit experience. Electric buses offer multiple advantages over diesel counterparts, including higher energy efficiency, regenerative braking, lower operating costs due to cheaper electricity, and the elimination of direct toxic emissions, benefiting both passengers and drivers. Additionally, electric buses have the potential to support local power grids through bidirectional charging technology, forming virtual power plants that reduce reliance on gas-powered backup electricity generation. This innovative use of electric bus batteries could further contribute to cleaner energy systems in the future.
energyelectric-busesUK-government-fundingclean-transportationregenerative-brakingvirtual-power-plantszero-emission-vehiclesOp-Ed: Lucid Motors' EV Manufacturing is Now Inside a Geopolitical Fault Line - CleanTechnica
The article discusses Lucid Motors’ expanding electric vehicle (EV) manufacturing presence in Saudi Arabia, centered on its assembly facility near Jeddah. This development is closely tied to Saudi Arabia’s Public Investment Fund (PIF), the company’s largest shareholder, which has invested billions to support Lucid’s growth. The partnership aligns with Saudi Vision 2030, the kingdom’s strategic plan to diversify its economy away from oil by fostering advanced manufacturing sectors, including EV production. The Jeddah plant symbolizes Saudi Arabia’s ambition to build a local EV ecosystem encompassing assembly, supply chains, and potentially battery manufacturing, while also providing Lucid a strategic international manufacturing foothold. However, the article highlights significant geopolitical risks due to escalating tensions in the Gulf region. Although the factory is not near immediate military targets, the broader conflict complicates logistics and supply chains critical to EV production. Lucid’s Saudi operation depends heavily on parts sourced from North America and Asia, making it vulnerable to disruptions in shipping routes, increased
energyelectric-vehiclesmanufacturingSaudi-Vision-2030renewable-energybattery-productionautomotive-industryDilemmas About Food Systems In Times Of US Federal Government Mayhem - CleanTechnica
The article from CleanTechnica highlights the detrimental impact of the Trump administration's policies on the US food system and environment. It criticizes the abandonment of clean energy investments and regulatory rollbacks that have made food production less safe and more expensive, including the approval of numerous food chemicals without sufficient oversight. The administration’s promotion of dietary guidelines favoring meat and dairy, influenced by industry research, further exacerbates environmental and health concerns. Food systems are responsible for 26%–34% of global greenhouse gas emissions, posing a significant barrier to meeting climate goals. A 2025 study in Environmental Research Food Systems reveals a stark disparity in food-related emissions, with a small wealthy segment producing as much as the bottom half of the population combined. The study emphasizes that emission reductions must be equitable, ensuring lower-income populations maintain nutritional adequacy while high emitters make the largest cuts. The article also explores food justice as a response to systemic inequities in food access, particularly under policies that have cut funding to programs
energygreenhouse-gas-emissionsclimate-changefood-systemsenvironmental-policysustainabilityfood-justiceMacBook Neo, AirPods Max 2, iPhone 17e, and everything else Apple announced this month
In March, Apple announced a range of new products spanning from budget-friendly devices to high-performance laptops and accessories. The company introduced the iPhone 17e, a budget model priced at $599, featuring the A19 chip, 256GB storage, improved wireless charging with MagSafe and Qi2, and a faster, more energy-efficient C1X cellular modem. Alongside, Apple released the M4 iPad Air, which is 30% faster than its predecessor, equipped with an 8-core CPU, 9-core GPU, 12GB unified memory, and enhanced AI capabilities, available in multiple colors and storage options. Apple also unveiled new MacBook Pro models powered by the M5 Pro and M5 Max chips, designed to significantly boost AI task performance—up to 4x faster than the previous generation. These laptops offer up to 24 hours of battery life, Thunderbolt 5 support, and faster storage options starting at 1TB. Prices range from $2
energyIoTApple-productswireless-chargingAI-chipsmobile-devicesbattery-lifeNiv-AI exits stealth to wring more power performance out of GPUs
Niv-AI, a Tel Aviv-based startup founded in 2025, has emerged from stealth with $12 million in seed funding to address inefficiencies in GPU power usage in AI data centers. These centers often experience millisecond-scale power surges as GPUs switch tasks, leading operators to throttle GPU performance by up to 30% or invest in costly temporary energy storage. This results in significant wasted electricity and lost revenue, as highlighted by Nvidia CEO Jensen Huang. Niv-AI aims to solve this by deploying rack-level sensors that measure GPU power consumption with high precision and developing tools to optimize power management, thereby unlocking more of the existing GPU capacity. The company plans to use the collected data to build AI models that predict and synchronize power loads across data centers, effectively acting as a "copilot" for data center engineers. Niv-AI expects to have operational systems in several U.S. data centers within six to eight months. The startup envisions its technology as an "intelligence layer
energydata-centersGPU-power-managementAI-energy-efficiencypower-grid-integrationsensorsAI-in-energy-managementFirst light water reactor at new nuclear plant reaches full power
The first light-water reactor at Russia’s new Kursk II nuclear power plant has reached full power during its commissioning phase. This 1,250 MWe VVER-TOI reactor, connected to the grid in December 2023, underwent a series of tests at various capacity levels to verify its performance and safety. Kursk II is located in western Russia, near the Ukrainian border, and replaces the older Kursk plant, which housed four RBMK-1000 reactors that were shut down between 2021 and 2024. The new facility will feature four advanced VVER-TOI reactors, each with a capacity of 1,250 MWe and an expected service life of up to 100 years. The VVER-TOI design is a third-generation pressurized water reactor (PWR) developed from the Soviet-era VVER technology, known for its inherent safety due to the use of ordinary water as both coolant and neutron moderator. Improvements over previous models include upgraded pressure vessels
energynuclear-powerlight-water-reactorVVER-TOInuclear-energypower-plantreactor-technologyUS' largest offshore wind energy project completes construction
The US offshore wind energy industry has recently achieved significant milestones with two major projects, Vineyard Wind 1 and Revolution Wind, overcoming political and legal challenges. Vineyard Wind 1, an 800-MW project, completed physical construction with all 62 turbines installed, marking it as the largest offshore wind farm in the US to reach this stage. Despite setbacks such as a blade failure and a federal "stop work" order, the project is poised to supply power to Massachusetts’ grid. Meanwhile, Revolution Wind, a 704-MW joint venture between Ørsted and Skyborn Renewables, began delivering electricity to Rhode Island and Connecticut, providing affordable and reliable power to approximately 350,000 homes and projecting nearly $500 million in annual savings for ratepayers. Both projects navigated legal hurdles after the Trump administration issued a halt on five major offshore wind projects citing national security concerns. Federal courts overturned these orders, ruling that the government lacked sufficient evidence for the shutdown, allowing the industry to continue progressing
energyoffshore-windrenewable-energywind-turbinesclean-energyenergy-infrastructureUS-energy-projectsUK: New 1.4MW mission-focused supercomputer to power fusion research
The UK government is investing £45 million (approximately $60 million) to build Sunrise, a 1.4-megawatt AI-focused supercomputer dedicated to accelerating nuclear fusion research. Installed at the UK Atomic Energy Authority’s Culham campus in Oxfordshire, Sunrise is set to begin operations in June and will be the most powerful AI supercomputer specifically designed for fusion energy science. By integrating advanced computing with physics-informed artificial intelligence models, the system aims to enable faster, more detailed simulations of plasma behavior and reactor materials under extreme conditions, which are critical challenges in fusion research. This approach will facilitate the creation of digital twins—virtual reactor models—that can test designs and operating conditions before costly physical prototypes are built. Sunrise will deliver up to 6.76 exaFLOPS of AI modeling performance, leveraging AMD EPYC processors, AMD Instinct GPUs, and Dell PowerEdge servers with WEKA storage. The project enjoys support from Intel, the University of Cambridge, and the UK Atomic
energyfusion-energysupercomputerartificial-intelligencenuclear-fusionhigh-performance-computingmaterials-scienceMy Zeekr 7X Decision - CleanTechnica
The article "My Zeekr 7X Decision" from CleanTechnica details Steve Nixon’s experience and rationale for purchasing a Zeekr 7X electric vehicle (EV) in Australia. After two years of research and observing the rise of EV popularity, Steve replaced his 2016 Mercedes-Benz GLC250d, which was costly to maintain, with the Zeekr 7X. He highlights the lower maintenance demands of the EV, with services required every two years or 40,000 km, compared to the expensive annual servicing of his previous diesel vehicle. While he appreciates the Zeekr’s design, driving experience, and tech package, he notes some drawbacks such as occasional phantom braking by the camera-based cruise control and inconsistent Apple CarPlay connectivity. Steve considered several EV options including Tesla Model Y, Xpeng G6, and BYD Sealion 7 before ultimately choosing the Zeekr 7X, partly due to its price point and features. He took delivery
energyelectric-vehiclesbattery-electric-vehiclesEV-technologyautomotive-technologywireless-connectivitysmart-car-featuresWhat Do Multiple Arrests in Indonesia Mean for Europe’s Biofuels Policy? - CleanTechnica
The article discusses recent arrests in Indonesia linked to a large-scale fraud involving the mislabelling of crude palm oil as Palm Oil Mill Effluent (POME), a waste product used in Europe’s biofuels market. Indonesian authorities detained Fadjar Donny Tjahjadi, the Technical Director of Customs, along with other suspects accused of facilitating the export of hundreds of millions of euros worth of palm oil disguised as POME. These exports have been supplied to major European biofuel producers such as Eni, Repsol, and Neste. The arrests highlight serious concerns about the integrity of Europe’s waste-based biofuel supply chains, which have been under scrutiny for years due to suspicions of fraud and mislabelling. Europe’s biofuels policy has increasingly relied on waste materials like POME and Used Cooking Oil (UCO) as sustainable alternatives to crop-based biofuels, which have been restricted due to environmental concerns such as deforestation. However, the rapid growth in demand for these
energybiofuelspalm-oilsustainable-aviation-fuelwaste-biofuelsEU-energy-policygreen-energy-transitionLet’s Not Pour Cold Water on the EU Car Industry’s EV Momentum - CleanTechnica
The article from CleanTechnica argues against weakening the European Union’s 2030 climate targets for carmakers, emphasizing that these regulations have been crucial in driving investment and progress toward electric vehicles (EVs). Despite concerns about infrastructure gaps and battery production capacity, the author contends that delaying or diluting targets based on current challenges is shortsighted. The global automotive market is rapidly shifting toward electrification, with significant growth in battery electric vehicle (BEV) sales not only in China but also in emerging markets like Brazil, India, and Vietnam. These markets favor affordable EVs from Chinese manufacturers, which is beginning to erode the export volumes of traditional Western automakers. The article stresses that continuing to manufacture combustion engines for export is no longer viable; instead, Europe must focus on improving electric models and vertically integrating key components such as batteries to remain competitive. Furthermore, the article highlights that transitional technologies like plug-in hybrids (PHEVs) are unlikely to sustain Europe’s automotive competitiveness or supplier base.
energyelectric-vehiclesbattery-technologyautomotive-industryclean-energyclimate-policyelectric-mobilitySierra Club Sues Trump Administration for Failing Americans’ Public Health from Gas Plant Pollution - CleanTechnica
The Sierra Club, along with environmental allies, has filed a lawsuit against the Trump administration’s Environmental Protection Agency (EPA) in the U.S. Court of Appeals for the D.C. Circuit. The suit challenges the EPA’s inadequate Clean Air Act standards for nitrogen oxides (NOx) emissions from gas-fired power plants, which contribute to smog and cause serious public health issues such as asthma, cardiovascular problems, hospital visits, missed school and work days, and premature death. The EPA had failed to update NOx pollution limits for 20 years until pressured by environmental groups in 2022, but the Trump-era final rule not only allowed increased NOx pollution from some plants but also completely omitted any analysis of the rule’s impact on public health—a central focus of the Clean Air Act. The Trump administration’s EPA has further announced it will broadly apply this policy of ignoring public health impacts in future Clean Air Act standards, effectively disregarding the benefits of lives saved and illnesses prevented due to reduced air
energyclean-energyair-pollutiongas-fired-power-plantsEPA-regulationsenvironmental-lawpublic-healthHydrogen’s Recapitalization Cycle: Thirty Years of Survival Without Profit - CleanTechnica
The article "Hydrogen’s Recapitalization Cycle: Thirty Years of Survival Without Profit" from CleanTechnica examines the persistent yet unprofitable existence of publicly traded hydrogen and fuel cell companies over the past three decades. Companies like Ballard Power, FuelCell Energy, Plug Power, and Bloom Energy have collectively reported billions in cumulative losses, with deficits reaching billions of dollars despite their long operational histories. Unlike typical energy technologies that take decades to mature technologically, the puzzle here is financial: these firms continue to operate publicly without ever generating operating profits, sustained by repeated capital raises and investor interest. The article highlights a cyclical pattern in the stock prices of these hydrogen companies, with peaks occurring roughly every six to ten years, coinciding with waves of political interest, media coverage, and investor enthusiasm tied to hydrogen’s potential as a clean energy solution. These surges align with government strategies and funding initiatives in regions like the EU, Japan, South Korea, and the U.S., which promote hydrogen as a
energyhydrogen-energyfuel-cellsclean-energyrenewable-energyenergy-storagedecarbonizationHistoric Support to Expedite New Power to Southwest Power Pool - CleanTechnica
The Federal Energy Regulatory Commission (FERC) has unanimously approved the Southwest Power Pool’s (SPP) Consolidated Planning Process (CPP), an innovative reform designed to streamline and unify the previously siloed interconnection and transmission planning processes. This change aims to accelerate the development of new power generation projects, reduce costs for consumers, and address the significant backlog of 552 active projects totaling 130 gigawatts stuck in lengthy queues. The legacy process was marked by excessive delays, multiple restudies, and unpredictable costs, leading to a 60% cancellation rate of proposed projects. The CPP consolidates these steps into a single, 180-day interconnection study and introduces a regional, long-term generation expansion plan with pre-designated transmission capacity locations, providing clearer guidance for new projects. Environmental groups such as the Sierra Club and the Natural Resources Defense Council (NRDC) strongly supported the CPP, highlighting the historic consensus achieved through inclusive stakeholder engagement. They praised the reform as a critical advancement in overcoming the bott
energypower-gridclean-energytransmission-planningSouthwest-Power-PoolFederal-Energy-Regulatory-Commissionenergy-policyNvidia unveils AI infrastructure spanning chips to space computing
NVIDIA has introduced a new AI infrastructure centered on its Vera CPU and the Vera Rubin platform, targeting the evolving needs of agentic AI systems and large-scale AI data centers. The Vera CPU, featuring 88 custom Olympus cores and high-bandwidth memory, is designed to efficiently manage thousands of simultaneous AI environments, delivering twice the efficiency and 50% faster performance than traditional rack-scale CPUs. This marks a shift where CPUs play a central role in orchestrating AI workloads alongside GPUs, rather than merely supporting them. Major cloud and infrastructure providers such as Alibaba, Meta, Oracle Cloud Infrastructure, Dell Technologies, and Lenovo plan to deploy systems based on this processor. The Vera Rubin platform integrates seven specialized chips across compute, networking, and storage to create what NVIDIA calls “AI factories,” large-scale facilities capable of generating massive AI token volumes required for modern models. A key configuration, Vera Rubin NVL72, combines 72 GPUs and 36 Vera CPUs in a single rack, delivering up to four times better
energyAI-infrastructureCPUsGPUsdata-centershigh-performance-computingNvidiaOffshore Wind Hits Important Milestones in New England - CleanTechnica
The article highlights significant progress in offshore wind energy development in New England, focusing on two major projects: the Vineyard Wind and Revolution Wind offshore wind farms. Vineyard Wind has completed construction and is expected to generate enough electricity to power over 400,000 homes and businesses in Massachusetts. Meanwhile, Revolution Wind has begun delivering power to the electric grid, supplying enough clean energy for 350,000 homes in Connecticut and Rhode Island. Both projects faced regulatory challenges, including stop-work orders issued by the Trump administration in 2025, which were subsequently overturned by courts, allowing construction to continue and ultimately reach completion. These milestones represent a crucial advancement in the region’s transition to clean, renewable energy, contributing to grid reliability, pollution reduction, and economic benefits such as local employment. Environmental advocates, including leaders from the Sierra Club, emphasize the importance of these projects in combating rising energy prices and fostering a sustainable energy future. The article underscores the broader significance of offshore wind as a key component in the U.S. clean
energyoffshore-windrenewable-energyclean-energywind-powerenergy-gridsustainable-energyStellantis to US Dealers: 25% Sales Growth NOW - CleanTechnica
Stellantis has experienced a significant decline in U.S. auto sales over the past seven years, dropping from a 12.5% market share in 2020 to around 8% in 2024-2025. Key brands such as Chrysler, Fiat, and Dodge have struggled, while Ram and Jeep have not seen substantial growth. The company’s slow adoption of electric vehicles (EVs), particularly among its major brands, has contributed to its sales challenges, with Fiat being a minor exception but having minimal U.S. presence. In response, Stellantis senior executives have set an ambitious target of 25% sales growth for 2026, urging dealers to deliver results with no excuses. The automaker plans to launch several new models that year, including the fully electric Jeep Recon and the extended-range Ram 1500 REV, though most new releases will remain gas-powered. Stellantis is also implementing price reductions (excluding EVs) and increasing marketing efforts to support dealers at local and
energyelectric-vehiclesautomotive-industryStellantisEV-marketrenewable-energytransportationVolkswagen & XPENG Launch ID.UNYX 08 Production: The Fruition of Collaboration - CleanTechnica
Volkswagen and XPENG have jointly launched the production of the ID.UNYX 08, a new electric vehicle developed through their collaboration and assembled at Volkswagen’s Anhui plant in China, a joint venture with JAC. The ID.UNYX 08 is built on an 800V platform and incorporates XPENG’s 5C fast-charging technology and advanced driver-assistance systems (ADAS). The vehicle features a tech-rich interior with expansive screens and a large sunroof, and offers rear-wheel-drive and all-wheel-drive variants producing 308 hp and 496 hp respectively. Equipped with CATL-sourced LFP battery packs, it achieves a CLTC range of up to 730 km. The model, previewed by the ID.EVO concept, marks a stylistic departure from traditional Volkswagen designs and is positioned as a large vehicle by European standards but typical for the Chinese market. This launch exemplifies Volkswagen’s strategy to introduce 20 new new energy vehicle (NEV) models in 202
robotIoTenergyelectric-vehiclesautonomous-drivingbattery-technologyautomotive-technologySamsung bets this island startup can tame the grid with software and batteries
The article discusses how Samsung Ventures has invested €12 million ($13.8 million) in Grid Beyond, a Dublin-based startup specializing in software and hardware solutions to manage electrical grids with batteries and flexible loads. Grid Beyond’s technology addresses the persistent challenge of peak power demand on the grid, which often leads to shortages despite ample generation capacity during off-peak times. Their system integrates hardware controllers with batteries and renewable energy plants, enabling large commercial and industrial users—such as data centers that experience fluctuating power needs during AI training—to smooth out demand spikes and provide rapid grid balancing. This approach helps avoid costly infrastructure expansions and improves grid stability. Grid Beyond’s origins trace back to Ireland, where the island grid faced balancing issues as wind power increased. The company now operates globally, with installations in Australia, Japan, the UK, the US, and Ireland, including a notable 200-megawatt battery in California. By leveraging batteries’ fast response times compared to traditional peaking plants, Grid Beyond can
energyrenewable-energybattery-storagesmart-gridenergy-managementgrid-balancingenergy-transitionDonut Lab solid-state battery charges motorcycle to 70% in 9 minutes
Donut Lab has demonstrated its solid-state battery technology's ultra-fast charging capabilities in a real-world electric motorcycle application, partnering with Verge Motorcycles. Unlike prior tests focusing on individual cells, this experiment evaluated a full 18 kWh air-cooled battery pack integrated into a Verge TS Pro motorcycle. This marks the first public demonstration of Donut Lab’s solid-state batteries operating at pack level inside a working vehicle, highlighting the technology’s high energy density and flexible design that allows different energy capacities within the same physical pack size—an important advantage for space-constrained applications like motorcycles. The charging test, conducted using a public high-power charger at around 20°C, achieved a peak charging power above 100 kW (5C rate). The battery charged from 10% to 50% in about five minutes, reached 70% in just over nine minutes, and 80% in roughly 12 minutes—approximately three times faster than Verge’s previous battery system. Verge Motorcycles CEO Tuomo
energysolid-state-batteryelectric-motorcyclefast-chargingbattery-technologyenergy-densitybattery-pack-designAnother deep tech chip startup becomes a unicorn: Frore hits $1.64B
Frore Systems, an eight-year-old semiconductor startup specializing in liquid cooling systems for chips, has raised $143 million in a Series D funding round led by MVP Ventures, reaching a valuation of $1.64 billion. The company has now raised a total of $340 million. Founded by two former Qualcomm engineers, Frore initially developed air-cooling technology for small fanless electronics but pivoted to liquid cooling for AI chips after a suggestion from Nvidia CEO Jensen Huang, who saw a demo of their technology about two years ago. Frore’s products are compatible with various Nvidia chips and boards, and the company has also developed solutions for Qualcomm and AMD. The rise of Frore reflects the growing investment interest in AI semiconductor technologies, with other startups like Recursive Intelligence and Eridu also achieving significant milestones or launching new AI networking chips. Notable investors in Frore’s latest funding round include Fidelity, Mayfield, Addition, Qualcomm Ventures, and Alumni Ventures. This funding and valuation milestone underscore the increasing importance
energysemiconductor-coolingliquid-cooling-systemsAI-chipsNvidiaQualcommAMDAntonio Gracias says he’s longing for ‘proentropic’ startups — those that are built to survive chaos
Antonio Gracias, founder of Valor Equity Partners, introduced the term "proentropic" to describe startups designed to thrive amid chaos and disruption, such as climate volatility, geopolitical shifts, and rapid technological change. Drawing from the physics concept of entropy—which denotes increasing disorder over time—Gracias envisions proentropic companies as those that anticipate and adapt to unpredictable futures. He cites SpaceX as an example, highlighting firms that embed probabilistic thinking into their strategies, preparing for and benefiting from edge cases rather than relying solely on current market conditions. Gracias also emphasized the need for moral courage in building a better world amid economic and global challenges, pointing to the intersection of climate, energy, and hardware innovation, with Tesla as a key example of integrating software and hardware efficiently. Contrary to prevailing fears about artificial intelligence causing job losses and social unrest, he remains optimistic about AI’s potential. He believes advancements in low-code/no-code tools will democratize entrepreneurship and unleash unprecedented productivity, ultimately shaping whether society moves toward a ut
energyartificial-intelligencestartupsclimate-technologyTeslahardware-integrationtechnology-disruptionThere's More To The South Fork Offshore Wind Farm
The South Fork offshore wind farm, located off Long Island, New York, is a relatively small project at 132 megawatts but plays a crucial role in advancing the U.S. offshore wind industry. It is the nation’s first large commercial-scale offshore wind farm and provides valuable operational data, particularly demonstrating strong performance during winter months, countering claims by Energy Secretary Chris Wright that offshore turbines are inefficient in cold weather. South Fork’s success, alongside other projects like Block Island and a Virginia pilot project, challenges recent federal stop-work orders issued on December 22, 2023, by Interior Secretary Doug Burgum, who cited national security concerns to halt construction on five Atlantic Coast wind farms. These stop-work orders have been controversial and quickly suspended by federal judges, especially since operational offshore wind farms like South Fork and Block Island have not raised similar security issues. The Interior Department’s inconsistent stance—allowing some turbines already connected to the grid to continue while halting others still under construction—has not
energyoffshore-windrenewable-energywind-farmclean-energyUS-energy-policysustainable-powerJapan's nuclear fusion firm begins building its first demonstrator
Japanese nuclear fusion startup Helical Fusion Co., Ltd., founded in 2021 as a spin-off from the National Institute of Fusion Science (NIFS), has commenced construction of its first integrated demonstration device, Helix Haruka. This marks Phase 1 of their project, focusing on assembling and validating a non-planar helical high-temperature superconducting magnet system, with energization tests planned for 2027. Helical Fusion aims to develop fusion energy technology using the stellarator approach, which differs from the more common tokamak design by employing a twisted torus-shaped vessel for plasma confinement. NIFS operates the Large Helical Device (LHD), a leading stellarator research facility that has demonstrated sustained plasma operation for over 54 minutes, providing critical expertise for Helical Fusion’s efforts. Helical Fusion’s demonstration plant development is structured into three phases: Phase 1 involves testing the magnet system; Phase 2 will integrate the magnet with core subsystems and the power-generating system Helix
energynuclear-fusionfusion-energysuperconducting-magnetstellaratorplasma-containmentclean-energyUS aims for 5 GW extra nuclear energy from existing reactors
The U.S. Department of Energy (DOE) has launched the Utility Power Reactor Incremental Scaling Effort (UPRISE) program to increase nuclear power capacity by adding 5 gigawatts (GW) from existing reactors by 2029, contributing to a broader national goal of 400 GW of nuclear capacity by 2050. UPRISE focuses on expanding output from current nuclear plants through power uprates, extending reactor lifespans, and restarting dormant facilities such as Michigan’s Palisades Nuclear Plant, which is set to resume operation in early 2026. This approach aims to rapidly boost electricity supply and maintain grid reliability without the lengthy timelines associated with building new nuclear plants. UPRISE leverages regulatory-approved power uprates that can increase reactor output by up to 20%, supported by efforts to assess plant equipment, streamline supply chains, and develop economic models to encourage investment. The DOE plans workshops to connect plant operators with major electricity users and offers significant federal financing options, including loan
energynuclear-energypower-upratesDOEUPRISE-programelectricity-gridcarbon-free-powerThe Effects Of Congestion Pricing — Pollution Reduction And So Much More - CleanTechnica
New York City implemented congestion pricing in January 2025 with goals established in 2020 through a Cornell-City College of New York collaboration to reduce traffic congestion, improve environmental quality, and generate revenue for social programs. Initial studies from the first six months indicate that vehicle entries into the Congestion Relief Zone (CRZ) decreased by about 11%, with heavy-duty truck entries dropping approximately 18% and car entries by 9%. This reduction in traffic has led to fewer crashes, decreased noise complaints, and significant environmental benefits, including a 22% reduction in particulate matter (PM2.5) pollution within the CRZ. The increased traffic flow and improved conditions have also contributed to a projected $500 million in toll revenue by the end of the year, supporting new initiatives for working-class citizens. The study highlights that congestion pricing effects are dynamic and have grown stronger over time within the tolled zone, while also providing temporary co-benefits in adjacent areas. The policy has encouraged shifts in
energypollution-reductioncongestion-pricingurban-sustainabilitytraffic-managementenvironmental-impactair-qualityWill the Next Disruptive Plane Be European? - CleanTechnica
The article from CleanTechnica highlights the stagnation in aviation innovation despite the sector’s historical role as a technological pioneer. While many industries have rapidly advanced with breakthroughs in electric vehicles, AI, and mobile technology, aviation has largely relied on incremental improvements to existing aircraft designs, such as the Boeing 737 MAX and Airbus A320neo, which trace back to decades-old models. Since 1990, emissions from European aviation have increased, and current efforts have not reversed this trend. The European Union launched ambitious initiatives like the Clean Sky programmes starting in 2007 and its successor, the Clean Aviation Joint Undertaking in 2021, aiming to drastically reduce CO2 emissions through new engine designs, advanced aerodynamics, ultralight structures, and hydrogen-powered aircraft. However, despite significant R&D funding, the transition from research to market-ready disruptive aircraft has been slow, with hydrogen planes and other innovative designs delayed into the 2040s or beyond. Looking ahead, the article argues that Europe must
energyaviation-technologyclean-energyhydrogen-aircraftemissions-reductionsustainable-aviationaerospace-materialsWhen Fossil Fuel Supplies Falter, Interest In Renewables Increases - CleanTechnica
The article from CleanTechnica highlights how disruptions in fossil fuel supplies drive increased interest and investment in renewable energy, using Cuba as a key example. Conventional reliance on fossil fuels, such as gasoline and oil, is increasingly seen as risky, especially when supply chains falter. Islands, which often depend heavily on imported fossil fuels, stand to benefit significantly from renewable sources like solar and wind, which are abundant and free locally. Cuba, historically dependent on Venezuelan oil, faced severe fuel shortages due to U.S. sanctions, prompting a rapid transition toward renewables with substantial support from China. In just one year, Cuba has more than tripled its solar electricity generation from under 6% to over 20% of its total electricity supply, connecting 49 new solar installations totaling over 1,000 megawatts. This rapid expansion is one of the fastest renewable energy transitions in a developing country, enabled by Chinese financing, equipment, and technical assistance. Cuba set a new solar generation record in February
energyrenewable-energysolar-powerwind-energyelectricity-generationfossil-fuel-alternativesenergy-transitionCUPRA Tavascan EV Exempted from EU Tariffs on Chinese EVs - CleanTechnica
The European Union has granted an exemption from its tariffs on Chinese electric vehicles (EVs) for the CUPRA Tavascan, a model produced in China but branded by the European Volkswagen Group. This exemption is notable because the EU generally imposes tariffs on Chinese EV imports to protect its domestic automotive industry. Volkswagen Group successfully argued that the Tavascan’s pricing strategy would not harm European manufacturers, leading to the exemption under strict conditions. These include a minimum pricing threshold (undisclosed), a cap on the number of units sold within the EU, and a restriction preventing Volkswagen Anhui from exporting other EV or plug-in hybrid models from China to the EU under the same exemption. The CUPRA Tavascan is positioned as a niche, low-volume model rather than a mass-market vehicle, with global sales totaling 1,685 units since launch and 1,407 sold in 2025 alone. The exemption helps avoid tariff-related price increases that could have negatively impacted sales and jobs within the brand
energyelectric-vehiclesEU-tariffsCUPRA-TavascanVolkswagenautomotive-industryclean-technologyUS Fast Charging Needs to Focus on Moving Faster - CleanTechnica
The article discusses the slow progress of the US National Electric Vehicle Infrastructure Formula Program (NEVI), which was approved in late 2021 with the goal of deploying 500,000 fast chargers by 2030. As of late 2023, only 121 stations across 16 states have been energized through NEVI, with the first charger going online that year. This pace is contrasted sharply with BYD, a Chinese company that installed over 4,500 advanced flash charging stations in just a few months, with plans to exceed 20,000 stations by year-end. BYD’s chargers offer significantly higher power (up to 1500 kW per charging gun), integrate buffer batteries and solar, and can be deployed in under a week compared to NEVI’s average 117 days per station. The article attributes NEVI’s slow rollout to numerous bureaucratic and political complications, including local supply chain development, domestic supplier restrictions, regulatory definitions, equity and union job requirements, and lengthy community
energyelectric-vehicle-chargingfast-charging-infrastructureNEVI-programDC-charging-stationsrenewable-energy-integrationbattery-storageWorld’s largest sailing cruise ship sets speed record in sea trials
The Orient Express Corinthian is set to become the world’s largest sailing cruise ship, measuring 721 feet long with a displacement of 25,200 gross tons. Designed for exclusivity, it will accommodate 110 passengers in 54 suites. A standout feature is its advanced Solid Sail system developed by Chantiers de l’Atlantique, which includes three masts carrying nearly 48,500 square feet of sail area. These sails can rotate 360 degrees, and the masts can tilt up to 70 degrees to optimize wind capture and allow passage under bridges. When wind conditions are insufficient, the ship can switch to an LNG-fueled engine. During recent sea trials, the vessel achieved a speed of approximately 14 mph under sail alone in 23 mph winds, a record for a sailing cruise ship of this size. The sail technology behind the Orient Express Corinthian has been in development since 2009, with extensive testing including a one-fifth-scale demonstrator from 201
energysailing-technologyLNG-enginerenewable-energymaritime-innovationadvanced-materialspropulsion-systemsGreen hydrogen production possible with semiconductor electrodes: Study
Finnish researchers from the University of Jyväskylä have demonstrated that semiconductor electrodes, specifically titanium dioxide (TiO2), can be used for green hydrogen production through (photo)electrochemical processes. Their study combined advanced atomic-level simulations with precise spectroelectrochemical experiments to uncover the fundamental mechanisms of the hydrogen evolution reaction on TiO2. Unlike traditional metal-based catalysts, semiconductor materials are composed of more abundant and less costly elements, but their electrochemical and catalytic behaviors have been poorly understood until now. The team developed a novel simulation approach called constant inner potential density functional theory, which incorporates electrode potential into modeling semiconductor electrochemistry. Their simulations revealed that applying a negative electrode potential induces the formation of local charge centers known as polarons on the TiO2 surface. These polarons facilitate hydrogen binding and activate the hydrogen evolution reaction. This polaron formation, experimentally confirmed through advanced techniques such as photoelectrochemical Raman spectroscopy and in situ electron resonance spectroscopy, is a previously unknown electro
energygreen-hydrogensemiconductor-electrodeshydrogen-evolution-reactionTiO2photoelectrochemistrymaterials-scienceWhy Is The Tesla Semi Still In Pilot Program Stage? - CleanTechnica
The Tesla Semi, an electric semi truck first revealed nearly a decade ago, remains in the pilot program stage rather than advancing to large-scale production and widespread deployment. Despite initial expectations for a swift market launch, Tesla has continued to test the vehicle through pilot programs, with companies like Mone Transport currently engaged in such trials. While the pilot results appear positive, the prolonged testing phase has raised questions about why Tesla has not yet moved to fulfill large orders and scale production. The article highlights the surprising length of time—almost ten years—that the Tesla Semi has spent in pilot programs, suggesting that the slow progress contrasts with the rapid development often associated with Tesla’s other products. The author expresses a sense of impatience and curiosity about when the Semi will transition from pilot testing to broader commercial availability. Overall, the piece underscores the gap between initial expectations for the Tesla Semi and the reality of its extended development timeline.
energyelectric-vehiclesTesla-Semipilot-programrenewable-energytransportationclean-technologyLucid Investor Day Report: "We Are Building for the Future" - CleanTechnica
During its March 12 Investor Day in New York, Lucid Group outlined a strategic shift from a niche luxury electric vehicle (EV) maker toward higher-volume premium market segments, aiming for accelerated positive free cash flow and sustainable profitability. Interim CEO Marc Winterhoff emphasized maintaining Lucid’s core product and technology DNA while increasing scale, capital efficiency, and cost discipline. Central to this strategy is the launch of a new midsize vehicle platform featuring the Atlas electric drive unit, designed to be smaller, lighter, and simpler to improve manufacturing efficiency and reduce costs without compromising performance or driving experience. The midsize platform underpins two upcoming SUVs, the Lucid Cosmos and Lucid Earth, targeted at a sub-$50,000 price point while preserving Lucid’s hallmark range and performance. Senior executives highlighted the platform’s design for scalability and cost leadership, with innovations such as identical front and rear drive unit components and tighter integration reducing battery size and parts count—key since batteries account for 30-40% of
energyelectric-vehiclesbattery-technologyautomotive-innovationcost-efficiencysustainable-mobilityelectric-drive-unitVingroup Shielding Filipino Motorists from Historic Fuel Price Hikes with Campaign - CleanTechnica
Vingroup has launched the "Trade Gas for Electric" campaign in the Philippines in response to the country's highest-ever fuel price hike, with gasoline and diesel prices rising by up to P24 (~$0.55) per liter due to global supply disruptions. Running from March 11 to March 31, 2026, the initiative aims to help Filipino families and businesses reduce their reliance on fossil fuels by encouraging a shift to electric vehicles (EVs). The campaign offers financial incentives including a 3% discount on VinFast electric cars (models VF 3, VF 5, VF 6, and VF 7) for customers trading in internal combustion engine vehicles, and a 5% discount on electric scooters for motorcycle riders. Additionally, a 10% fare reduction is available on the all-electric Green SM taxi and ride-hailing service through the end of March, providing a more affordable alternative amid rising fuel costs. VinFast’s battery subscription program further lowers the upfront cost of EV ownership
energyelectric-vehiclesVinFastfuel-priceelectric-mobilitybattery-subscriptiontransportation-incentivesThe MacBook Neo is ‘the most repairable MacBook’ in years, according to iFixit
Apple’s new MacBook Neo is being hailed by repair experts at iFixit as the most repairable MacBook in approximately fourteen years. A key improvement is the battery design: unlike previous models where batteries were glued in place, the Neo’s battery is mounted on a tray secured by 18 screws. This shift from adhesive to screws significantly simplifies battery replacement, a change that was enthusiastically received by iFixit. Additional factors enhancing repairability include a flat disassembly tree, compatibility with replacement parts through the Repair Assistant, and easier access to the display and keyboard for repairs. Despite these advancements, iFixit noted some limitations that prevent a perfect repairability score. The MacBook Neo still features soldered RAM and storage, which restricts upgrades and repairs in those areas. Consequently, iFixit assigned the Neo a repairability rating of 6 out of 10, which it considers a strong score for a MacBook. Overall, the MacBook Neo represents a notable step forward in Apple
energybattery-technologyrepairabilityMacBook-Neohardware-designconsumer-electronicssustainabilityDominion Energy Falls Into The "Dispatchable" Trap Over Data Center Power - CleanTechnica
Dominion Energy plans to build a 944-megawatt methane-fired power plant in Chesterfield, Virginia, on the site of a former coal facility, to meet the growing electricity demand driven largely by the state's booming data center industry. While methane combustion is cleaner than coal, environmental groups strongly oppose the project, citing concerns about increased air pollution and violations of Virginia’s 2020 Clean Economy Act and Environmental Justice Act. These laws aim to increase renewable energy use and reduce pollution, especially in communities of color, and to phase out fossil fuel plants by 2045 unless reliability is at risk. The controversy centers on the classification of renewables like wind and solar as non-dispatchable, meaning they cannot guarantee continuous power supply due to their intermittent nature. Dominion argues that additional dispatchable generation, such as methane plants, is necessary to maintain grid reliability. However, critics contend that relying on fossil fuel plants undermines the state’s clean energy goals and that cleaner alternatives exist. The debate highlights ongoing
energypower-generationmethanerenewable-energyenvironmental-impactVirginia-energy-policydata-centers-energy-consumptionHonda is killing its EVs — and any chance of competing in the future
The article discusses Honda's recent decision to halt development of its electric vehicle (EV) programs, including the electric Acura RDX and Honda 0 sedan and SUV, marking a significant retreat from the EV market. This move is attributed to challenges such as U.S. tariffs and competition from Chinese automakers, but the article argues that Honda never had a strong or viable EV strategy to begin with. By shelving these projects, Honda risks falling behind in two major industry shifts: the transition to electric drivetrains and the rise of software-defined vehicles (SDVs). The company’s approach, treating EVs merely as cars with different drivetrains rather than rethinking vehicle design from the ground up, is criticized as shortsighted and likely to result in heavier, less efficient, and more costly products. Moreover, Honda’s withdrawal from EV development means it will miss critical opportunities to learn from manufacturing, supply chain innovations, and customer feedback that are essential for success in the evolving automotive landscape. The article also highlights
energyelectric-vehiclesautomotive-industryelectric-drivetrainssoftware-defined-vehiclesbattery-technologyEV-strategyThe Epstein War Breathes New Life Into Green Hydrogen Industry
The article discusses how geopolitical tensions, specifically US President Donald Trump’s war on Iran, have inadvertently revitalized interest and investment in the green hydrogen industry, particularly in Europe. The conflict has caused fossil fuel prices, especially natural gas, to surge dramatically—gasoline prices in the US rose above $3.60 per gallon by mid-March, and European natural gas prices spiked by 75%. This price volatility has exposed the vulnerabilities of relying heavily on fossil fuels and hydrogen derived from natural gas or coal, highlighting the need for alternative, sustainable hydrogen sources such as green hydrogen produced via water electrolysis powered by renewable energy. Despite earlier setbacks in establishing a robust green hydrogen infrastructure across Europe—due to unfavorable market conditions and unclear policies—the recent energy crisis has shifted market dynamics, potentially accelerating green hydrogen development. For example, in Spain’s Andalusia region, $6.7 billion in green hydrogen investments face risks from policy delays, yet projects like a 50-megawatt off-grid green hydrogen
energygreen-hydrogenrenewable-energynatural-gashydrogen-productionclean-energyenergy-policyHighest power conversion rate for copper gallium solar cell achieved
Researchers at Japan’s National Institute of Advanced Industrial Science & Technology (AIST) have achieved a new power conversion efficiency record of 12.28% for copper gallium selenide (CuGaSe₂) solar cells. CuGaSe₂ is an indium-free, wide-bandgap chalcopyrite semiconductor with a direct bandgap of about 1.68 eV, making it highly effective at absorbing visible sunlight. This efficiency surpasses previous records for wide-bandgap chalcogenide solar cells in the 1.65–1.75 eV range, particularly for indium-free chalcopyrite or CIGS-related devices, as independently verified by AIST’s Photovoltaic Calibration, Standards and Measurement Team. The improved performance stems from a refined three-stage fabrication process where aluminum and rubidium fluoride are introduced to enhance the open-circuit voltage and reduce charge carrier recombination. The device structure includes a soda-lime glass substrate with a molybdenum back contact,
energysolar-cellscopper-gallium-selenidephotovoltaic-efficiencywide-bandgap-materialsrenewable-energysemiconductor-materialsUK EV Sales Were Higher Than Mandated In 2024 - CleanTechnica
In 2024, the UK’s zero-emission vehicle (ZEV) mandate required that 22% of new vehicle sales be electric vehicles (EVs). According to data from the UK’s Department for Transport, the auto industry exceeded this target when accounting for CO2 credits under the Vehicle Emissions Trading Scheme (VETS). Without credits, 19.8% of new vehicle sales were ZEVs, but including VETS credits raised this to 24.1%, surpassing the mandate. This overachievement allowed manufacturers to bank credits for future years and trade them under the Car Registration Trading Scheme (CRTS), with some even “forward-borrowing” EV registrations to avoid fines. While this demonstrates progress in electrification, it also means automakers can slow their transition by relying on credits rather than increasing actual EV sales. In the light commercial vehicle (LCV) market, a similar pattern emerged: only 6.8% of new LCVs were electric, but
energyelectric-vehicleszero-emission-vehiclesUK-EV-marketvehicle-emissions-tradingclean-transportationautomotive-industry-regulationsChina's new 385-mile range BYD EV charges 10% to 70% in 5 minutes
Chinese electric vehicle manufacturer BYD has introduced the Fang Cheng Bao Ti3 Flash Charging Edition, featuring advanced flash-charging technology and the latest Blade Battery 2.0 system. This new model can charge its battery from 10% to 70% in approximately five minutes and reach 97% in about nine minutes under normal temperatures, with only a slight increase in charging time in extreme cold (down to −22°F). The Ti3 is available in two variants: a rear-wheel-drive version with an estimated range of 385 miles and a four-wheel-drive version offering around 351 miles. Built on the EVO+ platform, the SUV incorporates a sophisticated suspension system and a 5.3 cubic foot electric front trunk. The Ti3 also integrates advanced technology, including an AI-powered intelligent cockpit with voice interaction, smart navigation, and personalized controls. It features BYD’s God’s Eye driver-assistance platform, which uses sensors and algorithms to enhance adaptive driving assistance and situational awareness. The four
energyelectric-vehiclesbattery-technologyfast-chargingAI-cockpitintelligent-driving-systemsvehicle-to-loadStellantis Rumored to Talk with Xiaomi & XPeng Regarding Partnership - CleanTechnica
Stellantis is reportedly in active discussions with Chinese electric vehicle manufacturers XPeng and Xiaomi to explore potential partnerships aimed at accelerating its transition to smart, electric vehicles. These talks reportedly involve technology sharing, platform integration, and possible investments, particularly focused on Stellantis’ European operations and brands such as Maserati. The collaboration could include the use of Chinese-developed EV platforms, batteries, and powertrains for Stellantis brands like Fiat, Opel, and Peugeot. This move reflects Stellantis’ efforts to address challenges in financial management and keep pace with the evolving automotive industry by leveraging Chinese EV technology and investment. The potential partnerships signal a strategic shift for Stellantis as it seeks to strengthen its position in the competitive electric vehicle market, particularly in Europe where some of its business units are struggling.
energyelectric-vehiclesbatteriespowertrainsautomotive-technologyrenewable-energyEV-platformsBig Changes For Compact BYD SUVs & Crossovers - CleanTechnica
The article discusses significant updates to BYD's compact SUVs and crossovers, highlighting the launch of the Fang Cheng Bao Ti3 (Titanium 3) for presale in China. The new Ti3 offers improved range with the rear-wheel-drive (RWD) version providing 620 km and the all-wheel-drive (AWD) version 565 km, priced at 153,800 RMB ($22,390) and 169,800 RMB ($24,719) respectively. These prices represent a slight increase from previous models, aiming to position the Ti3 as a more premium offering within BYD’s portfolio, reduce internal competition, and clear out older inventory. The model launch features simplified trim levels to streamline production, with potential future expansions in trim options. Additionally, BYD is introducing a new 2026 Yuan Plus model, which is larger and more refined than its predecessor, with a length of 4665 mm and a 2770 mm wheelbase, making it slightly longer than
energyelectric-vehiclesbattery-technologyBYDBlade-Batteryelectric-SUVsautomotive-energy-storageEV Laggard Honda Latest to Bail on EV Plans - CleanTechnica
The article reports that Honda, historically slow to embrace electric vehicles (EVs), is now canceling three planned EV models for the North American market and writing off up to ¥2.5 trillion ($15.7 billion) in EV investments. This retreat is attributed to a combination of factors including slowing demand for new-energy vehicles, increased costs, and the impact of U.S. tariffs initiated during the Trump administration. Honda forecasts significant losses for the fiscal year ending March, ranging from ¥270 billion to ¥570 billion ($1.69 billion to $3.57 billion). The company’s lagging EV strategy has also hurt its competitiveness in China, a rapidly electrifying market where domestic brands dominate. The article criticizes Honda for its continued reliance on gasoline vehicles and its reluctance to aggressively pursue EV development, contrasting this with competitors like BYD, Leapmotor, and Geely, which are better positioned for global growth in EV sales. Despite some hope that Honda might lead the EV transition as it
energyelectric-vehiclesHondaEV-marketautomotive-industryclean-energyelectric-mobilityLook At What They Make You Give: The Extreme Risks We Endure For A Fossil Fuel Economy - CleanTechnica
The article from CleanTechnica highlights the extreme geopolitical and logistical risks inherent in maintaining a global fossil fuel economy, particularly focusing on the escalating conflict in the Middle East. While media attention centers on dramatic military actions such as missile strikes and political disputes, the deeper crisis lies in the fragility of the fossil fuel supply chain. The U.S. and Israel are rapidly depleting their missile defense interceptors (THAAD) against Iranian ballistic attacks, with estimates suggesting their stockpiles could run out within days. Meanwhile, Iran’s extensive underground missile facilities in the Zagros Mountains are impervious to current U.S. bunker-busting capabilities, making military solutions ineffective and unsustainable. Compounding the military dilemma is the strategic closure of the Strait of Hormuz to commercial shipping, a critical chokepoint for global oil and LNG transport. Tanker crews are increasingly unwilling to risk navigating this dangerous passage, threatening a systemic shock to the global energy supply chain. The article argues that this precarious situation underscores
energyfossil-fuelsglobal-supply-chaindefense-technologyballistic-missilesTHAAD-systemgeopolitical-riskThe Offshore Floating Wind Industry Floats Away From The US
The article discusses the contrasting development of offshore wind energy along the US Atlantic and Pacific coasts, highlighting the challenges and technological innovations in floating offshore wind. While Atlantic coast states such as Rhode Island, Massachusetts, New York, and Virginia have advanced with traditional fixed-bottom offshore wind turbines due to their shallow waters, Pacific coast states like California, Oregon, and Washington face difficulties because their deeper waters make monopile foundations impractical. The solution for the Pacific involves newer floating wind turbine technology, which anchors turbines on floating platforms tethered to the seabed, but this technology is still emerging and presents engineering challenges. The article also addresses political and economic factors affecting the US offshore wind industry. It notes that former President Donald Trump’s administration hindered progress, particularly for floating wind projects on the Pacific coast, causing US innovators to relocate their technology abroad. A key example is the Spanish startup X1 Wind, co-founded by MIT alumnus Carlos Casanovas, which developed a cost-effective floating platform called PivotBuoy
energyoffshore-windfloating-wind-turbinesrenewable-energyclean-technologywind-powersustainable-energyHundreds of Thousands of Lightly Used Electric Cars About to Hit US Market - CleanTechnica
The article discusses the impending influx of lightly used electric vehicles (EVs) into the U.S. used car market, driven largely by the Inflation Reduction Act of 2022. This legislation, which extended and enhanced federal EV tax credits, included a leasing loophole that enabled nearly all EV models to qualify for incentives. As a result, EV leasing surged, and now, about three years later, a significant number of these leased vehicles are coming off lease and entering the used car market. It is estimated that over 300,000 EVs will be returned from leases in 2026 alone, creating a substantial supply of affordable, lightly used electric cars. This surge in used EV availability is expected to impact pricing and dealer dynamics. Historically, EVs have depreciated quickly, partly because new EV buyers could immediately access federal discounts, which are now less available. However, the increased supply of used EVs should drive prices down, making them more competitive and accessible to a broader range of consumers.
energyelectric-vehiclesEV-marketused-electric-carsEV-leasingInflation-Reduction-Actclean-transportationOxygen-trapping coating pushes EV battery life past 1,000 cycles
Researchers at the University of Arkansas have developed an ultrathin zirconium sulfide (ZrS2) nanoscale coating to significantly extend the lifespan of lithium-ion batteries using the popular NMC811 cathode material (lithium nickel manganese cobalt oxide). NMC811 is valued for its high energy density and cost-effectiveness in electric vehicle (EV) batteries but suffers from oxygen release during repeated charge-discharge cycles. This released oxygen reacts with the electrolyte, producing gases and byproducts that degrade battery performance and pose safety risks. The new 2-nanometer-thick zirconium sulfide coating chemically traps the oxygen by converting into zirconium sulfate, preventing harmful reactions and stabilizing the cathode-electrolyte interface. This protective layer also reduces microcracking and structural damage inside the cathode. Testing showed a dramatic improvement in battery cycle life: while uncoated NMC811 cathodes typically fail after about 200 cycles, the coated cathodes maintained operation beyond 1,
energylithium-ion-batterieselectric-vehiclesbattery-technologynanoscale-coatingzirconium-sulfidebattery-life-extensionWar, Oil & Cleantech: Thoughts on the Ramifications of the USA’s Latest Imperial Adventure - CleanTechnica
The article from CleanTechnica analyzes the recent U.S. military interventions in Venezuela and Iran under President Donald Trump, focusing on their implications for global oil markets and geopolitical dynamics. The Venezuelan operation, which led to the capture of Nicolás Maduro and the installation of Delcy Rodríguez, is portrayed as a swift and largely successful move for the U.S. Despite initial skepticism, the transition avoided civil conflict, maintained regime continuity, and opened the door for economic liberalization and foreign investment, particularly by U.S. oil companies. Venezuela’s oil production has begun to increase modestly, benefiting U.S. refineries, though significant expansion remains contingent on high oil prices. In contrast, the U.S.-Israel bombing campaign against Iran is described as a less successful and more uncertain endeavor, with potential to escalate into a prolonged conflict. Iran’s strategic position as a major oil producer and its control over the Strait of Hormuz—through which a significant portion of the world’s oil and LNG passes—adds complexity and
energyoilcleantechglobal-energy-marketsoil-reservesenergy-geopoliticsoil-productionDecades-long grid storage unlocked with new hydrogen-iron flow battery
Dutch company Elestor has developed a novel hydrogen-iron flow battery designed for long-duration grid energy storage, demonstrating stable performance over tens of thousands of charge-discharge cycles and a potential operational lifespan of 20-25 years. Unlike conventional batteries, this flow battery separates power output and energy storage, using a hydrogen gas circuit at the anode and an aqueous iron-based electrolyte at the cathode. The system relies on abundant, low-cost materials, avoiding supply-chain issues common with lithium, cobalt, or vanadium batteries. Testing under continuous, industrially relevant conditions showed the battery maintained over 80% energy efficiency and more than 75% round-trip efficiency without structural degradation, with periodic operational conditioning restoring optimal performance. Elestor’s prototype incorporated a hydrogen-fed anode, proton-conducting membrane, and carbon-based cathode, circulating an acidic iron salt electrolyte at elevated temperatures and constant current densities. The reversible electrochemical reaction between ferric and ferrous iron ions enables energy storage and release, with
energyhydrogen-iron-flow-batterygrid-storagelong-duration-energy-storageelectrochemical-batteryrenewable-energy-storagebattery-technologyHawaiʻi’s LNG Business Case Was Overly Optimistic & Built On A Broken Spreadsheet - CleanTechnica
The article from CleanTechnica reveals critical flaws in Hawaiʻi’s economic case for importing liquefied natural gas (LNG) as a transitional fuel. A key finding, highlighted by former University of Hawaiʻi professor Matthias Fripp and the Sierra Club of Hawaiʻi, is that the state’s Energy Office Scenario 3A spreadsheet—which projected $700 million to $800 million in net savings from LNG—omitted nearly $900 million in LNG fuel costs. Fripp’s stress test, multiplying LNG prices by 100 without affecting the savings graph, indicated a fundamental error or broken formula rather than a modeling disagreement. This calls into question the validity of the widely publicized economic justification for LNG on Oʻahu. The LNG plan was part of Hawaiʻi’s broader January 2025 Alternative Fuels, Repowering, and Energy Transition Study, which aimed to address the state’s high electricity prices, dependence on imported oil, and post-Maui wildfire grid reliability concerns. The proposal involved building an offshore
energyLNGrenewable-energyHawaii-energy-policyenergy-transitionclean-energypower-generationThin Film Solar Gets A Muscular Perovskite Makeover
The article discusses the emerging role of perovskite, a next-generation solar material, in enhancing thin film solar technology, particularly through the efforts of the US-based manufacturer First Solar. Thin film solar cells, unlike traditional rigid silicon cells, are lightweight, flexible, and can be produced via sprayable solutions, offering advantages in durability, longevity, and lower manufacturing costs. Although thin film solar typically has lower conversion efficiency compared to silicon, it has established a significant presence in the US utility-scale solar market. This success is partly due to federal energy policies aimed at reducing dependence on overseas silicon suppliers by supporting domestic innovation in cadmium-telluride (CdTe) thin film technology, with First Solar playing a key role in this development through a longstanding partnership with the US Department of Energy. First Solar, founded in the 1990s from research at the University of Toledo, has advanced CdTe thin film solar cells to new efficiency records, with a goal of reaching 30% conversion efficiency by
energysolar-energythin-film-solarperovskiterenewable-energyFirst-Solarsolar-technologyIs The Big Oil Cartel Losing Its Influence? - CleanTechnica
The article from CleanTechnica examines the current challenges facing the historically powerful "Big Oil" cartel amid ongoing geopolitical turmoil, particularly the US/Israeli conflict with Iran and the resulting military blockade of the Strait of Hormuz. This strategic chokepoint typically sees 20 million barrels of oil pass daily, but disruptions have caused the International Energy Agency (IEA) to label the situation the largest supply disruption in global oil market history. Despite oil futures hovering around $100 per barrel and fears of prices potentially doubling, fossil fuel executives reportedly remain confident, as supply interruptions increase reliance on domestic oil reserves, potentially boosting their profits. Tracing the origins of the Big Oil cartel, the article highlights how early 20th-century US oil companies formed cartel-like agreements to stabilize prices and control production amid fears of oversupply. These arrangements, supported by the US government for strategic and military interests, helped cement American dominance in Middle Eastern oil markets. By 1930, major US oil firms such as Exxon, Mobil
energyoil-marketBig-OilOPECenergy-pricesoil-supplyfossil-fuelsZero-Emission Trucks in Europe — The Road So Far - CleanTechnica
The article from CleanTechnica highlights the significant rise in electric truck sales in Europe following the implementation of the continent's first truck CO2 emissions target in July 2025. Since the target took effect, 5.6% of new trucks sold in Europe have been electric, up from 3.5% in the previous year, with one-quarter of all European e-trucks registered since 2022 sold after the target's introduction. Despite this progress, Europe still trails China, which leads globally with a 15% electric truck market share compared to Europe's 5% in 2025. Several European countries, including the Netherlands, Norway, Sweden, and Denmark, are front-runners with electric truck shares between 16% and 18%, while Germany leads among large truck markets. The article emphasizes the importance of national policies complementing European measures—such as CO2-based tolling, CO2 pricing, and renewable electricity credits—to improve the economics of electric trucks and support large-scale
energyelectric-truckszero-emission-vehiclesCO2-targetsEuropean-marketrenewable-electricitytruck-electrificationHow China Is Avoiding The Straits Of Hormuz Curse - CleanTechnica
The article "How China Is Avoiding The Straits Of Hormuz Curse" from CleanTechnica examines how China is mitigating risks associated with the strategic and often volatile Straits of Hormuz, a critical chokepoint for global oil and LNG shipments. Unlike many countries heavily reliant on this narrow shipping lane—through which about 20% of global oil and gas transit—China has proactively reduced its dependence on fossil fuels over the past two decades. This strategic shift is part of a long-term national electrification plan embedded in successive five-year plans, emphasizing clean energy targets such as offshore wind capacity and carbon intensity reduction. As a result, oil and gas now constitute only a small fraction of China’s energy consumption, with oil and gas shipments through Hormuz accounting for roughly 6% of China’s total energy use, a figure that continues to decline. The article contrasts China’s forward-looking energy strategy with the United States’ reactive and short-term approach, highlighting the US’s recent release of nearly half
energyoilLNGenergy-storageelectrificationChina-energy-policyfossil-fuel-reductionUS university installs Alpha-E tabletop nuclear fusion device in a first
Purdue University’s School of Health Sciences has installed the first Alpha-E tabletop nuclear fusion device in the United States, marking the first time a domestic academic institution offers students direct, hands-on access to fusion experimentation on campus. Manufactured by Alpha Ring, the device is now part of Purdue’s radiation instrumentation laboratory and will be used collaboratively by the School of Health Sciences and the School of Nuclear Engineering to advance research in plasma physics and nuclear energy. This initiative aligns with the U.S. Roadmap for fusion strategy by shifting fusion training from large national labs into university settings, thereby increasing student exposure to practical fusion experience. The Alpha-E device is designed as a safe, affordable platform for conducting plasma physics experiments and fusion diagnostics, enabling frequent use by students and faculty. It generates data useful for broader research and AI modeling, and at Purdue, it will support specialized training in radiation hardening of electronics—critical for ensuring electronic components function in high-radiation environments such as space or nuclear reactors. The installation follows a
energynuclear-fusionplasma-physicsclean-energyfusion-researchradiation-hardeningfusion-educationDraper liquid rocket engine achieves supersonic speeds in flight test
The Air Force Research Laboratory (AFRL) and Ursa Major have successfully completed the first flight test of the Affordable Rapid Missile Demonstrator (ARMD), powered by the Draper liquid rocket engine, achieving supersonic speeds. This milestone marks a significant advancement toward cost-effective, mass-producible missile technology designed to enhance national deterrence and enable immediate, long-range strike capabilities. Unlike traditional solid rocket motors, the Draper engine is throttleable and restartable, allowing for complex maneuvers and speed adjustments, which represents a leap forward in missile propulsion technology. The engine’s design leverages a manufacturing model based on the Hadley engine architecture, emphasizing affordability, scalability, and long-term storability without relying on expensive materials. The ARMD program exemplifies a successful public-private partnership that rapidly transitioned from contract to flight-ready status in just eight months, a notably accelerated timeline in defense development. AFRL and Ursa Major plan to continue flight tests to fully characterize the Draper engine’s performance
energyrocket-engineliquid-propulsionaerospace-technologydefense-technologysupersonic-flightmissile-technology48 New Tesla EV Chargers Planned For Detroit Area - CleanTechnica
Tesla plans to install a new Supercharger hub with up to 48 charging stalls in Romulus, Michigan, adding to recent installations of about 40 fast chargers in the Detroit metro area. This expansion would bring the total number of new fast chargers in the region to approximately 88, addressing range anxiety by increasing the availability of quick charging options where they are currently limited. Tesla has also completed a large solar-powered charging hub with around 164 stalls and announced further charger installations elsewhere, demonstrating ongoing commitment to expanding EV infrastructure despite controversies surrounding Elon Musk. Detroit currently has over 2,300 public EV chargers, including about 440 fast chargers, serving a metropolitan population of roughly 3.5 million. The city supports EV infrastructure growth through initiatives like "Detroit Charge Ahead," which aims to create a network of fast chargers spaced every 3–5 miles to enhance accessibility and convenience. This program aligns with Detroit’s goal to lead the automotive industry's transition to electrification by ensuring widespread public charging availability. Although
energyelectric-vehiclesEV-charging-infrastructureTesla-Superchargersrenewable-energysolar-powerclean-transportationUS quietly resumes railgun tests, reviving hypersonic weapon ambitions
The United States Navy has quietly resumed live-fire testing of a prototype electromagnetic railgun at White Sands Missile Range, signaling renewed interest in this hypersonic weapon technology after earlier development setbacks. Railguns use powerful electric currents to launch projectiles at speeds of Mach 6–7 or higher without gunpowder, offering potential advantages such as long-range engagement, rapid fire, and lower operating costs compared to traditional missile systems. The recent tests, conducted in February 2025 over three days, supported the Joint Hypersonics Transition Office’s efforts to advance electromagnetic launch technology, though the exact objectives of the trials remain unclear. The railgun program had been paused in 2021 with hardware placed in storage, but new developments, including General Atomics’ 2025 proposal to integrate railguns into the Pentagon’s missile defense plans, suggest a strategic revival. Despite its promise, railgun technology faces significant challenges, including high electrical power demands, complex cooling requirements, and rapid barrel wear from firing hyperson
energyelectromagnetic-railgunhypersonic-weaponsnaval-technologydefense-technologyhigh-velocity-projectilesmilitary-innovationResidents challenge drilling of US firm’s underground Gravity reactor
Residents of Parsons, Kansas, and local advocacy groups have raised significant concerns over Deep Fission’s underground “Gravity” nuclear reactor project, which recently began drilling site characterization. At a contentious community meeting, opponents, including the Prairie Dog Alliance, criticized changes in federal policy that they believe have weakened safety standards and reduced Nuclear Regulatory Commission (NRC) oversight. Many residents expressed apprehension about the project’s rapid timeline and potential long-term risks, urging a more cautious approach. Deep Fission representatives defended the reactor’s design, emphasizing its placement 6,000 feet underground to prevent traditional meltdown scenarios by balancing internal vessel pressure with external water pressure. They also described an innovative maintenance method involving pulling the reactor unit up via structural pipes for replacement without bringing it fully to the surface. The company clarified that the previously suggested pilot completion date of July 4, 2026, is outdated; instead, they anticipate grid connection and full project realization between 2027 and 2028 after a multi-year validation process
energynuclear-reactorunderground-reactorDeep-Fissionenergy-innovationnuclear-energyreactor-safetyGerman firm's new EV charges 10-80% in 16 minutes, offers 400 kW power
Porsche has introduced the Cayenne S Electric, a new electric SUV positioned between the base electric Cayenne and the turbo variant, aiming to balance efficiency with sporty performance. It features a dual-motor all-wheel-drive system delivering strong acceleration and power, supported by a high-capacity lithium-ion battery built on an advanced 800-volt architecture. This setup enables rapid charging, allowing the battery to recharge from 10% to 80% in just 16 minutes at compatible high-power stations, and provides a substantial driving range suitable for both daily use and long trips. The vehicle incorporates advanced technologies such as a direct oil-cooling system for the rear motor to maintain performance and durability, and silicon-carbide semiconductor technology in the inverter to enhance energy efficiency and handle high electrical loads. Design-wise, the Cayenne S Electric features unique exterior accents and aerodynamic wheels, along with a premium, customizable interior. It also includes sophisticated driving and chassis systems like torque vectoring, advanced suspension, and high-performance brakes
energyelectric-vehicleslithium-ion-batteryrapid-chargingsilicon-carbide-semiconductorelectric-drivetrainautomotive-technologyBefore quantum computing arrives, this startup wants enterprises already running on it
Finnish entrepreneur Peter Sarlin, after selling his startup to AMD and leading AMD Silo AI, is now chairman of two new ventures, including QuTwo, a startup focused on bridging classical AI and future quantum computing. QuTwo is developing QuTwo OS, an orchestration platform designed to enable enterprises to transition smoothly from classical to quantum computing by leveraging hybrid and “quantum-inspired” computing—classical hardware simulating quantum behavior to overcome current quantum hardware limitations. The company aims to allow businesses to focus on their core problems while QuTwo OS manages the routing between classical and quantum resources, supporting both quantum and non-quantum algorithms flexibly. QuTwo’s leadership team combines expertise from quantum and AI fields, including cofounders from IQM and Finnish semiconductor startup SemiQon, as well as former Nokia CEO Pekka Lundmark on its board. The startup has already secured significant design partnerships worth tens of millions of dollars, collaborating closely with enterprises like Zalando and Finnish financial services provider OP
energyquantum-computingAIhybrid-computingsemiconductorquantum-chipsenterprise-technologyRivian Introduces R2 Lineup, Sharing Full Trims & Pricing - CleanTechnica
Rivian has announced the full trims and pricing for its new R2 lineup, a mid-size electric SUV designed to bring Rivian’s signature design, performance, and technology to a broader market at a more accessible price point. Deliveries will begin in Spring 2026 with the R2 Performance Launch Package starting at $57,990, followed by Premium trims in late 2026 and Standard trims in 2027. Built on a new mid-size platform, the R2 offers up to 656 horsepower, 0-60 mph acceleration in as quick as 3.6 seconds, and an estimated range of up to 345 miles, maintaining Rivian’s focus on capability and adventure readiness. The R2 lineup includes multiple trims to suit different driving needs. The Performance trim, debuting with a limited Launch Package, features dual-motor AWD, semi-active suspension, premium interior with Birch wood accents, heated and ventilated seats, advanced lighting, and a 4,400-l
energyelectric-vehiclesRivianautomotive-technologyEV-chargingelectric-SUVsustainable-transportationWhy Are EV Prices Only Coming Down Now? The Answer Is More Political Than You Think - CleanTechnica
The article from CleanTechnica explains why electric vehicle (EV) prices have only recently started to decline, despite significant reductions in battery costs over the past several years. Between 2020 and 2024, average battery electric vehicle (BEV) prices actually rose by about 13%, driven largely by automakers’ strategic focus on larger, premium EV models that yield higher profits. This shift was facilitated by the absence of stringent EU CO₂ targets during that period, allowing manufacturers to prioritize margin maximization over affordability and volume growth. Consequently, although battery costs dropped, BEV prices increased as the market skewed toward more expensive vehicles. The turning point came in 2025 with the enforcement of new, binding EU car CO₂ targets. These regulations compelled automakers to pivot their strategies toward increasing BEV volumes and accelerating the release of more affordable electric models, resulting in an average price drop of about 4% (€1,800). Despite a continued trend toward larger vehicles, the regulatory pressure
energyelectric-vehiclesbattery-technologyEU-CO2-targetsautomotive-industryclean-energysustainable-transportationConflict in Middle East Could Cost Europe’s Drivers an Extra €150 Million a Day - CleanTechnica
The article from CleanTechnica highlights the significant economic impact of Europe’s dependence on imported fossil fuels amid geopolitical conflicts in the Middle East. In 2022, when oil prices last averaged $100 per barrel, European drivers paid an estimated €55 billion in a “geopolitical premium” at the pump, reflecting the additional costs caused by global volatility. Research by Transport & Environment (T&E) warns that as oil prices again surpass $100 per barrel, Europeans could face an extra €150 million daily in fuel costs. This premium stems from Europe’s reliance on imported oil, which exposes its economy and households to price shocks driven by geopolitical tensions. T&E emphasizes that short-term government subsidies, which cost taxpayers billions, have only temporarily alleviated fuel prices without addressing the structural problem of oil dependency. The organization advocates for long-term solutions such as accelerating the adoption of electric vehicles (EVs), heat pumps, and renewable energy sources to reduce vulnerability to fossil fuel market fluctuations. Europe’s 7
energyfossil-fuelsoil-priceselectric-vehiclesrenewable-energyenergy-securityEurope-energy-crisisEurope's Oil Dependency: The Geopolitical Premium - CleanTechnica
The article from CleanTechnica highlights Europe's significant vulnerability to geopolitical tensions due to its heavy dependence on imported oil. In early 2026, coordinated strikes by the United States and Israel on Iran triggered retaliatory attacks by Iran, disrupting oil production and blocking the critical Strait of Hormuz, a major transit route for Middle Eastern fossil fuels to Europe and Asia. These events caused Brent crude oil prices to surge above $100 per barrel, exacerbating Europe's energy import costs, which already exceeded €1 billion per day in 2023. The article emphasizes the financial impact of Europe's oil dependency, noting that in 2022, when oil prices last surpassed $100 per barrel, the EU's energy import bill reached €604 billion. This dependence results in consumers paying a substantial "geopolitical premium," with drivers alone spending an additional €55 billion at fuel pumps. Meanwhile, fossil fuel companies such as Chevron, ExxonMobil, BP, Shell, and TotalEnergies have seen soaring profits during these periods of
energyoil-dependencyfossil-fuelsgeopolitical-riskenergy-importsoil-pricesEurope-energy-crisisNew Nissan LEAF Wins Another Award - CleanTechnica
The 2026 Nissan LEAF has received another accolade, being named one of Autotrader’s Best New Cars of 2026. Autotrader’s editorial team evaluated hundreds of new and redesigned vehicles, selecting the LEAF for its groundbreaking features, strong consumer appeal, and value in the competitive electric vehicle market. The all-new LEAF offers an EPA-estimated driving range of up to 303 miles per charge and includes a built-in NACS port with Plug & Charge capability, granting access to over 27,500 Tesla Superchargers, enhancing convenience for public charging. Now in its third generation, the redesigned Nissan LEAF combines reliable, affordable electric mobility with modern design elements favored by consumers, such as a crossover body style. Key features highlighted by Nissan include a segment-first dimming panoramic roof, standard Intelligent Around View® Monitor, 64-color ambient interior lighting, flush door handles, 3D holographic tail lamps, and available dual 14.3-inch Google-integr
energyelectric-vehiclesNissan-LEAFelectric-mobilityEV-chargingclean-energyautomotive-technologyUS Perovskite Solar Cell Startup Hits The Ground Running - CleanTechnica
The US solar manufacturing sector, historically challenged by overseas competition, is experiencing a significant resurgence. Despite federal energy policy shifts under the Trump administration favoring fossil fuels, domestic solar manufacturing capacity has surged. As of October 2025, the US surpassed 60 gigawatts of solar module production capacity—a 37% increase from the previous year—and domestic solar cell production capacity more than tripled to 3.2 gigawatts. The Solar Energy Industries Association (SEIA) highlighted that the US now has the capability to produce every major component of the solar supply chain, aided by new facilities such as Corning’s ingot and wafer plant. Amid this growth, the emergence of tandem silicon-perovskite solar cells presents a promising advancement. Perovskite materials can enhance solar cell efficiency and reduce costs, enabling more power generation from less space and expanding rooftop solar opportunities. US startup Swift Solar recently acquired key intellectual property and manufacturing assets from the bankrupt German company Meyer Burger, positioning itself
energysolar-energyperovskite-solar-cellssolar-manufacturingclean-energyrenewable-energyUS-energy-policyLike dry spaghetti: Brittle lithium spikes found in batteries
Scientists have directly observed the growth and mechanical behavior of lithium dendrites—tiny, needle-like metal structures that form on the anode inside lithium-ion batteries. These dendrites can pierce the battery’s internal separator, causing dangerous short circuits and battery failure. Using specialized experimental platforms and high-resolution electron microscopy, researchers from the U.S. and Singapore captured how dendrites crystallize and deform under stress within sealed battery environments. Contrary to previous assumptions that lithium dendrites are soft and flexible, the study revealed they are actually brittle and strong, snapping like dry spaghetti due to a stiff coating called the solid electrolyte interphase (SEI). This brittleness allows dendrites to puncture battery components, increasing the risk of internal shorts, while broken fragments accumulate as “dead lithium,” reducing battery capacity over time. The findings highlight dendrites as a major obstacle to commercializing lithium-metal batteries, which offer higher energy density than current lithium-ion cells but are limited by dendrite formation. Understanding dendrite mechanics could inform
energylithium-ion-batteriesbattery-safetylithium-dendritesmaterials-sciencebattery-degradationsolid-electrolyte-interphasePakistan Avoids LNG Shocks Due to Iranian Bombing With Solar Panels - CleanTechnica
The article highlights how Pakistan has managed to avoid severe disruptions in its electricity supply amid regional LNG (liquefied natural gas) shocks caused by geopolitical tensions around Iran. While many countries dependent on LNG imports—such as Japan, South Korea, and Bangladesh—face rising prices and supply insecurity due to halted shipments through the Strait of Hormuz, Pakistan's situation is notably different. This resilience is attributed not to new gas discoveries or pipelines but to a rapid and large-scale expansion of solar power capacity. Over 2024 and 2025, Pakistan installed approximately 32 GW of solar capacity, mostly distributed across rooftops of factories, commercial buildings, and homes, which now generates energy equivalent to over one-third of the country's annual electricity demand. This solar surge has significantly altered Pakistan’s electricity demand profile, especially during daylight hours when solar output peaks. The widespread adoption of rooftop solar systems by businesses, driven by high grid electricity costs ($0.13–$0.16 per kWh) and
energysolar-energyLNGenergy-securityrenewable-energyPakistan-energysolar-panelsWhy Rivian is holding the $45,000 base model R2 until ‘late 2027’
Rivian recently disclosed details about its upcoming R2 SUV, including pricing and availability, revealing that the much-anticipated $45,000 base model will not be available until late 2027. Notably, the company shifted its language from promising the R2 would "start at $45,000" to "starting around $45,000," reflecting increased costs and market changes since the vehicle was first announced. Factors contributing to this delay and price adjustment include the expiration of the $7,500 federal EV tax credit, the end of revenue from regulatory credit sales, increased component costs due to tariffs, and declining sales of Rivian’s earlier R1 models. Rivian plans to launch the R2 initially with higher-priced, premium performance models in 2026 to showcase the platform’s capabilities, projecting sales of 20,000-25,000 units by year-end—an ambitious target second only to Tesla’s Model Y in speed of market penetration. The company will introduce a "
energyelectric-vehiclesRivianbattery-technologyautomotive-manufacturingEV-marketelectric-SUVsHow Spain's Magerit supercomputer is advancing aerospace, combustion, and climate research
Spain’s Magerit supercomputer, housed at the Supercomputing and Visualization Center in Madrid (CeSViMa) at Universidad Politécnica de Madrid (UPM), is a key asset in advancing research across aerospace, combustion, climate science, and other fields. As one of the most powerful supercomputers in Spain, Magerit performs trillions of calculations per second, enabling simulations and data analyses that would be infeasible on ordinary computers. Since its initial deployment in 2006 and subsequent upgrades culminating in Magerit-3 in 2019, the system has significantly enhanced Madrid’s status as a European hub for computer science and high-performance computing (HPC). Experts like Jack Dongarra emphasize that supercomputers like Magerit are not just tools but strategic infrastructure critical for tackling global challenges such as climate change, pandemics, and energy security. The integration of simulation, modeling, and AI on such platforms is unlocking breakthroughs in diverse areas including fusion energy, precision medicine
energymaterials-sciencesupercomputingclimate-researchhigh-performance-computingsimulationcomputational-modelingCriticality nears for US MARVEL nuclear reactor after safety approval
The US Department of Energy (DOE) has approved the Preliminary Documented Safety Analysis (PDSA) for the MARVEL microreactor, a critical safety blueprint that enables the project to proceed with its initial nuclear physics experiments at Idaho National Laboratory (INL). This approval marks a transition from design to demonstration, allowing MARVEL to conduct its first “dry criticality” test—a near zero-power experiment to validate reactor physics before full-power operation. The PDSA confirms that the reactor can operate safely in this configuration and sets the stage for final safety documentation and full assembly. MARVEL is a sodium-potassium-cooled microreactor designed to produce 85–100 kilowatts of thermal energy and about 20 kW of electricity. Despite its small size, its regulatory framework is expected to influence future advanced nuclear projects significantly. Notably, MARVEL employs an innovative Reactivity Control System that replaces traditional vertical control rods with rotating drums, enabling precise control of neutron reflection and absorption. This
energynuclear-reactormicroreactorenergy-innovationsafety-approvaladvanced-nuclearreactor-control-systemsCryogenic hydrogen fuel system for aircraft turbines tested at -423°F
Engineers at the German Aerospace Center (DLR) have conducted pioneering cryogenic tests on a novel liquid hydrogen (LH2) fuel delivery system designed for future aircraft turbines. These evaluations took place at DLR’s Future Propulsion Test Facility in Cologne, reaching temperatures as low as -423°F (-253°C), the point at which hydrogen liquefies. The primary focus was on safely transporting liquid hydrogen from onboard tanks to aircraft engines, a critical and technically challenging step for hydrogen-powered aviation. The tests achieved Technology Readiness Level 4 (TRL 4), validating key components and prototypes in a lab environment. The data collected will inform computer simulations to adapt the system for real-world aircraft operations. Liquid hydrogen is considered a promising aviation fuel due to its zero carbon dioxide emissions when burned. While DLR previously demonstrated safe combustion of 100% gaseous hydrogen in aircraft engines, the storage and delivery of hydrogen remain complex because it requires extremely low temperatures and stable conditions throughout the fuel system under varying flight
energyhydrogen-fuelcryogenic-technologyaviation-fuel-systemsliquid-hydrogenaircraft-turbinessustainable-energyPeak Energy Bringing Sodium-Ion Battery Storage To Wisconsin - CleanTechnica
Peak Energy, founded in 2023 by former Tesla, Enovix, and Apple entrepreneurs, is pioneering low-cost, large-scale sodium-ion battery storage technology aimed at dramatically reducing energy storage costs and establishing U.S. leadership in battery innovation. Sodium-ion batteries offer several advantages over traditional lithium-ion types, including better performance in cold temperatures, longer lifespan, lower flammability, and reduced cooling requirements. These features simplify battery pack design and cut costs, potentially halving the total price of battery systems and accelerating the adoption of battery-powered vehicles and grid storage. On March 12, 2026, Peak Energy announced a partnership with RWE Americas to pilot its passively cooled sodium-ion grid storage system in Eastern Wisconsin. This project positions RWE as a first mover in deploying next-generation, capital-efficient energy storage solutions. Peak’s proprietary GS-1.1 system leverages highly stable sodium-ion cells to eliminate costly maintenance and cooling infrastructure, reduce capacity overbuild, and maintain performance across a wide
energysodium-ion-batteriesenergy-storagebattery-technologygrid-storagerenewable-energyPeak-EnergyElectric Trucks Save More Bucks, Now That Oil Is Spiraling Up
The article highlights the growing financial and operational advantages of electric trucks, especially for short-haul fleets that can recharge overnight. Harbinger Motors, a new US startup founded in April 2025, is entering this market with a fully customizable, purpose-built electric chassis that integrates major vehicle systems like the powertrain, battery, steering, and brakes. This ground-up electrification approach offers benefits over retrofitting diesel or gasoline trucks, including streamlined maintenance, improved uptime, and increased payload capacity due to the space-efficient design of electric vehicle (EV) batteries. Harbinger recently launched its HC Series Cab electric truck, which features a Low Cab Forward (LCF) design that enhances driver visibility and maneuverability while reducing noise and vibration compared to conventional trucks. The HC Series is offered both as a 100% battery electric vehicle and as a range-extended hybrid, which includes an onboard gas tank to recharge batteries when charging stations are unavailable, extending the range up to 500 miles. However,
energyelectric-trucksbattery-electric-vehicleshybrid-vehiclesEV-powertrainsustainable-transportationvehicle-electrificationIn Battle Against Renewable Energy, Texas AG Is All Hat No Cattle
The article critiques Texas Attorney General Ken Paxton’s efforts to support coal power and oppose renewable energy investments amid his 2024 U.S. Senate campaign. Paxton led a lawsuit against major asset managers BlackRock, State Street, and Vanguard, accusing them of illegally pushing decarbonization agendas that allegedly raised energy costs for ratepayers. However, the lawsuit’s impact has been minimal, with Vanguard settling quietly while continuing business as usual. Meanwhile, former President Trump’s policies to extend coal plant operations and geopolitical events have bolstered fossil fuel markets, undermining Paxton’s claims of asset manager collusion against coal. Despite Paxton’s rhetoric, renewable energy investment in Texas is thriving. Florida-based Origis Energy secured $545 million to expand a large solar complex in West Texas, expected to exceed 700 MW upon completion. Additionally, Eagle Point Credit Management provided $28.5 million in financing to Heritage Energy Storage DevCo, which focuses on smaller-scale battery storage projects designed to bypass lengthy
energyrenewable-energysolar-powerenergy-storageTexas-energy-marketclean-energy-investmentfossil-fuels-debateTesla becomes a utility in the UK, setting up showdown with Octopus Energy
Tesla has become an officially licensed utility in the United Kingdom, marking a significant expansion of its energy business. While Tesla has been involved in electricity markets for years—initially through products like the Powerwall and Powerpack—it began scaling its energy division more aggressively after launching a utility in Texas in 2022 that allowed direct electricity sales to customers. Tesla Energy Ventures, the new UK utility arm, enables Powerwall owners to sell stored electricity back to the grid, participating in a virtual power plant model. This move positions Tesla to compete directly with established UK utilities such as EDF, E.ON, and notably Octopus Energy. Octopus, founded in 2015, has gained prominence by leveraging advanced software, renewable energy integration, and innovative marketing strategies—approaches that closely mirror Tesla’s own energy business philosophy. The entry of Tesla as a utility in the UK sets the stage for a competitive showdown, particularly with Octopus Energy, as both companies focus on clean energy solutions and customer-centric technology.
energyTesla-Energyrenewable-energyvirtual-power-plantPowerwallenergy-utilityelectricity-marketWorld's most advanced supercomputers decode nuclear reactor turbulence
Researchers at Argonne National Laboratory are leveraging cutting-edge supercomputing power to improve nuclear reactor safety by accurately modeling turbulent fluid flow—a critical factor in heat transfer and gas mixing within reactors. Using advanced open-source computational fluid dynamics (CFD) tools, Nek5000 (CPU-based) and its GPU-optimized successor NekRS, the team can simulate complex turbulent behaviors, such as hydrogen gas mixing in containment structures, which is vital for preventing accidents like the 2011 Fukushima disaster. Their models demonstrated high accuracy in the international PANDA blind benchmark, successfully predicting gas flow patterns without prior experimental data. This breakthrough has attracted the attention of the U.S. Nuclear Regulatory Commission (NRC), which is collaborating with Argonne to apply these simulations for verifying complex containment geometries where traditional methods fall short. By transitioning simulations to the powerful Aurora supercomputer and integrating AI and machine learning through the DOE’s NEAMS program, Argonne aims to drastically reduce computation times and enhance predictive capabilities. This approach not only
energynuclear-energysupercomputingcomputational-fluid-dynamicsreactor-safetyturbulence-modelinghigh-performance-computingParis Electrified 2.0 - CleanTechnica
The article "Paris Electrified 2.0" by Fritz Hasler revisits Paris’s progress in electrification since his initial visit in 2024. During a brief 36-hour stay in February 2026, Hasler observed a significant proliferation of electric vehicles (EVs) throughout the city, including battery electric cars, trucks, buses, and e-bikes. He contrasts this with his experience living in Paris in 1975, when public transit relied heavily on the electrified Metro system and buses, and ride-hailing apps like Uber did not exist. Today, Paris offers a robust electric Metro system complemented by widespread availability of EV Ubers and taxis, with no price penalty for requesting electric vehicles. Hasler highlights the presence of diverse EV models in Paris, noting his rides in a BYD Seal and a Toyota bZ4X as Uber vehicles—both featuring advanced, large display screens surpassing those in his Tesla models. He points out that while BYD vehicles are not
energyelectric-vehiclesEVspublic-transportationelectrificationbattery-technologyurban-mobilityRivian R2 launch: Here’s what $57,990 gets you
Rivian has unveiled detailed pricing, colors, and performance specifications for its upcoming R2 mid-sized SUV, aiming to offer a more affordable electric vehicle accessible to a broader market. The initial model available this spring will be the top-tier R2 Performance with Launch Package, an all-wheel-drive dual-motor EV delivering 656 horsepower, 609 lb-ft of torque, and up to 330 miles of EPA-estimated range, starting at $57,990. Rivian plans to release several other versions over the next few years, including a premium dual-motor AWD trim at $53,990 in late 2026, a long-range rear-wheel-drive version with 345 miles of range at $48,490 in early 2027, and a potential $45,000 standard version with 275 miles of range expected in late 2027, though its production is uncertain. All R2 trims share core features such as an 87.9 kWh battery pack, Rivian’s
energyelectric-vehiclesbattery-technologyRivianelectric-SUVautomotive-energy-storageEV-rangeSan Francisco Could Add 100 New Curbside EV Chargers - CleanTechnica
San Francisco plans to install 100 new curbside public electric vehicle (EV) chargers to expand access to EV charging, particularly benefiting renters who may lack home charging options. The city already has over 1,700 public Level 2 and fast DC chargers, surpassing the number of gasoline pumps, which have declined from over 100 to fewer than 90 in the past 15 years. With around 30,000 EVs registered—about 7% of the city’s vehicles—the demand for public charging infrastructure continues to grow, supported by state and local policies aimed at promoting EV adoption. This expansion aligns with San Francisco’s goal to achieve net-zero greenhouse gas emissions by 2040, emphasizing the role of EVs in reducing fossil fuel consumption. The article highlights the comparatively low cost of EV charging—around $14 for a full charge at curbside stations, which is significantly cheaper than gasoline costs when considering the broader societal expenses associated with fossil fuels. Although adding 100 chargers may seem
energyelectric-vehiclesEV-chargersclean-energyrenewable-energysustainable-transportationnet-zero-emissionsHonda scraps 3 EVs planned for the US, blaming tariffs and Chinese competition
Honda has canceled three electric vehicle models—the Honda 0 SUV, 0 Saloon, and the electric Acura RSX—originally planned for the U.S. market. The company attributed this decision to the negative impact of President Donald Trump’s tariffs on its gas and hybrid vehicle business, creating a challenging earnings environment. Additionally, Honda cited increased competition from Chinese EV manufacturers and slowing growth in the U.S. market as key factors influencing the cancellations. In response, Honda plans to reassess its resource allocation and focus more on strengthening its hybrid vehicle lineup in the U.S. The company warned that these strategic changes could result in costs up to $15.7 billion. This move places Honda among several established automakers that have recently scaled back or abandoned their electric vehicle plans for the U.S. market.
energyelectric-vehiclesautomotive-industryHondatariffsChinese-competitionhybrid-modelsAIKO’s new solar panels promise 90.6% power output after 3 decades
AIKO Energy has launched its third-generation All-Back Contact (ABC) 60-Cell solar module in Australia, designed to address the challenge of limited rooftop space amid rising household energy demands driven by electric cooking and EV adoption. The new panels boast over 25% mass-production efficiency and output up to 545W, making them highly efficient for residential, commercial, and off-grid applications. AIKO’s Infinite ABC technology eliminates front metal grid lines, enhancing sunlight absorption and delivering up to 30W more power per module compared to comparable TOPCon panels, along with a 15% higher lifetime energy yield per square meter. Built specifically for Australian conditions, these panels feature enhanced durability with 3.2mm thick front glass for superior hail protection, IEC Fire Class A certification for bushfire areas, and copper interconnections replacing standard silver paste for improved reliability. They also exhibit a low temperature coefficient (−0.26%/°C), maintaining efficiency in extreme heat, and demonstrate minimal degradation
energysolar-panelsAIKO-Energyrenewable-energysolar-technologyenergy-efficiencysustainable-energyPalm-sized magnet joins world's most powerful coils for first time
Researchers at ETH Zürich have developed the most powerful miniature superconducting magnets to date, achieving magnetic fields above 40 tesla in a palm-sized device consuming less than one watt of power. Utilizing rare-earth barium copper oxide (REBCO) tape, the team constructed two compact high-temperature superconducting (HTS) magnets: one generating 38 tesla with two pancake-shaped coils, and another reaching 42.3 tesla with four stacked coils. These magnets dramatically reduce size and power consumption compared to traditional high-field magnets, which require room-sized infrastructure and megawatts of electricity, such as the 45.5-tesla magnet at the U.S. National High Magnetic Field Laboratory that consumes over 20 megawatts. The key engineering breakthrough involved winding REBCO tape around a very small 3.1-millimeter bore without damaging the superconducting layer, achieved by relocating coil connection points outside the bore and employing a no-insulation winding method with full-coil solder
energysuperconducting-magnetshigh-temperature-superconductorsREBCO-tapenuclear-magnetic-resonancequantum-materialsmicro-NMRUS firm begins drilling for world's first mile-deep nuclear reactor
Deep Fission, a California-based nuclear startup, has begun drilling the first of three data acquisition wells for its groundbreaking underground nuclear pilot project called the “Gravity” reactor. This small modular reactor (SMR) is designed to operate a mile beneath the Earth’s surface, specifically at the Great Plains Industrial Park in Parsons, Kansas. The initial well, drilled to about 6,000 feet deep and eight inches in diameter, aims to collect essential geological, hydrological, and thermal data. The project represents a shift from concept to construction and demonstrates a novel approach to nuclear energy deployment by leveraging natural geology for containment and pressure. The Gravity reactor’s design eliminates the need for massive surface containment structures by situating the reactor at the bottom of a deep borehole. At this depth, the water column provides the necessary 160 atmospheres of pressure, removing the need for expensive surface pressure vessels. Additionally, the surrounding bedrock offers natural shielding and containment, reducing the surface footprint and enhancing security. Deep F
energynuclear-energysmall-modular-reactorsunderground-reactorsclean-energyenergy-innovationsustainable-powerGroup14 opens factory to produce battery materials for flash charging EVs
Group14 has inaugurated its BAM-3 factory in South Korea to produce silicon anode battery materials at scale, aiming to revolutionize electric vehicle (EV) charging and energy storage. The facility can produce up to 2,000 metric tons annually, sufficient for about 10 gigawatt-hours of energy storage or 100,000 long-range EV batteries. This production scale marks a significant milestone for Group14 and the broader battery industry, addressing a key hurdle in silicon anode adoption: manufacturing large quantities. The factory was initially a joint venture with Korean battery maker SK, which owned 75% before Group14 acquired full control last summer amid SK’s strategic shifts. Silicon anodes promise to vastly improve battery energy density and charging speed compared to traditional carbon anodes, as silicon can store up to ten times more lithium ions. However, silicon’s tendency to swell and degrade quickly has limited its practical use. Group14’s innovation lies in a hard carbon scaffold that stabilizes tiny silicon particles,
energybattery-materialssilicon-anodeelectric-vehiclesfast-chargingenergy-storageEV-batteriesUS: New rifle-mounted laser weapon to disrupt drones in combat zones
A US defense firm, NUBURU, has achieved a proof-of-concept milestone for a portable rifle-mounted laser weapon designed to disrupt hostile drones using non-kinetic directed-energy technology. The system, developed by NUBURU’s subsidiary Lyocon, employs a laser dazzler that emits multiple light beams across green, blue, and infrared wavelengths to interfere with drone sensors and cameras, impairing their visual navigation without physically destroying the UAVs. This lightweight, compact platform integrates with standard military small arms and offers adjustable power output and beam control, enabling rapid deployment in NATO-compliant operational environments. The development addresses the growing threat posed by low-cost commercial and tactical drones, which increasingly endanger frontline troops, vehicles, and critical infrastructure. As drone threats escalate, defense agencies worldwide are accelerating efforts to procure portable counter-UAV solutions capable of neutralizing these threats in real time. NUBURU’s modular directed-energy system aims to provide a scalable, adaptable, and non-lethal method for protecting personnel and
energydirected-energylaser-weaponcounter-drone-technologyunmanned-aerial-vehiclesmilitary-technologyoptical-interferenceWorld's first off-grid solar-to-hydrogen plant to be built in Spain
A new partnership between Israeli startup H2Pro and renewable energy developer Doral Hydrogen is set to build the world’s first off-grid solar-to-hydrogen plant in Extremadura, Spain. This project aims to produce green hydrogen directly from solar power without relying on grid electricity, addressing the high costs and technical challenges associated with conventional electrolyzers that require steady baseload power. By using H2Pro’s Decoupled Water Electrolysis (DWE) technology, which separates hydrogen and oxygen production and can handle intermittent renewable energy without hardware damage, the plant will enable flexible, efficient hydrogen production that matches the fluctuating output of solar power. The initial phase will feature a 5 MW DWE system paired with 10 MWp of solar capacity, with plans to scale up to a 50 MW renewable fuels facility supported by 80 MWp of solar generation. The produced hydrogen will be immediately blended into existing natural gas pipelines operated by Enagás, allowing for early revenue generation without costly infrastructure changes.
energygreen-hydrogensolar-powerrenewable-energyhydrogen-productiondecoupled-water-electrolysisoff-grid-energy-systemsGulf & Environment Groups Respond To Public Waters Sell-off To Oil Industry - CleanTechnica
The article discusses the Trump administration’s recent large-scale offshore oil and gas lease sale in the Gulf of Mexico, conducted by the Bureau of Ocean Energy Management (BOEM). This auction covered 80 million acres and is part of a series of planned Gulf sales through 2040, mandated by a Trump-era tax and spending law. Environmental and Gulf advocacy groups sharply criticized the sale, arguing that it prioritizes oil industry profits over the health of coastal ecosystems, wildlife, and communities. They highlight that offshore drilling is highly risky and environmentally damaging, and express concern over recent regulatory changes that reduce oil companies’ financial responsibility for environmental cleanup, potentially leaving taxpayers liable for abandoned infrastructure costs. Despite soaring energy prices, the administration received significantly fewer bids compared to a December sale, with most bids focused on deep and ultra-deepwater areas, which are considered high-risk. Critics emphasize that the administration has failed to adequately assess the environmental and economic risks of these lease sales, including the potential for catastrophic oil spills and harm
energyoil-and-gasoffshore-drillingfossil-fuelsenvironmental-impactpublic-watersenergy-policyPlugin Vehicles Achieve 19% Penetration in Australian Auto Market in February - CleanTechnica
In February 2026, plugin electric vehicles (EVs) achieved a significant milestone in the Australian auto market, reaching a 19% penetration rate. This comprised 11,100 battery electric vehicles (BEVs) and 5,854 plugin hybrid EVs (PHEVs), totaling nearly 17,000 new EV owners—almost double the number from February 2025. Out of over 91,000 light vehicles sold that month, the growth in plugin vehicle sales came primarily at the expense of petrol-only internal combustion engine vehicles, while diesel vehicle shares remained steady. The Australian EV market continues to evolve with new model introductions, such as the upcoming Tesla Model Y Long Range and NIO’s budget-friendly Firefly sub-brand, alongside MG’s stripped-down urban MG 4. The top-selling EV models in Australia for February 2026 highlight BYD’s strong market presence, with six of the top 20 models from the Chinese automaker, including the BYD Sealion
energyelectric-vehiclesEV-salesautomotive-marketclean-technologybattery-electric-vehiclesplugin-hybridsElectric Car Average Price Falls by €1,800 as Carmakers Release Affordable Models to Meet EU Target — Analysis - CleanTechnica
The average price of electric vehicles (EVs) in the European Union fell by €1,800 (4%) to €42,700 in 2024, marking the first price decline since 2020. This drop is primarily attributed to the introduction of more affordable small EV models in the B-segment, such as the Citroën ë-C3 and Renault 5, launched to help carmakers meet the EU’s 2025 car CO2 emissions targets. Between 2020 and 2024, EV prices had risen by about €5,000 despite reductions in battery and component costs, as manufacturers focused on larger, more profitable EVs due to weaker emissions targets during that period. The analysis by Transport & Environment (T&E) highlights that half of the carmakers have already met the 2025-2027 EU targets ahead of schedule, with Renault and Volkswagen expected to comply by 2027. The report also indicates that EVs have reached price parity with combustion engine
energyelectric-vehiclesEU-emissions-targetsEV-price-parityautomotive-industryclean-transportationbattery-cost-reductionHow to Fix Greenwashing Risks in the EU’s Next Long-Term Budget - CleanTechnica
The article discusses concerns about greenwashing risks in the European Union’s upcoming long-term budget, specifically related to the proposed Performance Regulation. This regulation aims to establish a unified framework for tracking climate and environmental spending across the entire EU budget, which involves over €1 trillion. While the introduction of such a framework is a positive move toward simplifying budget management and enhancing transparency, the current proposal contains weaknesses that could allow substantial EU funds to be misclassified as climate or environmental initiatives without delivering genuine benefits. A coalition of NGOs and European think tanks, including WWF, ClientEarth, and the European Environmental Bureau, has published detailed guidance and proposed revisions to address these issues. Their joint briefing highlights problematic elements in Annex I of the regulation, which defines how climate and environmental spending is tracked. The recommended corrections target reducing greenwashing risks, improving the credibility of the EU’s climate tracking, and ensuring that the budget effectively supports the EU’s climate and environmental goals. As negotiations on the next Multiannual Financial Framework (MFF)
energyclimate-changeEU-budgetenvironmental-policygreenwashingsustainabilityclimate-financeBurning Plastic Isn’t Renewable: Rethinking Waste & Power In Hawaii - CleanTechnica
The article critically examines Oʻahu’s H-POWER waste-to-energy facility within the context of the island’s fully electrified energy system. H-POWER, operational since 1990 and expanded in 2012, processes 2,000 to 3,000 tons of municipal waste daily, generating about 340 GWh annually—roughly 4-5% of Oʻahu’s electricity. While the plant significantly reduces landfill volume by converting waste to ash and flue gases, its primary function is waste disposal rather than clean energy production. The article highlights that modern municipal waste contains a substantial portion of fossil-derived materials, especially plastics, which release fossil carbon dioxide when burned. Hawaiʻi’s greenhouse gas inventory estimates about 300,000 metric tons of CO2e annually from waste incineration, resulting in an emissions intensity (~0.88 tons CO2e/MWh) comparable to coal plants and much higher than renewable sources like solar or wind. Further analysis of the waste composition
energywaste-to-energyrenewable-energyemissionselectricity-generationclimate-impactwaste-management1,000x more efficient tabletop laser could power future nuclear clocks
Physicists at the University of Colorado Boulder, led by Henry Kapteyn and Margaret Murnane of JILA, have developed a new vacuum ultraviolet (VUV) laser that is 100 to 1,000 times more efficient than existing technologies. This compact, tabletop device generates bright light in the challenging VUV wavelength range (approximately 100 to 200 nanometers), which has been difficult to access with practical systems due to strong absorption by most materials. The laser operates by combining red and blue laser beams and passing them through an anti-resonant hollow core fiber filled with xenon gas, which absorbs and re-emits the light at shorter VUV wavelengths. This innovation enables higher resolution microscopy, real-time tracking of chemical reactions, and detection of microscopic defects in nanoelectronics. Beyond imaging applications, the new laser could significantly advance the development of ultra-precise nuclear clocks, which measure time based on energy transitions within atomic nuclei rather than electrons. Such clocks rely on thorium atoms
energylaser-technologyvacuum-ultravioletnuclear-clocksprecision-measurementnanoelectronicsmaterials-scienceExtreme Heat Limits Outdoor Activities For One Third Of Human Population - CleanTechnica
A recent study by scientists from the Nature Conservancy, published in a scientific journal, reveals that nearly one-third of the global population today cannot safely perform outdoor work due to rising temperatures driven by fossil fuel combustion. These extreme heat conditions hinder even basic physical activities, such as housework or climbing stairs, especially during peak summer daylight hours. The elderly are disproportionately affected because their bodies have a reduced ability to regulate temperature through sweating. On average, people over 65 now face about 900 hours annually when heat severely limits safe outdoor activity, a significant increase from 600 hours in 1950, equating to over a month of daytime hours with heightened heat stress. The study highlights that poorer countries and regions suffer the most from these heat limitations, despite contributing least to climate change. Tropical and subtropical areas, including parts of southwest Asia (e.g., Bahrain, Qatar, UAE), south Asia (e.g., India, Pakistan, Bangladesh), and west Africa (e.g., Mali, Senegal,
energyclimate-changefossil-fuelsheat-stressoutdoor-activityglobal-warminghuman-healthStop Waiting for Gas Prices to Go Back to Normal. The Volatility Is the Real Problem. - CleanTechnica
The article from CleanTechnica highlights the ongoing volatility in global fuel prices, driven by geopolitical conflicts such as the shutdown of the Strait of Hormuz and disruptions in oil shipping routes. This volatility causes unpredictable spikes in gasoline and diesel prices, making it difficult for consumers to plan their budgets. Although interest in electric vehicles (EVs) has surged, many potential buyers hesitate to switch due to high vehicle prices, interest rates, and the perceived hassle of adapting to new charging infrastructure. The article emphasizes that waiting for gas prices to "return to normal" is a flawed strategy because price spikes are recurrent and tied to global instability, not just temporary crises. The core issue is not just high fuel prices but their extreme unpredictability, which continually strains household and commercial budgets. Fossil fuel dependence ties local economies to a volatile global market vulnerable to wars, natural disasters, and supply chain disruptions. This volatility disproportionately affects diesel users, including commercial freight, leading to widespread economic ripple effects. The article argues that electric vehicles
energyelectric-vehiclesgas-pricesenergy-volatilityrenewable-energycharging-stationsgeopolitical-impactThe NEVI Funds Are Finally Unfrozen, But The Administration’s Chaos Goes Unpunished - CleanTechnica
The article discusses the recent unfreezing of the $5 billion National Electric Vehicle Infrastructure (NEVI) funds, which were initially authorized by Congress under the Bipartisan Infrastructure Law to expand EV charging stations across U.S. highways. Despite this legal authorization, the Trump administration unlawfully froze the program in 2025, halting progress on establishing a nationwide charging network with stations every 50 miles. A federal judge ruled in January 2026 that the freeze was illegal, ordering the administration to release the funds. However, the delay caused significant disruption, forcing states to restart procurement processes, renegotiate contracts, and face increased costs and delays in construction timelines. The article highlights the long-term damage caused by the freeze, noting that states like New Mexico, Arizona, and others are still recovering from the pause, with new construction projects not expected to begin until 2027 or later. While officials express relief that the funds are now flowing, the lost time and increased expenses cannot be undone. The author
energyelectric-vehiclesEV-charging-infrastructureNational-Electric-Vehicle-Infrastructure-programBipartisan-Infrastructure-Lawrenewable-energytransportation-electrificationBioacid-powered process pulls cobalt, nickel from old batteries
Scientists have developed a cleaner, more sustainable method to separate cobalt and nickel from lithium-ion battery materials using an electrochemical technique enhanced by bioacids, specifically tartaric acid, a naturally occurring acid found in grapes and used in winemaking. This approach addresses the growing demand for cobalt and nickel driven by the expansion of electric vehicles, smartphones, and grid storage systems. Traditional solvent extraction methods for metal recovery are costly, environmentally harmful, and less effective for battery recycling due to low metal concentrations and mixed ions. The new method leverages electrowinning, a process that deposits metals as solids on electrodes, combined with bioacids that chemically interact with metal ions to improve separation efficiency. Led by Assistant Professor Yayuan Liu, the research highlights the potential of this technique for "urban mining," which recovers valuable metals from discarded electronics and spent batteries, offering a practical pathway to reduce reliance on foreign supply chains. The team found that tartaric acid forms a unique di-nuclear complex with cobalt and
energymaterialsbattery-recyclingcobalt-recoverynickel-recoverylithium-ion-batteriesclean-energy-transitionPolitical Change Requires A Hopeful Vision Of Tomorrow: Rebecca Solnit - CleanTechnica
The article highlights insights from Rebecca Solnit, a San Francisco-based writer, historian, and activist, known for her optimistic approach to political and social change. Solnit’s 2004 book, *Hope in the Dark*, emphasized rejecting cynicism and embracing incremental progress through collective effort. Her upcoming 2026 book, *The Beginning Comes after the End*, continues this theme, reflecting on how progressive movements have profoundly changed the world despite significant backlash from conservative forces. Solnit stresses that while opposition exists, it is neither comprehensive nor global, and she urges focus on tangible, incremental victories, such as the energy revolution driven by affordable solar and wind technologies. Solnit identifies the main barriers to climate action as political and economic interests tied to the fossil fuel industry rather than technological limitations. She critiques the fascination with “superhero” solutions, advocating instead for collective action and sustained effort. Despite setbacks, including opposition from the current U.S. administration, Solnit insists that civil society remains the key to resistance
energyrenewable-energysolar-powerwind-powerclimate-actionfossil-fuelsenergy-revolutionUS tool to recreate deep-earth conditions to unlock 'superhot' power
Oregon State University (OSU) has received a $750,000 donation from Quaise Energy to advance research on superhot rock (SHR) geothermal energy, a promising resource estimated to have the potential to generate 63 terawatts of power—over eight times the current global electricity output—by exploiting just 1% of SHR resources located 2 to 12 miles beneath the Earth's surface. The funding supports OSU’s Experimental Deep Geothermal Energy (EDGE) lab in simulating extreme deep-earth conditions, specifically studying water at supercritical temperatures (374°C) and pressures (up to 500 atmospheres), where water can transport up to five times more energy than standard hot water. This research is crucial as existing geothermal models do not accurately predict behaviors in such superhot regimes. The EDGE lab, led by Assistant Professor Brian Tattitch, uses a custom flow-through reactor to observe real-time chemical interactions between rock and fluids under these conditions, aiming to overcome challenges such as mineral
energygeothermal-energydeep-earth-conditionssuperhot-rockdrilling-technologymaterials-scienceenergy-researchAlmost 40 new unicorns have been minted so far this year — here they are
In 2026, nearly 40 new startups have achieved unicorn status, driven largely by heightened investor interest in artificial intelligence (AI). According to data from Crunchbase and PitchBook tracked by TechCrunch, the majority of these companies are AI-focused, although notable unicorns also emerge from sectors such as health care and cryptocurrency. The list of newly minted unicorns is dynamic and will be updated throughout the year. Highlighted companies include Positron, an AI startup founded in 2023 with over $300 million raised; Skyryse, an autonomous flight technology firm with more than $540 million in funding; and TRM Labs, a crypto fraud investigation platform backed by $219 million. Other significant unicorns span diverse fields: Midi Health targets menopausal telemedicine, Lunar Energy develops advanced batteries, and Bedrock Robotics applies AI to construction automation. Additionally, companies like Iterative Health and Solace focus on medical research and healthcare marketplaces, respectively, while Apptronik leads with a $5.
energybatteriesroboticsAIstartupsventure-capitaltechnology-innovationPhotos: Ultra-rare 761 hp hypercar shatters lap record by 7 seconds with V12 engine
The Gordon Murray Automotive (GMA) T.50s Niki Lauda hypercar, powered by a specially developed 3.9-liter Cosworth V12 engine producing 761 horsepower at 11,500 rpm, has set a new lap record at the Bahrain International Circuit, beating the previous best by seven seconds. Weighing under 900 kg thanks to extensive use of carbon fiber for the monocoque and body panels, the car emphasizes a superior power-to-weight ratio and exceptional handling. Key features include adjustable R53 dampers for precise track tuning, carbon-ceramic brakes, magnesium wheels, and Michelin slick tires to maximize grip and performance. The T.50s replaces the road car’s manual gearbox with a lighter, six-speed Xtrac sequential transmission operated via paddle shifters for faster gear changes, enhancing driver focus during high-speed driving. Aerodynamics play a critical role, with a rear-mounted fan spinning at 7,000 rpm generating 2,645 pounds
materialsenergyautomotive-engineeringcarbon-fiberV12-enginelightweight-materialsaerodynamicsUS tool to recreate deep-earth conditions to unlock 'superhot' power
Oregon State University (OSU) has received a $750,000 donation from Quaise Energy to advance research on superhot rock (SHR) geothermal energy, a resource with the potential to generate up to 63 terawatts—over eight times the current global electricity output—by exploiting just 1% of SHR resources located 2 to 12 miles beneath the Earth’s surface. The funding supports OSU’s Experimental Deep Geothermal Energy (EDGE) lab in simulating extreme deep-earth conditions, specifically studying water at supercritical temperatures (374°C) and pressures (500 atmospheres), where it can carry significantly more energy than standard hot water. This research aims to reduce technical risks as Quaise Energy progresses from successful 2025 drilling tests toward deeper drilling goals in 2026. The EDGE lab, led by Assistant Professor Brian Tattitch, uses a custom flow-through reactor to replicate deep-earth environments and monitor chemical interactions between rock and fluids in real time, addressing the shortcomings
energygeothermal-energydeep-earth-conditionssuperhot-rockdrilling-technologymaterials-scienceenergy-researchMeta debuts new AI silicon to power platform recommendations
Meta Platforms has unveiled a roadmap for four new custom AI chips under its MTIA (Meta Training and Inference Accelerator) program, aimed at enhancing AI capabilities across its platforms like Facebook and Instagram. The first chip, MTIA 300, is already deployed to power content ranking and recommendation algorithms. The subsequent chips—MTIA 400, 450, and 500—are designed to handle AI inference workloads, with improvements in memory capacity and low-precision AI processing. Meta plans to release these chips roughly every six months over the next two years, reflecting its rapid expansion of AI infrastructure and data center footprint. Built on the open-source RISC-V architecture with design support from Broadcom and fabricated by TSMC, these chips enable Meta to optimize AI workloads more efficiently than general-purpose processors. Starting with the MTIA 400, Meta is also designing entire computing systems around the chips, including advanced cooling solutions, to support large-scale AI operations. This iterative development approach allows Meta to quickly adapt
energymaterialsAI-chipssemiconductor-manufacturingdata-centerscustom-siliconAI-infrastructure3D Chess Alert As Iran War Builds The Case For Clean Energy
The article discusses how escalating tensions and conflict involving Iran have driven up petroleum and natural gas prices in the U.S., indirectly boosting the attractiveness of clean energy sources like wind and solar. Despite President Donald Trump’s generally fossil-fuel-friendly stance, there are signs he is allowing some key solar projects to proceed, particularly in Nevada. The Esmeralda 7 solar project, initially stalled by the Interior Department, appears to be back on track after intervention by Nevada’s Republican Governor Joe Lombardo, signaling a subtle shift in federal energy policy amid market pressures. Nevada remains a significant player in solar energy, ranking sixth nationally in total solar capacity with 8.2 gigawatts powering approximately 1.4 million homes annually, despite a sharp decline in new solar capacity additions in 2025. The state continues to lead in new electricity generation from solar, underscoring the resilience and economic viability of clean energy investments. This is further exemplified by a recent $600 million bond refinancing deal for the
energyclean-energysolar-powerrenewable-energyenergy-policysolar-capacityenergy-infrastructureTehran hit by 'black rain' after US-Israeli strikes on oil depots
The recent US-Israeli strikes on oil refineries and desalination plants near Tehran have caused a severe environmental and humanitarian crisis marked by toxic "black rain"—rain darkened by pollutants from the fires. Satellite images confirmed smoke drifting over Tehran, prompting WHO warnings about acute health risks such as respiratory distress and chemical burns, alongside long-term dangers including cancer and neurological disorders. The strikes have released a complex mix of hazardous pollutants like carbon monoxide, soot, sulfur, nitrogen oxides, and metallic compounds, creating an unprecedented chemical smog that blocks sunlight and contaminates air, water, and soil, with lasting effects on human health and fragile ecosystems. In addition to air pollution, the targeting of desalination infrastructure has exacerbated Iran’s critical water insecurity. The attacks have cut water supplies to numerous villages and affected neighboring Bahrain, compounding the impact of a five-year drought that has severely depleted natural water sources. Iran’s efforts to expand desalination are hindered by sanctions, high costs, and infrastructure
energyoil-infrastructureenvironmental-pollutionchemical-smogwater-insecuritydesalination-plantspower-gridsPhotos: 62-foot hybrid catamaran marries 42 solar panels with twin 450 hp engines for power
Turkish yacht builder VisionF Yachts has introduced the 65 Hybrid, a 62-foot (19 m) compact hybrid catamaran designed to bring hybrid yacht technology to a broader market. This model marks the company's entry into the 60-foot segment, a departure from its usual production of larger multihulls over 80 feet. The 65 Hybrid combines a muscular, clean-lined exterior with balanced proportions and a wide 30-foot (9.1 m) beam, offering stability and a spacious deck footprint. Constructed from GRP composite rather than aluminum, the vessel is lighter at about 66 tons, enhancing fuel efficiency and making it more accessible. Inside, the yacht features a large salon for socializing, four guest cabins accommodating eight passengers, and separate crew quarters for up to four crew members. Expansive glass panels throughout the interior maximize natural light and maintain a strong connection with the surrounding ocean. The hybrid propulsion system pairs twin 450 hp Volvo Penta engines with two battery
energyhybrid-technologysolar-panelscomposite-materialsmarine-engineeringfuel-efficiencysustainable-transportationFirst in US: New solid-state battery passes customer approval
ION Storage Systems, a Maryland-based U.S. battery developer, has achieved a significant milestone by having its solid-state Cornerstone Cell battery technology pass customer performance qualification—the first such validation for a U.S. solid-state battery company. This accomplishment follows the shipment of sample cells in August 2025 to partners across industrial equipment, consumer electronics, and automotive sectors. Passing customer qualification indicates the battery meets stringent commercial standards, enabling ION to move beyond lab testing toward real-world application and large-scale production. The Cornerstone Cell features a novel solid-state, anodeless architecture that replaces the traditional liquid electrolyte and anode with a solid electrolyte, aiming to enhance energy density, thermal stability, and safety compared to conventional lithium-ion batteries. ION’s strategy focuses initially on smaller or specialized applications rather than electric vehicles, mirroring the early market entry path of lithium-ion batteries. This approach is intended to build manufacturing expertise and customer confidence before scaling to larger markets. The company is expanding its Beltsville,
energysolid-state-batterybattery-technologyenergy-storagelithium-ion-alternativebattery-safetyindustrial-applicationsAnother Electric Vehicle Benefit: No Catalytic Converters To Be Stolen - CleanTechnica
The article highlights a lesser-known benefit of fully electric vehicles (EVs): they do not have catalytic converters, which are common targets for theft in gasoline-powered cars. Catalytic converter theft has become a significant problem in the U.S., with estimates suggesting between 600,000 to 700,000 thefts annually. The average replacement cost ranges from $2,000 to over $2,500, leading to an estimated public repair cost exceeding $1.5 billion per year. This theft rate affects roughly 2% to 2.5% of the active vehicle population in the country. Many thefts go unreported due to lack of insurance coverage, making accurate data collection difficult. In contrast, fully electric vehicles lack catalytic converters and many other components prone to theft, such as mufflers and spark plugs, offering owners protection from this costly issue. Hybrids and extended-range electric vehicles (EREVs) still contain catalytic converters and remain vulnerable to theft. The article underscores that beyond environmental
energyelectric-vehiclescatalytic-convertersvehicle-thefthybrid-vehiclesemissions-reductionclean-technologyUS Army clears first new offensive hand grenade design in 57 years
The U.S. Army has officially introduced the M111 Offensive Hand Grenade, the first new lethal hand grenade design approved in nearly 60 years, marking a significant advancement in military weaponry tailored for modern combat. Unlike the longstanding M67 fragmentation grenade, which dates back to the Vietnam War era and is optimized for open battlefields, the M111 is designed specifically for urban warfare. It utilizes blast overpressure (BOP) rather than fragmentation, reducing the risk of fratricide in confined spaces such as buildings, where lethal fragments from traditional grenades could penetrate walls and endanger friendly forces. The M111 features a plastic body that is fully consumed upon detonation, making it safer for both training and combat compared to older models like the asbestos-containing Mk3A2. Developed collaboratively by the Capabilities Program Executive Ammunition and Energetics and the DEVCOM Armaments Center, the M111 offers soldiers a specialized option for restricted terrain without replacing the M67. Soldiers can now
energymilitary-technologyexplosivesblast-overpressureurban-warfareweapon-designdefense-materialsGeely & Zeekr Right Behind BYD with 1,500 kW Charging - CleanTechnica
The article highlights a significant advancement in electric vehicle (EV) charging technology in China, focusing on Geely and its premium brand Zeekr, which are closely following BYD in deploying ultra-fast 1,500 kW charging capabilities. The 2026 Zeekr 001 model, equipped with Geely’s “Golden Battery” featuring 12C charging capability and a 900V architecture, can charge from 10% to 80% in just seven minutes by drawing up to 1,488 kW of power. This rapid charging is supported by Geely’s proprietary Aegis Lithium Iron Phosphate (LFP) batteries, which demonstrate strong low-temperature performance and long-term durability, retaining over 90% capacity at -30°C and maintaining 92.1% health after 1,500 full charge cycles. Geely is not only innovating in battery and vehicle technology but also in charging infrastructure, opting to own and operate its own 1,500 kW
energyelectric-vehiclesfast-charginglithium-iron-phosphate-batteriesenergy-storagehigh-voltage-architecturenew-energy-vehiclesUS team hits record 151 Kelvin superconductivity at ambient pressure
Researchers at the Texas Center for Superconductivity and the University of Houston have achieved a record-high superconducting transition temperature of 151 Kelvin (−251°F) at ambient pressure, surpassing the previous record of 133 K (−356°F) set in 1993. This breakthrough is significant because the transition temperature marks the point below which a material can conduct electricity without resistance, and raising this temperature makes superconducting technologies more practical and affordable. The research was funded by Intellectual Ventures, the state of Texas, and other foundations. The team employed a technique called pressure quenching, which involves applying intense pressure to enhance superconducting properties, cooling the material under pressure, and then rapidly decompressing it to "lock in" these properties at ambient pressure. This method contrasts with previous approaches that required maintaining high pressure to sustain superconductivity. Achieving stable superconductivity at ambient conditions opens new possibilities for energy generation, transmission, medical imaging, fusion energy, and faster electronics. The ultimate goal remains to reach
energysuperconductivitymaterials-scienceambient-pressureelectrical-gridsfusion-energyadvanced-electronicsUS sinks 16 Iranian boats in bid to prevent Hormuz energy blockade
Tensions in the Persian Gulf escalated sharply as the United States conducted its most intense military strikes against Iran since the start of Operation Epic Fury on February 28, 2026. On March 10, the US destroyed 16 Iranian vessels suspected of laying mines in the Strait of Hormuz, a critical chokepoint that handles about 20 percent of the world’s oil supply. President Donald Trump issued a stern warning via Truth Social, threatening unprecedented military retaliation if Iran attempted to block the waterway with mines. The US employed advanced surveillance and missile technologies, originally used against drug traffickers, to detect and neutralize Iranian mine-laying boats, underscoring the strategic importance of keeping the shipping lane open to avoid global fuel price disruptions. US Defense Secretary Pete Hegseth described the day’s strikes as the most aggressive yet, targeting Iranian military sites, missile installations, and nuclear program elements. Despite heavy bombardment reported in Tehran, Iranian leaders vowed to continue their campaign, launching drones
energyoilPersian-GulfStrait-of-Hormuznaval-vesselsmilitary-technologysurveillance-systemsNIO Makes A Profit - CleanTechnica
NIO achieved a significant milestone by reporting an operational profit in the fourth quarter of 2025, joining Tesla and BYD as one of the few electric vehicle (EV) companies to do so. In Q4 2025, NIO's vehicle sales reached RMB31.6 billion (US$4.52 billion), an 80.9% increase from the same quarter in 2024, with a vehicle margin improving to 18.1%. Total revenues rose 75.9% year-over-year to RMB34.7 billion (US$4.95 billion), and gross profit surged 163.1% to RMB6.07 billion (US$868.6 million). The company reported a profit from operations of RMB807.3 million (US$115.4 million), a dramatic turnaround from losses in previous quarters, and a net profit of RMB282.7 million (US$40.4 million). Adjusted figures excluding share-based compensation showed even stronger profitability
energyelectric-vehiclesEV-industryNIOautomotive-technologyclean-energyprofit-milestoneToxic Coal Pollution Spikes to 25-Year High Under Trump - CleanTechnica
The article from CleanTechnica reports that pollution from coal-fired power plants in the United States has surged to a 25-year high during the Trump administration. This increase in coal pollution contradicts the administration's promotion of coal and has significant public health implications, as coal pollution is linked to respiratory illnesses, heart attacks, asthma, neurological disorders, cancer, and premature death. The spike in pollution is seen as a failure to protect Americans' health and environment. Patrick Drupp, Climate Policy Director at the Sierra Club, strongly criticized the Trump administration for prioritizing the coal industry over public health, calling it a betrayal of Americans and a threat to both health and economic well-being. The Sierra Club, a major grassroots environmental organization, continues to advocate for clean energy and environmental protection through activism, education, lobbying, and legal efforts. The article underscores the tension between coal industry support and environmental health concerns under the Trump administration.
energycoal-pollutionclean-energyrenewable-energyenvironmental-policyair-qualityclimate-changeLawsuit Challenges Trump’s Massive Public Lands Giveaway in Alaska - CleanTechnica
The article reports on a lawsuit filed by ten Alaska and national environmental groups against the U.S. Interior Department challenging the Trump administration’s decision to remove federal protections from approximately two million acres of public lands in Alaska. These lands, protected for over 50 years under Public Land Orders 5150 and 5180, form a critical ecological corridor between Gates of the Arctic National Park and the Arctic National Wildlife Refuge, supporting wildlife migrations, subsistence hunting, and intact Arctic ecosystems. The removal of protections allows the State of Alaska to take control, opening the area to mining claims and industrial projects such as the proposed Ambler mining road, as well as expanded LNG production, which environmentalists warn will cause irreversible damage. The lawsuit alleges that the Interior Department violated multiple federal laws—including the Alaska Native Claims Settlement Act, the Alaska National Interest Lands Conservation Act, the Federal Land Policy and Management Act, and the National Environmental Policy Act—by failing to conduct proper environmental reviews, hold public hearings, or meaningfully consult
energyminingpublic-landsenvironmental-protectionAlaskapipelineindustrial-developmentBYD Song Ultra In Market Context: Value & Next-Generation Capability - CleanTechnica
The article discusses BYD’s new Song Ultra, a midsized SUV that exemplifies the company’s next-generation electric vehicle (EV) capabilities, particularly its “flash charging” technology. Flash charging allows the vehicle to charge from 10% to 70% in just 5 minutes and up to 97% in 12 minutes even at very low temperatures (-30°C), a feature that does not increase the vehicle’s selling price but enhances its market appeal. The Song Ultra is positioned as a mainstream, value-oriented EV with features such as rear-wheel drive, advanced suspension, heated/cooled power seats, vehicle-to-load (VTOL) capability, and options like massage seats, refrigerator, HUD, intelligent driving, and LiDAR, aligning with consumer expectations in China. Pricing for the Song Ultra starts at 155,000 RMB ($22,430) for the base model with a 69.07 kWh battery and 605 km range (CLTC), with higher trims offering more power
energyelectric-vehiclesbattery-technologyfast-chargingBYDautomotive-technologyclean-energyA Deluge Of Solar Power Crushes A Small Victory For Coal
The article discusses the ongoing decline of coal power in the United States amid the rapid rise of renewable energy, particularly solar power. Texas Attorney General Ken Paxton, a conservative figure and Senate candidate, recently claimed a legal victory against major investment firms Vanguard, BlackRock, and State Street over their ESG (environmental, social, governance) investing practices, which he alleges unfairly disadvantage coal power. However, this "victory" is overshadowed by broader market and geopolitical trends. Despite a $29.5 million settlement by Vanguard, the firm did not admit wrongdoing and reaffirmed its commitment to ESG principles, which support renewable energy sources like wind and solar—both abundant in Texas. The article highlights that the timing of Paxton’s legal win was poor, coming just before President Donald Trump’s escalation of conflict with Iran, which caused spikes in oil, gas, and coal prices. Nonetheless, coal power remains economically challenged due to high transportation and generation costs, which have risen significantly over recent years.
energysolar-powercoal-powerrenewable-energyESG-investingUS-energy-policywind-powerBuffering Batteries: The Grid Enhancing Technology No One Calls A GET - CleanTechnica
The article discusses the role of buffering batteries as an underrecognized form of grid enhancing technology (GET) that differs from traditional GETs like dynamic line rating, power flow control, and advanced conductors. Unlike these technologies, which increase the instantaneous transmission capacity of power lines, buffering batteries do not raise the megawatt (MW) limit of transmission lines but instead shift energy through time. By storing surplus electricity during periods of congestion and releasing it when transmission capacity is available, batteries effectively increase the total energy transmitted over a day without exceeding the line’s MW rating at any moment. A key example is a solar plant producing more power than the transmission line can handle at peak times, leading to curtailment of excess energy. Adding a battery sized to absorb this surplus allows the energy to be saved and sent later, reducing waste and improving grid utilization. The economics of this approach have improved significantly due to steep declines in lithium-ion battery costs, making batteries competitive with traditional transmission upgrades, which are costly and time
energybatteriesgrid-enhancing-technologiesrenewable-energyenergy-storagetransmission-lineslithium-ion-batteriesGeoengineering The Gulf Of Maine - CleanTechnica
The article discusses the LOC-NESS project, a scientific initiative focused on geoengineering the Gulf of Maine to enhance ocean alkalinity as a method of carbon capture. The ocean is the largest carbon sink on Earth, holding about 38,000 gigatons of carbon, but increased carbon dioxide absorption lowers ocean pH, reducing its capacity to absorb more CO2 and causing ocean acidification. LOC-NESS aims to counteract this by adding alkaline substances, such as sodium hydroxide, to increase ocean alkalinity, thereby promoting greater carbon dioxide uptake. This approach, known as ocean alkalinity enhancement (OAE), has precedent in freshwater restoration but is novel and complex in marine environments. In a recent experiment near Cape Cod, scientists released 65,000 liters of sodium hydroxide over a 1 square kilometer area and monitored the effects using vessels, underwater vehicles, sensors, and satellite imagery. Preliminary results showed that 2 to 10 tons of atmospheric CO2 were absorbed over four days, with
energycarbon-captureocean-alkalinity-enhancementclimate-solutionsenvironmental-monitoringmarine-chemistrycarbon-sequestrationGoogle and Tesla think we’re managing the electrical grid all wrong
A coalition of companies including Google, Tesla, and data center developer Verrus, along with HVAC leader Carrier, virtual power plant firm Renew Home, distributed energy resource developer Sparkfund, and smart electrical panel startup Span, has formed a group called Utilize. This coalition argues that the current electrical grid is underutilized, designed primarily for brief peak demand periods, leaving significant capacity unused most of the time. Utilize advocates for rethinking grid design and operation by leveraging emerging technologies such as battery storage, demand response, and virtual power plants, which have grown over the past decade but remain insufficiently adopted. These technologies can enhance grid resilience, exemplified by Texas’s improved performance during recent cold snaps due to increased battery storage. Despite the potential benefits, many regulators and politicians remain cautious, favoring traditional centralized fossil fuel plants over newer solutions. Utilize aims to promote policies encouraging broader adoption of these technologies, benefiting both producers and consumers on the grid. The coalition’s members cover various parts of the energy ecosystem: Tesla
energyelectrical-gridbattery-storagevirtual-power-plantsdemand-responsedistributed-energy-resourcessmart-electrical-panelChevy Bolt 2.0 — Way Better In (Almost) Every Way - CleanTechnica
The second-generation Chevy Bolt, arriving now in showrooms, appears as a refreshed version of the prior Bolt EUV but is substantially redesigned beneath the surface. It features a new 65 kWh lithium iron phosphate (LFP) battery replacing the previous nickel manganese cobalt (NMC) battery, significantly reducing fire risk and allowing regular charging to 100%, unlike the old battery which was recommended to be charged only to 80%. The electric motor, sourced from the Equinox EV, delivers 210 hp and 169 lb-ft of torque with improved efficiency and a revised gear ratio that enhances low-speed performance. Despite the LFP battery’s lower energy density, the Bolt 2.0 achieves an EPA-estimated range of 262 miles. It supports up to 150 kW DC fast charging, enabling a 10 to 80% charge in about 25 minutes, and includes a NACS charging port with “plug & charge” functionality expanding across networks, including Tesla’s. Priced
energyelectric-vehicleslithium-iron-phosphate-batterybattery-technologyEV-chargingautomotive-energy-efficiencyelectric-motorUnlocking Existing Grid Capacity With Dynamic Line Rating - CleanTechnica
The article discusses the benefits and mechanics of Dynamic Line Rating (DLR) technology in electricity transmission systems. Traditional transmission line ratings are based on conservative assumptions about worst-case weather conditions—such as high temperatures, low wind, and strong sunlight—that limit the current a line can safely carry. However, these static ratings often underestimate actual line capacity because real-time weather conditions frequently provide better cooling, especially from wind, which significantly enhances conductor cooling and allows for higher current flow without overheating. DLR replaces these static assumptions with real-time measurements and weather forecasts, enabling operators to optimize line capacity dynamically and safely. DLR works by monitoring the heat balance of transmission conductors, which is influenced by electrical current, solar radiation, and cooling effects from wind and convection. Since conductor temperature affects sag and clearance limits, maintaining safe temperatures is critical. By accurately measuring environmental factors and integrating high-resolution weather models (with grid spacing around 3 km), DLR systems provide operators with current and forecasted line capacity. This allows
energysmart-griddynamic-line-ratingtransmission-lineselectrical-gridrenewable-energy-integrationgrid-optimizationLotus Poised To Be The First Chinese EV Brand In Canada Under New Tariff Law - CleanTechnica
Lotus Cars is set to become the first Chinese-built electric vehicle (EV) brand to enter the Canadian market under a new tariff framework that allows a quota of Chinese EVs to be imported at a reduced 6.1% tariff. This arrangement, effective from March 1 to August 31, permits up to 24,500 Chinese EVs to enter Canada under this preferential tariff, a result of agreements between Canadian Prime Minister Mark Carney and China’s President Xi Jinping. Lotus CEO Feng Qingfeng emphasized the strategic importance of this opportunity, noting that growth in Canada could offset losses in other regions like the Middle East. The Lotus Eletre, produced at Geely’s Wuhan factory, is expected to be the primary model exported, alongside the newly introduced Lotus For Me plug-in hybrid. Lotus’s entry into Canada aligns with Geely’s broader strategy of leveraging globally recognized brands rather than pushing unfamiliar Chinese-branded vehicles directly into Western markets. Geely, which owns Lotus, Volvo,
electric-vehiclesEVenergyelectric-carsbattery-electric-vehiclesautomotive-energyclean-energyHow Are Prices of Gas & Diesel in ASEAN and Where Do We Go From Here? - CleanTechnica
The article provides a detailed comparison of gasoline and diesel prices across ASEAN countries, highlighting the wide variation influenced by government policies, subsidies, and market dynamics. Singapore has the highest fuel prices in the region, with gasoline around ₱158 per liter ($2.84/L) and diesel about ₱139 per liter ($2.50/L), driven by high fuel taxes and strict vehicle demand management aimed at discouraging private vehicle ownership. Cambodia, Vietnam, the Philippines, and Thailand have moderate prices, with gasoline ranging from about ₱55 to ₱64 per liter ($0.98 to $1.16/L) and diesel slightly lower but still significant. In contrast, Indonesia and Malaysia maintain much lower prices near ₱28-33 per liter ($0.51-$0.60/L) for gasoline and ₱26-29 per liter ($0.46-$0.52/L) for diesel through extensive government subsidies and price controls. The Philippines stands out as one of the most market
energyfuel-pricesASEANdieselgasolinesubsidiesSoutheast-AsiaLargest California Utility Could Have 3,800 Electric Fleet Vehicles By 2030 - CleanTechnica
Pacific Gas and Electric (PG&E), California’s largest utility serving over 16 million people, is aggressively electrifying its vehicle fleet as part of its commitment to sustainability and regulatory compliance. Currently, about 13% of PG&E’s roughly 9,700 on-road vehicles use alternative fuels, including electricity. The utility aims to have 3,800 electric vehicles (EVs) by 2030, covering 100% of light-duty, 50% of medium-duty, and 20% of heavy-duty vehicles. This transition is supported by a substantial expansion of EV charging infrastructure, with plans to increase from 821 chargers across 33 sites today to approximately 3,800 chargers across 88 sites by 2030, maintaining roughly a one-to-one vehicle-to-charger ratio. PG&E’s current electric fleet includes a variety of battery electric vehicles such as Ford Lightning and Chevrolet Silverado pickup trucks, medium-duty Freightliner vans, an all-electric bucket truck, and a Tesla Model Y
energyelectric-vehiclesfleet-electrificationEV-charging-infrastructurerenewable-energyclean-energybattery-electric-vehiclesThinking Machines Lab inks massive compute deal with Nvidia
Thinking Machines Lab, an AI research startup co-founded by OpenAI alum Mira Murati, has signed a significant deal with semiconductor giant Nvidia to deploy at least one gigawatt of Nvidia’s new computing technology starting in 2027. Although the financial terms were not disclosed, Nvidia is also making a strategic investment in the company, which has raised over $2 billion since its founding in February 2025 from investors including Andreessen Horowitz, Accel, Nvidia, and AMD’s venture arm. The partnership aims to develop AI training and serving systems optimized for Nvidia’s architecture, with Murati emphasizing the foundational role of Nvidia’s technology in advancing AI development. Thinking Machines Lab, still in its early stages without any released products, focuses on building AI models that produce reproducible results. The company has experienced notable talent departures recently, including co-founder Barret Zoph and others returning to OpenAI, and another co-founder moving to Meta. This deal reflects the intense demand for large-scale compute resources in
energyAINvidiasemiconductorcomputeinvestmenttechnology-partnershipUS: SOLO micro-reactor plan advances with nuclear-grade graphite deal
Terra Innovatum Global has taken a significant step toward deploying its SOLO micro-modular nuclear reactor by securing its first procurement order for nuclear-grade graphite from Mersen. This material is critical for the reactor’s safety and thermal performance and represents a key “long-lead” component needed for the company’s First-of-a-Kind (FOAK) reactor planned for 2027. The agreement with Mersen, a global leader in isostatic graphite production, supports Terra Innovatum’s strategy to mitigate supply chain risks and establish a foundation for serial manufacturing of future reactors, aligning with rising global demand for low-carbon energy. The SOLO reactor, developed since 2018, emphasizes the use of off-the-shelf commercial components to reduce costs and supply uncertainties, and it is designed to support both LEU+ and HALEU fuel types. The U.S. Nuclear Regulatory Commission (NRC) has initiated the formal safety review process, expected to conclude by October 2026, keeping the project on
energynuclear-energymicro-reactornuclear-grade-graphitemodular-reactorlow-carbon-energyadvanced-materialsUS test accelerator fires first proton beams to power future colliders
US researchers at Fermilab have successfully accelerated and stored the first proton beams in the FAST/IOTA test accelerator, marking a significant advancement in particle accelerator R&D. The proton beams circulate in the IOTA ring at about 7% of the speed of light, enabling scientists to explore new methods for controlling and stabilizing high-intensity beams. This facility, combining a low-voltage proton source with a radio-frequency quadrupole accelerator, allows experiments without disrupting larger production accelerators, providing a flexible platform for testing innovative accelerator technologies. The achievement supports ongoing upgrades to Fermilab’s proton accelerator complex, including the PIP-II project, which aims to deliver higher-intensity beams for neutrino experiments such as the Deep Underground Neutrino Experiment. FAST/IOTA also pioneers the integration of artificial intelligence in accelerator design and operation, using detailed digital models to simulate machine behavior and train AI systems. These virtual accelerators help optimize performance and identify new configurations before physical testing, potentially transforming how particle accelerators
energyparticle-acceleratorproton-beamshigh-intensity-beamsaccelerator-physicsFermilabPIP-II-projectHyperscale Power is the latest startup to challenge 140-year-old transformer tech
The article discusses the emergence of Hyperscale Power, a startup developing advanced solid state transformers (SSTs) to replace the traditional iron-core transformers that have powered electrical grids and data centers for over 140 years. While iron-core transformers are reliable, their bulky size and limitations are becoming problematic as data center power demands surge, especially with the rise of AI workloads and renewable energy integration. Solid state transformers offer significant advantages, including reducing component counts, improving grid stability, and shrinking the physical footprint of power conversion equipment. Hyperscale Power claims its technology can operate at much higher frequencies than competitors, enabling even smaller and more efficient transformers suited for the increasing power densities in modern data centers. Hyperscale Power recently raised a €5 million seed round led by World Fund and Vsquared Ventures to build a prototype. Although the SST market has rapidly grown with over $330 million raised by competitors backed by major investors like ABB and Andreessen Horowitz, Hyperscale’s founders bring deep technical expertise,
energysolid-state-transformerpower-griddata-centersrenewable-energypower-conversionelectrical-engineeringThe Need For Global Growth Is A Billionaire's Lie — And It's Killing The Planet - CleanTechnica
The article from CleanTechnica critiques the prevailing global economic paradigm centered on continuous growth, arguing that this model is fundamentally incompatible with environmental sustainability. It highlights how the relentless pursuit of increasing gross domestic product (GDP) leads to extensive depletion of natural capital—ecosystems and resources treated as infinite despite their finiteness. This growth-driven approach results in significant environmental damage, including climate change, biodiversity loss, and pollution, while paradoxically relying on nature for essential raw materials and ecosystem services. The article points out the stark imbalance in investment, noting that for every dollar spent on protecting nature, thirty dollars are spent on activities that destroy it. The piece challenges the assumption that technological innovation alone can decouple economic growth from environmental harm, emphasizing that efficiency gains and commodification of natural resources have failed to prevent ecological degradation. It calls for major policy reforms, including the elimination of harmful subsidies and a shift toward scaling natural solutions that align economic benefits with planetary health. Public sentiment, including among many millionaires, supports
energysustainabilityenvironmental-impactnatural-resourcesclimate-changeeconomic-growthpollutionRussian microwave weapon tied to Havana Syndrome in new US reports
A covert US intelligence operation reportedly uncovered a small, portable Russian microwave weapon that may explain the mysterious "Havana Syndrome," a condition involving unexplained brain injuries affecting American diplomats, spies, and military personnel since 2016. Victims have experienced symptoms such as sudden head pressure, loud noises, dizziness, vision and hearing problems, balance issues, and cognitive impairments. The syndrome was first noted at the US Embassy in Havana, Cuba, and similar cases have since appeared worldwide, including in China, India, Europe, and Washington, D.C., with around 1,000 cases reported globally. In 2024, a joint investigation linked Havana Syndrome incidents to Russia’s military intelligence Unit 29155, suspected of using directed-energy devices against US personnel, though Moscow denied involvement and an NIH study found no clear brain injuries. The newly revealed weapon, acquired in a $15 million undercover operation by Department of Homeland Security agents from a Russian criminal network, emits pulsed microwaves capable of penetrating walls
energydirected-energy-weaponsmicrowave-technologymilitary-technologyintelligence-operationscovert-weaponsbrain-injury-researchHydrogen vs Batteries on Norway's Lofoten Route: An Engineering Reality Check - CleanTechnica
The article examines the challenges facing Norway's Vestfjord Lofoten hydrogen ferry project, particularly focusing on the durability of fuel cell technology supplied by PowerCell. Investigative reporting revealed internal tests suggesting fuel cell lifetimes around 3,000 hours, significantly lower than the 33,000 hours claimed in marketing materials. While this discrepancy is concerning, the article emphasizes that fuel cell durability must be viewed within the broader context of the entire hydrogen system, which includes hydrogen production, compression, storage, bunkering infrastructure, and operational procedures. Public data indicate that while fuel cells in light vehicles can achieve sufficient durability, heavy-duty applications like ferries and trucks currently lack proven long-term reliability, making the 3,000-hour figure a serious issue for commercial ferry propulsion. Beyond fuel cell longevity, the article highlights the limited real-world operational history of PowerCell’s marine fuel cells in demanding, continuous high-power settings. Although PowerCell partners with Bosch, whose licensed fuel cell designs have been deployed mainly in pilot projects
energyhydrogen-fuel-cellsclean-energymarine-propulsionrenewable-energyenergy-storagefuel-cell-durabilityForever chemicals used to extract 99% pure battery-grade lithium
Researchers at Rice University, led by James Tour and Yi Cheng, have developed an innovative method to extract 99% pure battery-grade lithium from high-salinity brine using spent perfluoroalkyl and polyfluoroalkyl substances (PFAS), commonly known as “forever chemicals.” These toxic compounds, which persist in the environment and contaminate water, are typically treated as hazardous waste after use in filtration. The team repurposed PFAS-saturated activated carbon, leveraging the fluorine locked within these molecules to bind with lithium ions in brine, forming lithium fluoride through a process called Flash Joule Heating. This technique rapidly heats the mixture to over 1,000°C, breaking strong carbon-fluorine bonds and freeing fluorine to react with lithium. To purify the lithium fluoride, the researchers applied a second heating stage at temperatures between 1,676°C and 2,260°C, vaporizing lithium fluoride while leaving heavier impurities behind. This flash distillation
energylithium-extractionbattery-materialsPFAS-recyclingflash-joule-heatingsustainable-mininglithium-ion-batteriesRolls-Royce, Equilibrion to study nuclear-powered jet fuel production
Rolls-Royce has partnered with UK-based Equilibrion to investigate the commercial-scale production of sustainable aviation fuels (SAF) using Rolls-Royce’s small modular reactors (SMRs). These SMRs provide low-cost, reliable, and carbon-free energy, which can support the energy-intensive process of producing SAF. Unlike electric aircraft, which face challenges due to the low energy density of batteries, SAF offers the same energy density as fossil fuels but with a significantly smaller carbon footprint. Equilibrion’s proprietary Eq.flight system uses electricity and heat from nuclear energy to produce SAF via a modular Power-To-Liquids (PtL) process, aiming to deliver a demonstration plant in the UK by the end of the decade. The aviation sector is a rapidly growing source of global emissions, yet SAF production currently meets less than one percent of global aviation fuel demand. The UK has mandated that 22 percent of aviation fuel must be sustainable by 2040, driving demand for low-cost, carbon-free
energynuclear-energysustainable-aviation-fuelsmall-modular-reactorsdecarbonizationrenewable-energypower-to-liquidsIn Alaska, a Data Center Inside a Power Plant, Inside a Microgrid - CleanTechnica
The article discusses Cordova, Alaska’s innovative integration of a data center within its existing microgrid-powered hydroelectric facility, highlighting a localized approach to both energy and data management. Cordova Electric Cooperative has long focused on sourcing energy locally through hydropower and battery storage, reducing reliance on diesel imports for its remote community of 2,600 residents. Building on this success, Cordova partnered with Greensparc and several national laboratories to pilot a modular edge data center directly inside the Humpback Creek hydroelectric plant. This setup leverages the plant’s cold mountain water for efficient server cooling and uses surplus hydropower that would otherwise go unused, aiming for a highly energy-efficient operation with a power usage effectiveness (PUE) close to 1. The project was supported by advanced modeling tools like the ARIES digital twin developed by the National Laboratory of the Rockies and other labs, which helped validate the microgrid’s ability to support the unique power demands of data centers. The pilot data center provides
energymicrogriddata-centerlocalized-energyhydropowerbattery-storageedge-computingDuke Merger Settlement Agreement Reached in South Carolina - CleanTechnica
A settlement agreement has been reached between Duke Energy and groups including the Sierra Club regarding Duke’s proposed merger of its South Carolina subsidiaries. A key element of the settlement is Duke Energy’s commitment to pursue at least 70 megawatts of new winter grid flexibility through demand response programs. The agreement also includes provisions to ensure accurate tracking of merger-related cost savings for customers over the next 14 years, with Duke’s shareholders responsible for covering any shortfall in the promised savings. This settlement follows a similar agreement reached earlier in North Carolina, paving the way for regulatory approval in both states. The Sierra Club emphasized its focus on consumer protections and affordability for South Carolina families and small businesses, advocating for investments in alternatives to costly and polluting energy resources. The group supports the Public Service Commission’s docket on large load tariffs, which could provide protections for residential and traditional business customers by ensuring that new data center energy costs are borne by tech companies rather than families. The Sierra Club’s involvement reflects its broader mission to promote
energyclean-energyDuke-Energygrid-flexibilitydemand-responseutility-mergerconsumer-protectionsBoosting Aviation Decarbonisation Through the Revision of the EU ETS - CleanTechnica
The article discusses the upcoming revision of the EU Emissions Trading System (ETS) in July 2026 as a critical opportunity to accelerate decarbonisation in European aviation. Currently, the EU ETS only covers flights within Europe, accounting for a limited portion of aviation emissions. Expanding the scope to include all flights departing from the EU would add approximately 80 million tonnes of CO₂ emissions to the scheme, compared to the current 64 million tonnes, and cover 67% more private jet emissions. This extension would significantly increase ETS revenues—from €3 billion in 2024 to an additional €7 billion—providing crucial funding to support the green transition in aviation. Germany, Poland, and Italy stand to benefit the most from this scope expansion. The article also highlights the need to reform the Sustainable Aviation Fuels (SAF) allowances mechanism. Currently, SAF allowances aim to incentivize airlines to use SAFs by partially bridging the cost gap with conventional kerosene but fall short in supporting
energyaviationdecarbonisationEU-ETSsustainable-aviation-fuelsclimate-policyemissions-trading-systemNew Nissan LEAF Wins Another Award — From Women This Time - CleanTechnica
The new Nissan LEAF has earned the prestigious 2026 Women’s Worldwide Car of the Year (WWCOTY) award, marking another accolade in its successful history. This award, decided by an international jury of 86 women automotive journalists from over 50 countries, recognizes the LEAF as the overall winner among 55 global contenders. The jury highlighted the vehicle’s balance of advanced electric performance, user-friendly design, safety, value, and environmental impact, emphasizing its realistic and accessible approach to electric mobility. Since its launch in 2010 as the world’s first mass-market electric vehicle, the Nissan LEAF has maintained affordability while significantly improving its range and capabilities. The 2026 LEAF S+ offers 303 miles of range at a base price of $29,990, nearly the same as its 2013 starting price of $28,800, and far surpassing the original 73-mile range. The WWCOTY jury praised the LEAF for being an
energyelectric-vehiclesNissan-LEAFelectric-mobilitysustainable-transportationclean-energyautomotive-technologyElectric air taxi maker Archer hits back at Joby in countersuit alleging concealed Chinese ties
Archer Aviation, an electric air taxi developer, has filed a countersuit against rival Joby Aviation, accusing Joby of defrauding the U.S. government and competitors by misrepresenting itself as an American-made company while relying on a Chinese manufacturing subsidiary. Archer alleges that Joby sourced critical components from Chinese suppliers supported by the Chinese government and concealed these ties by misclassifying Chinese-origin aircraft materials as consumer goods to evade U.S. tariffs and oversight. This countersuit follows a previous lawsuit filed by Joby in November, accusing a former employee of stealing trade secrets to benefit Archer. Both companies, which went public in 2021 via SPAC mergers, compete in the electric air taxi market and defense applications. Archer’s complaint highlights Joby’s receipt of substantial U.S. government funding, including Air Force contracts, and its role in advancing President Trump’s 2025 executive order aimed at accelerating electric vertical takeoff and landing (eVTOL) aircraft development. Recently, both companies
energyelectric-air-taxiaviation-technologymanufacturingtrade-secretsdefense-applicationsvertical-takeoff-and-landingUnlocking Hidden Capacity in the Grid With Advanced Conductors - CleanTechnica
The article from CleanTechnica discusses the growing challenge of meeting rising electricity demand amid electrification of transport, heating, and industry, alongside expanding data centers and industrial loads. Since building new transmission lines is a lengthy and complex process—often taking 10 to 15 years due to permitting, environmental reviews, and litigation—engineers are exploring how to maximize the capacity of existing transmission infrastructure. One promising solution is the use of advanced conductors, which enable existing transmission towers to carry significantly more electricity without the need for new corridors or towers. Traditional transmission lines use aluminum conductor steel reinforced (ACSR) wires, which balance conductivity, strength, and cost but have thermal and mechanical limitations that restrict current capacity. As current flows, conductors heat up, causing expansion and sag that must be kept within safety limits. Advanced conductors, often categorized as high temperature low sag (HTLS) conductors, overcome these constraints by using stronger cores and materials that tolerate higher temperatures (150°C or more) while
energyadvanced-conductorselectricity-transmissiongrid-capacityreconductoringpower-flow-controlthermal-ratingDemand Shifting in Hawaiʻi: The Other Half of the Energy Transition - CleanTechnica
The article "Demand Shifting in Hawaiʻi: The Other Half of the Energy Transition" from CleanTechnica examines the critical role of demand management in Oʻahu’s transition to a fully electrified, solar-dominated energy system. After removing non-civilian energy uses such as aviation fuel, maritime bunkering, and military consumption, the island’s energy demand for civilian purposes was significantly reduced through electrification of transportation, buildings, and industry. This transition lowered annual electricity demand to about 6,000 GWh, with an average load of roughly 685 MW. However, peak demand in the evenings can exceed 1,000 MW due to increased air conditioning use and electric vehicle (EV) charging, necessitating substantial generation and storage capacity that only operate during these peak periods. To address the mismatch between solar generation—peaking midday—and evening demand, demand management strategies like time-of-use pricing are essential. Hawaiian Electric already implements tariffs that incentivize electricity use during midday hours when solar output
energyenergy-transitiondemand-managementsolar-powerelectricity-gridrenewable-energyenergy-storageSamsung debuts first pouch solid-state battery prototype for humanoid robots
Samsung SDI has unveiled its first pouch-type all-solid-state battery prototype designed specifically for emerging physical AI systems such as humanoid robots. This battery will be showcased publicly for the first time at the InterBattery 2026 exhibition in Seoul. Unlike traditional lithium-ion batteries that use liquid electrolytes, Samsung’s solid-state battery replaces the liquid with solid materials, enhancing safety, energy density, and compactness. The pouch design caters to compact devices requiring lightweight components and flexible integration, addressing the unique power demands of robots that experience sudden spikes in energy consumption while maintaining reliability. Beyond robotics, Samsung SDI is also presenting advanced battery technologies aimed at AI infrastructure, including a high-power prismatic battery for uninterruptible power supply (UPS) systems in data centers. This U8A1 battery uses lithium manganese oxide chemistry to deliver improved safety, higher power output, and better space efficiency—about 33% more efficient than previous models—helping stabilize power during sudden AI computing demand spikes. Samsung SDI
robotenergysolid-state-batteryAI-infrastructurebattery-technologyhumanoid-robotsenergy-storage-systemsElectric air taxis are about to take flight in 26 states
The Federal Aviation Administration (FAA) has approved eight pilot programs enabling companies such as Archer Aviation, Beta Technologies, Joby Aviation, and Wisk to begin widespread testing of electric vertical takeoff and landing (eVTOL) aircraft across 26 states. This three-year initiative, called the Advanced Air Mobility and Electric Vertical Takeoff and Landing Integration Pilot Program, aims to position U.S. companies at the forefront of next-generation aircraft for personal travel, regional transportation, cargo logistics, and emergency medicine. Announced last year by President Donald Trump, the program allows these companies to test eVTOL aircraft without full regulatory certification, accelerating development timelines and potentially boosting investor confidence. The pilot program requires collaboration between companies and state, local, tribal, or territorial governments, covering diverse applications such as urban air taxis and regional flights. Notable partnerships include the Port Authority of New York and New Jersey working with multiple companies to test operations from a Manhattan heliport, and the Texas Department of Transportation collaborating on regional flights
energyelectric-aircrafteVTOLurban-air-taxisAdvanced-Air-MobilityFAA-pilot-programelectric-vertical-takeoff-and-landingWorld's first solid-state battery retains 97.7% charge after 10 days
Finnish startup Donut Lab has released the results of a third independent test conducted by the VTT Technical Research Centre of Finland, demonstrating that its solid-state “Donut Battery” retains 97.7% of its charge after being idle for 10 days. This finding addresses previous speculation that the battery might function like a supercapacitor, which typically loses charge rapidly when not in use. The test involved charging the battery to about 50% capacity, leaving it idle at room temperature for 240 hours, and then measuring the remaining charge, confirming the battery’s strong self-discharge performance and stability without any visible damage. The Donut Battery, designed for Verge Motorcycles’ TS Pro, offers a 370-mile range, five-minute charging, and an energy density of 400 Wh/kg, along with robust thermal stability demonstrated in earlier tests at elevated temperatures. Donut Lab’s CTO, Ville Piippo, emphasized that the battery behaves as expected for a solid-state battery, maintaining charge
energysolid-state-batterybattery-technologyelectric-vehiclesenergy-storagefast-chargingbattery-durabilityUS Farmers Need Green Ammonia, And China Has It
The article discusses the challenges faced by US farmers amid rising fuel and fertilizer costs exacerbated by geopolitical tensions and policy decisions under President Trump’s administration. While green ammonia—a sustainable fertilizer produced using renewable energy—offers a promising solution to reduce reliance on fossil fuels in agriculture, its adoption in the US has been hindered. Federal support for green hydrogen and ammonia initiatives, such as a $7 billion funding program and low-cost loans for on-site renewable energy installations, was curtailed, limiting farmers’ ability to produce green ammonia locally. In contrast, China has advanced rapidly in green hydrogen and green ammonia production, leveraging abundant renewable resources, particularly in Inner Mongolia, to establish a robust green ammonia industry. The article suggests that US farmers could benefit from forming cooperatives to develop local green ammonia production, which aligns with traditional shared agricultural infrastructure practices. However, without renewed federal support and policy shifts, US agriculture risks falling behind in sustainable fertilizer innovation, while China gains a competitive edge in this emerging sector.
energygreen-ammoniasustainable-agriculturehydrogen-productionrenewable-energyfertilizer-innovationclean-energy-technologyAre Gas Prices Going Up? - CleanTechnica
The article from CleanTechnica explores recent trends in U.S. gasoline prices, prompted by a meme highlighting how electric vehicle (EV) owners avoid the impact of rising gas costs. The author, an experienced EV user, initially questioned whether gas prices were indeed increasing significantly. Upon checking, they found that the average price of regular gasoline in the U.S. had risen sharply—by nearly 60 cents or about 20.4%—within a short period, reaching around $2.89 per gallon according to AAA data. This spike represents a substantial increase over just one week, raising concerns about whether prices will continue to climb, stabilize at higher levels, or potentially fall again. The article suggests that rising gas prices provide a compelling incentive for drivers of gasoline vehicles to consider switching to electric cars. It notes that the EV market has matured, with a growing and diverse used EV market making electric vehicles more accessible and affordable than before. Beyond cost savings, the author emphasizes that EVs often offer greater
energyelectric-vehiclesgas-pricesclean-energytransportationsustainabilityEV-marketSlate Auto changes CEO months ahead of affordable EV launch
Slate Auto, an electric vehicle startup backed by Jeff Bezos, has appointed Peter Faricy as its new CEO just months before launching its affordable electric truck. Faricy, formerly an Amazon Marketplace VP and advisor at McKinsey and Bessemer Venture Partners, began his role recently, replacing Christine Barman, Slate’s first CEO and a longtime Chrysler veteran. Barman, who had been the public face of the company since it emerged from stealth in April 2025, has transitioned to President of Vehicles, focusing on delivering the truck on time and within budget. The company, which has raised around $700 million from Bezos and other investors, initially aimed to price its electric truck under $20,000 but now targets a starting price in the mid-$20,000 range, partly due to changes in federal EV tax credits. Slate has a refundable preorder list of about 160,000 potential buyers, which it is preparing to convert into actual orders. The leadership change highlights the startup’s strong ties to
energyelectric-vehiclesEV-startupSlate-Autoaffordable-electric-truckvehicle-manufacturingelectric-mobilityIran Was Facing "Water Bankruptcy" Before The Bombs Began Falling - CleanTechnica
The article from CleanTechnica highlights that Iran’s most pressing existential crisis is its rapidly approaching "water bankruptcy," a situation worsened more by decades of mismanagement than by international sanctions or recent military conflicts. Historically, Iran relied on an ancient water management system called qanats—underground tunnels that transported groundwater over long distances using gravity without the need for pumping. These qanats, some over 2,500 years old and totaling more than 250,000 miles, were resilient to natural and man-made disasters and provided a stable water supply with minimal variation. However, in the 20th century, Iran shifted away from this sustainable system, favoring modern approaches like dam construction and extensive groundwater pumping, which ultimately depleted underground water reserves and neglected the qanats. The consequences of these changes have been severe. A prolonged drought in northern Iran, including Tehran, has intensified water scarcity to the point where the government is considering relocating millions of residents. Experts attribute the crisis not solely to climate change but to
energywater-managementsustainable-infrastructureclimate-changegroundwaterdroughtenvironmental-planningProfiting From Subsidies While Proliferating Trump’s Protectionism - CleanTechnica
The article from CleanTechnica highlights the complex interplay between subsidies, corporate profits, and protectionist trade policies in the U.S. solar industry, focusing particularly on First Solar. In 2025, First Solar reported a net profit of $1.53 billion on $5.2 billion in net sales, but a significant portion of this revenue—$1.6 billion—came from transferable 45X tax credits, which are subsidies that can be sold to other companies. These credits, alongside other subsidies like the 48E tax credit for commercial solar installations, substantially bolster First Solar’s profitability. The article emphasizes that these tax credits are not mere tax cuts but substantial government subsidies that inflate reported sales and margins. First Solar has historically depended on various federal, state, and local subsidies, which continue to support its operations. Simultaneously, the article discusses the Trump administration’s protectionist measures targeting solar panel imports from countries like India, Indonesia, and Laos, imposing steep countervailing duties
energyrenewable-energysolar-powersubsidiestax-creditssolar-manufacturingtrade-protectionismHow To Escape The Trump Pump On An E-Bike - CleanTechnica
The article "How To Escape The Trump Pump On An E-Bike" from CleanTechnica addresses the current high gasoline prices in the U.S., exacerbated by geopolitical tensions such as the conflict in Iran reducing global oil supply. It critiques Republican promises of cheap fuel, highlighting how these have failed to materialize, leaving American families burdened by expensive gas costs. The author coins this surge in fuel prices the “Trump Pump” and emphasizes that many people, especially those in multi-vehicle households or without access to home charging, feel trapped by rising costs and limited alternatives. As a practical solution, the article advocates for the adoption of electric bicycles (e-bikes) as an affordable and effective way to reduce dependence on gas-powered vehicles. E-bikes offer a dramatically lower cost per mile—about one cent compared to over ten cents per mile for a typical small car—along with reduced maintenance expenses. For many, e-bikes can replace some or all car trips, generating significant annual savings and
energyelectric-bikee-biketransportationfuel-costsrenewable-energyenergy-savingsOver 400 Tesla Fast Chargers Planned For New Charging Hub - CleanTechnica
Tesla is planning a major expansion of its Supercharger network with the development of a new fast charging hub in Yermo, California, featuring over 400 V4 stalls capable of charging at up to 500 kW. This large-scale project, known as Eddie World 2, will be built in six phases, with construction on the first phase expected to begin this year. The hub will likely include solar-powered canopies, continuing Tesla’s trend of integrating renewable energy into its charging infrastructure. Yermo’s location near major travel routes between Southern California and Las Vegas makes it a strategic site to support the growing number of electric vehicle (EV) drivers traveling this popular corridor. The expansion reflects broader trends in the EV market, where despite the reduction of federal incentives in the U.S., state-level support and ongoing infrastructure growth continue to drive adoption. The article highlights the resilience of the clean energy movement amid political challenges, suggesting that upcoming elections could influence the future balance of power and support for sustainable technologies. Overall
energyelectric-vehiclesTesla-SuperchargerEV-charging-hubsolar-powerclean-energysustainable-transportationSandberg, Clegg join Nscale board as this ‘Stargate Norway’ startup hits $14.6B valuation
Nscale, a Norway-based AI infrastructure startup, has reached a $14.6 billion valuation following a major funding round described as the largest in European history. This round, backed by prominent investors including Blue Owl, Dell, Nvidia, Nokia, Goldman Sachs, and JPMorgan, supports Nscale’s vertically integrated approach spanning energy, data centers, compute, and orchestration software. The company plans to leverage this capital to accelerate AI infrastructure development across Europe, North America, and Asia, expand its engineering and operations teams, and enhance its platform. Nscale also raised debt financing secured by GPUs to support its cluster deployments in Europe. The startup’s board has been strengthened with high-profile additions such as former Meta COO Sheryl Sandberg, former Yahoo president Susan Decker, and former UK deputy prime minister Nick Clegg. Nscale is closely associated with the “Stargate Norway” project, an ambitious AI infrastructure initiative involving OpenAI and led by Aker’s joint venture, which is now fully
energydata-centersAI-infrastructurerenewable-energywaste-heat-reusecloud-computingvertical-integrationRTX's hybrid-electric plane inches closer to fuel-efficient aviation
RTX has achieved a significant milestone in its hybrid-electric propulsion project by successfully operating its engine and battery system at full power for the first time. The company aims to improve fuel efficiency by 30 percent compared to current advanced regional turboprops through its Hybrid-Electric Flight Demonstrator. This system combines a Pratt & Whitney Canada thermal engine, a 1-megawatt electric motor from Collins Aerospace, and a 200-kilowatt-hour battery from Swiss startup H55. The hybrid setup uses the thermal engine for cruise phases while the electric motor assists during taxi, takeoff, and climb, drawing power from the batteries. RTX plans to install this system on a modified De Havilland Canada Dash 8-100 for flight testing. The project addresses key challenges such as battery weight and high-voltage management by employing advanced materials, wide band-gap semiconductors, and high-density magnets to maximize power density while minimizing weight. High-voltage operation, which surpasses current aviation standards, poses risks
energyhybrid-electric-propulsionaviation-technologybattery-systemsfuel-efficiencyelectric-motorshigh-voltage-managementUS considers special forces mission to seize Iran's uranium stockpile
US military planners are considering a high-risk special forces operation to seize Iran’s near weapons-grade uranium stockpile amid growing uncertainty about its location. The stockpile, approximately 441 kilograms stored near Isfahan before last year’s conflict between Israel and Iran, has not been verified by international inspectors for nearly nine months following airstrikes on key nuclear sites. This lack of access has raised concerns that the uranium may have been moved or hidden, complicating efforts to monitor Iran’s nuclear capabilities. President Donald Trump acknowledged the possibility of future action to secure the material but indicated such a mission would only occur under specific conditions. Contingency plans under discussion include deploying special forces to either dilute the uranium on-site, rendering it unusable for weapons, or physically removing the material from Iran. The stockpile is estimated to fit into about 16 metal cylinders, each weighing roughly 25 kilograms, making it potentially transportable by vehicle or even by hand. The US and Israeli officials are actively searching for the missing
energyuraniumnuclear-materialsspecial-forcesnuclear-securityIran-uranium-stockpilenuclear-weapons-materialsA Better Way To Compare Gas & Electric Prices - CleanTechnica
The article from CleanTechnica addresses the challenge of comparing gasoline and electric vehicle (EV) fueling costs, noting that traditional metrics like MPGe (miles per gallon equivalent) are technically accurate but not user-friendly for everyday budgeting. Instead, the author proposes a new metric called the “Fair eGallon,” which translates electricity costs into a gasoline-equivalent price based on the actual work done to move a vehicle the same distance. This approach accounts for the real-world efficiencies of internal combustion engines (about 20%) and electric motors (about 80%), including factors like regenerative braking limitations at highway speeds. By dividing the energy content of a gallon of gasoline (33.7 kWh) by four, the Fair eGallon is defined as 8.4 kWh of electricity, allowing consumers to multiply their electricity rate by 8.4 to get a comparable gas price. Using this method with 2026 U.S. averages, the article finds that home charging at $0.18
energyelectric-vehiclesEV-chargingenergy-efficiencygasoline-comparisonrenewable-energytransportation-energy‘Distributed energy resources’ like EVs and heat pumps could reduce 10% of peak electricity demand in B.C.: study - Clean Energy Canada
A recent study by Dunsky Energy + Climate Advisors, commissioned by Clean Energy Canada, highlights the significant potential of distributed energy resources (DERs) such as electric vehicles (EVs), heat pumps, and efficient water heaters to reduce peak electricity demand in British Columbia (B.C.) by over 10% by 2040. DERs are customer-connected technologies capable of generating, storing, or flexibly managing energy demand, and when coordinated by utilities, they form “virtual power plants” (VPPs) that offer a cost-effective alternative to traditional infrastructure expansion. The study emphasizes that prioritizing DERs can help B.C. meet rising electricity demand driven by electrification while supporting decarbonization goals and saving ratepayers money. The report examines three scenarios: a reference case aligned with BC Hydro’s current plans, an accelerated electrification scenario, and a DER-centric scenario combining rapid electrification with expanded DER programs. Even under the reference scenario, DERs could reduce peak load by
energydistributed-energy-resourceselectric-vehiclesheat-pumpsgrid-reliabilityvehicle-to-griddecarbonizationIs BYD's Flash Charging Revolutionary? - CleanTechnica
The article from CleanTechnica discusses BYD's new flash charging technology for electric vehicles (EVs), highlighting its potential to significantly reduce charging times to as little as 3 to 9 minutes. This breakthrough addresses one of the primary consumer concerns about EV adoption: the lengthy charging process. The author notes that while fast charging has steadily improved over the past decade, BYD’s advancement could be considered revolutionary because it effectively eliminates charging time as a barrier to EV ownership, making EVs more practical and appealing to a broader audience. Beyond just charging speed, the article emphasizes how this innovation could alleviate the widespread anxiety about range and charging availability, which often deters potential buyers despite many EVs already offering substantial driving ranges. The ability to recharge quickly also enhances the viability of EVs in commercial applications such as taxis and robotaxis, where maximizing vehicle utilization and revenue is critical. The author argues that with such rapid charging capabilities, the rationale for choosing gasoline or plug-in hybrid vehicles becomes increasingly weak, especially
energyelectric-vehiclesfast-chargingBYDEV-technologyclean-energybattery-technologyUK firm's 98% efficient hybrid motor delivers record performance
Horse Powertrain, a London-based company, has developed a new hybrid transmission motor called the Amorphous Motor, which achieves an industry-leading efficiency of 98.2%. This high efficiency is made possible by using amorphous steel—a steel alloy with a disordered atomic structure that offers superior magnetic permeability and significantly lower core losses compared to conventional crystalline electrical steels. The motor’s stator is constructed from ultra-thin amorphous steel laminations just 0.025mm thick, about one-tenth the thickness of traditional motor steel layers, reducing losses due to eddy currents and hysteresis by 50%. The Amorphous Motor delivers a maximum power output of 140kW at 360Nm and contributes to a 1% reduction in whole-vehicle fuel consumption when integrated into hybrid powertrains. This efficiency gain supports automotive OEMs in producing low-emission vehicles, including range-extended EVs, hybrids, and plug-in hybrids, advancing the industry’s decarbon
energyhybrid-motoramorphous-steelelectric-vehicleshigh-efficiencyautomotive-technologypowertrain-innovationSpring Forward, Fall Back. Are Time Changes Bad For Your Health? - CleanTechnica
The article from CleanTechnica explores the history and health implications of Daylight Saving Time (DST), a practice of adjusting clocks forward in spring and back in fall to better align waking hours with daylight. DST has roots dating back to ancient Rome and was formally proposed in the late 19th and early 20th centuries, with various countries adopting it at different times, notably during wartime and after the 1970s energy crisis. Contrary to popular belief, farmers opposed DST because their schedules depend on natural sunlight rather than clocks. The U.S. first implemented DST during World War I and II. Regarding health, the article highlights research indicating that the abrupt one-hour time change disrupts human circadian rhythms—internal biological clocks that regulate bodily functions according to light and dark cycles. Martin Young from the University of Alabama at Birmingham notes that the spring shift forward is linked to a 10-24% increase in heart attack risk shortly after the change, as well as more traffic accidents and strokes.
energydaylight-saving-timecircadian-rhythmshealth-impacttime-change-effectsenergy-crisisbiological-clocksSteering Electricity: How Grid Control Devices Unlock Transmission Capacity - CleanTechnica
The article from CleanTechnica discusses the critical role of grid-enhancing technologies, particularly Flexible AC Transmission Systems (FACTS) and Advanced Power Flow Control devices, in optimizing existing electricity transmission infrastructure. As electrification increases demand and renewable generation shifts geographically—often far from urban centers—the expansion of new transmission lines has slowed due to lengthy permitting and environmental review processes. Consequently, transmission capacity, rather than generation capacity, has become a key bottleneck in many regions. These technologies enable grid operators to more effectively manage power flows on existing lines, overcoming the physical and regulatory challenges of building new corridors. A fundamental limitation in alternating current (AC) transmission networks is that electricity flows according to the impedance of lines rather than operator commands, causing uneven distribution of power that can overload certain lines while others remain underutilized. FACTS devices, which emerged commercially in the late 20th century, use power electronics to control voltage, reactive power, and line impedance, allowing operators to steer electricity flows more precisely. This
energypower-transmissiongrid-controlflexible-AC-transmission-systemsrenewable-energy-integrationelectricity-infrastructureadvanced-power-flow-controlBiomethane for Oʻahu: A Small Reserve With a Big Reliability Role - CleanTechnica
The article from CleanTechnica examines the role of biomethane as a strategic reliability resource for Oʻahu’s renewable electricity system. Following a comprehensive energy analysis that excludes overseas aviation, maritime bunkering, and military use, and assumes full electrification of transportation, buildings, and industry, Oʻahu’s civilian electricity demand is projected to be about 6,000 GWh annually. Solar energy and batteries are expected to supply most of this demand, with batteries shifting solar generation to evening hours. However, even with these technologies, the grid requires a small amount of firm capacity to cover rare periods of low renewable output due to weather or equipment outages. Biomethane, produced from organic waste through anaerobic digestion or landfill gas capture, is identified as a suitable fuel for this strategic reserve because it provides dispatchable combustion-based power without adding new fossil carbon emissions. Oʻahu’s biomethane feedstock potential is limited but significant, primarily coming from sewage sludge at several wastewater treatment plants and methane
energyrenewable-energybiomethaneelectricity-gridenergy-storageanaerobic-digestionsustainable-energyOwner of ICE detention facility sees big opportunity in AI man camps
The article discusses the growing use of temporary worker housing known as "man camps" to accommodate the large influx of laborers needed for constructing AI data centers in the U.S. A notable example is in Dickens County, Texas, where a former Bitcoin mining facility is being converted into a massive 1.6 gigawatt data center. Workers there live in gray housing units equipped with amenities such as a gym, laundromat, game rooms, and an on-demand steak cafeteria. Target Hospitality, a company specializing in such accommodations, has secured contracts worth $132 million to build and manage this camp, which could eventually house over 1,000 workers. The company views the data center construction boom as its most significant growth opportunity to date. Additionally, the article briefly references Target Hospitality’s involvement in operating a detention center in Texas for families held by Immigration and Customs Enforcement (ICE). This facility has faced legal scrutiny over poor conditions, including allegations of worm-infested and moldy food and inadequate accommodations for
energydata-centersAI-infrastructuretemporary-housingBitcoin-miningworkforce-accommodationconstructionEvolution of Travel Over the Last 100 Years: + An Adventure in France in 2026 - CleanTechnica
The article contrasts the evolution of long-distance travel over the past century through a personal narrative spanning from 1927 to 2026. In 1927, the author's father traveled from Utah to East Germany using a combination of coal-powered steam trains, Great Lakes steamers, and transatlantic ships, taking about 20 days to complete the journey. This multi-modal, time-intensive travel reflected the technology and infrastructure of the early 20th century. In contrast, the author's 2026 trip from Utah to central France involved a 10-hour nonstop flight on a modern twin-engine Airbus 330-200, followed by a 4.5-hour drive on France’s extensive toll highway system, totaling approximately 18 hours of travel time. The flight utilized efficient polar great circle routes, highlighting advances in aviation technology and route optimization. The article also explores contemporary travel experiences in rural France, including renting electric bikes to explore former railway lines repurposed as bike trails, illustrating shifts in transportation modes and
energyelectric-biketransportation-technologysustainable-travelfuel-efficiencyrenewable-energyelectric-vehiclesA Positive Strata Title EV Charger Story! - CleanTechnica
The article from CleanTechnica shares a positive case study about installing electric vehicle (EV) charging infrastructure in a strata title (condominium) building called The Botanica in Melbourne, Australia. Gary Buck, Chairman of the building’s Owner Corporation (OC), led the initiative to prepare the 60-apartment, 100-car bay building for future EV demand despite no immediate requests in 2022. The OC surveyed residents, finding about 20% expected to own an EV within two years, while 50% said they would never buy one. Concerns centered on who would pay for charging and potential fire risks. Gary successfully addressed these fears by clarifying that electricity costs would be billed to EV owners, not subsidized by others. The OC engaged Jetcharge to explore options and consulted the building’s insurer and real estate agents. The insurer surprisingly indicated that installing a compliant EV charging system could reduce fire risk, as it would prevent unsafe charging practices like extension cords or overloaded power boards. Real
energyelectric-vehicle-chargingEV-infrastructurestrata-titlesustainable-energybuilding-managementelectric-vehiclesBYD’s 1.5 MW “Flash” Charging Wasn’t A Gimmick. The Battery Chemistry Behind It Could Change The Industry. - CleanTechnica
The article highlights BYD’s breakthrough 1.5-megawatt “Flash” Charging system, emphasizing that its significance goes beyond just delivering extremely high peak power. Central to this innovation is BYD’s second-generation Blade Battery architecture, which allows compatible electric vehicles (EVs) to charge from 10% to 70% in five minutes and reach 97% in just nine minutes without the typical thermal throttling seen in conventional EV batteries. This flat, sustained charging curve is made possible by a fundamental redesign of battery cells and chemistry focused on rapid power input and thermal management. This advancement could revolutionize EV design by enabling smaller battery packs—around 50 to 60 kWh—for passenger cars and SUVs while still providing a gas-like refueling experience. Drivers could add roughly 200 miles of range in the time it takes to fill a gas tank, removing the need for large, heavy, and costly batteries. This shift could lower costs, reduce vehicle weight, and increase production capacity
energybattery-technologyelectric-vehiclesfast-charginglithium-ion-batteriesEV-infrastructureBYD-Flash-ChargingVolkswagen Group Reaches 4 Million EV Sales - CleanTechnica
Volkswagen Group has reached a significant milestone of 4 million cumulative battery electric vehicle (BEV) deliveries, positioning itself as the top European automaker in electric vehicle sales. While this achievement is notable, it falls short of the company’s more ambitious plans from a few years ago. The Group ranks 5th globally in fully electric vehicle sales and holds a 7% share of the global plugin vehicle market, trailing behind leaders such as BYD Group, Tesla, Geely, and SAIC. Volkswagen Group’s EV journey began with early models like the VW e-Up! (2013) and VW e-Golf (2014), but the real acceleration came with the introduction of the Modular Electric Drive Matrix (MEB), which underpins about 3 million of the 4 million EVs sold. The Group has aggressively expanded its electric portfolio, launching around 60 new models in the past two years, with roughly one-third being all-electric. Currently, Volkswagen Group offers over 30
energyelectric-vehiclesVolkswagenbattery-technologyelectric-mobilityautomotive-industryclean-energyDistrict Cooling From the Pacific: A Targeted Efficiency for Oʻahu - CleanTechnica
The article "District Cooling From the Pacific: A Targeted Efficiency for Oʻahu" discusses the potential of seawater air conditioning (SWAC) as an energy-efficient cooling solution within Oʻahu’s fully electrified energy system. Oʻahu’s energy framework excludes overseas aviation, maritime bunkering, and military consumption, focusing instead on electrified ground transportation, interisland aviation, and local marine transport, with fossil fuel heating replaced by electric technologies. This transition reduces overall energy demand to about 6,000 GWh per year, which serves as a baseline for evaluating energy efficiency measures and renewable resources on the island. Space cooling emerges as one of the largest electricity consumers in Oʻahu, driven by its tropical climate and dense commercial and residential buildings. Commercial HVAC systems alone consume approximately 2,190 GWh annually on the island, primarily for cooling rather than heating. Residential cooling adds an estimated 250 to 450 GWh per year, leading to a total cooling demand around
energyrenewable-energydistrict-coolingHVACelectrificationenergy-efficiencyOahuTesla Sales in Germany Actually Still Down Enormously - CleanTechnica
The article from CleanTechnica examines recent Tesla sales figures in Germany, highlighting that despite some reports of rising sales, Tesla’s overall performance in the German electric vehicle (EV) market remains significantly down compared to two years ago. While Tesla sold 2,276 vehicles in February 2026, up from 1,429 in February 2025, this is still a 62% decrease from the 6,038 units sold in February 2024. The article notes that the German battery electric vehicle (BEV) market grew by 29% year-over-year in February, making Tesla’s decline more pronounced given the market’s expansion. The temporary pause in Model Y production in early 2025, due to a production line update, partly explains the low sales in February 2025, but the broader trend remains a steep decline. When combining January and February sales data, Tesla’s sales dropped from 9,190 units in 2024 to 3,577 units in
energyelectric-vehiclesTeslaautomotive-industryclean-technologyrenewable-energybattery-technologyThe US Offshore Wind Industry Gets An Assist From Singapore
The US offshore wind industry has faced challenges due to the Jones Act, a century-old law requiring commercial vessels operating between US ports to be US-built, owned, and crewed. This law has complicated the deployment of specialized service operational vessels (SOVs) needed for installing large offshore wind turbines, as the US shipbuilding industry has lagged in producing Jones-compliant vessels. To work around this, developers have used a shuttle model where a main construction vessel remains offshore while Jones-compliant feeder vessels transport supplies and personnel. A significant development in overcoming these challenges is the commissioning of a specialized wind turbine installation vessel (WTIV) built in Singapore by Seatrium for Maersk Offshore Wind. This vessel, designed with advanced features to improve operational efficiency and extend weather windows, is set to install 54 turbines at the Empire Wind project off New York. Despite political interruptions, including halts ordered by former President Trump and legal battles, the vessel passed final tests in Singapore and is expected to arrive
energyoffshore-windwind-turbinesrenewable-energyshipbuildingJones-ActMaersk-Offshore-WindIt's Time For An Authentic Golden Age Of Agriculture - CleanTechnica
The article from CleanTechnica calls for a new, authentic "Golden Age of Agriculture," contrasting it with both the late 19th-century era of sustainable small-scale farming and the current industrial agricultural model. Historically, small farmers maintained soil fertility through crop rotation and local resource use, fostering resilient ecosystems. However, since the mid-20th century, agriculture has shifted toward industrialization, characterized by mechanization, synthetic fertilizers, pesticides, and large-scale monocultures. While this increased yields, it has also caused significant environmental degradation, including nutrient runoff, greenhouse gas emissions, habitat destruction, pesticide pollution, and loss of biodiversity. The article highlights that industrial agriculture costs the environment about $3 trillion annually and often prioritizes animal feed, biofuels, and processed food ingredients over direct food production. The article emphasizes the urgent need to transition away from chemical-intensive, industrial farming toward localized, sustainable food systems that protect natural resources and human health. It notes that smallholder farms, which make up
energyagriculturesustainabilityenvironmental-impactcrop-geneticsfarm-mechanizationindustrial-farmingChina's BYD EV catches fire as driver narrowly escapes burning cabin
A BYD Seal electric sedan caught fire on Hong Kong’s Tuen Mun Road, causing traffic disruption. Preliminary investigations at a BYD service center revealed that the fire was not caused by the vehicle itself but by an external power bank left on the passenger seat, which likely experienced a short circuit or thermal runaway, igniting cabin materials. Despite extensive damage to the upper cabin, BYD confirmed that the core propulsion and electrical systems, including its Blade Battery, remained intact and were not responsible for the incident. The BYD Seal’s battery pack, based on lithium iron phosphate (LFP) chemistry, demonstrated significant thermal resilience during the fire. Unlike conventional nickel-manganese-cobalt batteries that can enter thermal runaway at around 390°F, LFP batteries typically withstand temperatures above 930°F without failure. The battery’s structural design, featuring a honeycomb-style layout integrated into the chassis (Cell-to-Body construction), enhances safety by acting as a load-bearing component and providing robust protection against heat and
energyelectric-vehicleslithium-iron-phosphate-batterybattery-safetythermal-runawayBYD-Blade-Batteryelectric-car-fireDonald Trump: America’s Greatest EV Salesman - CleanTechnica
The article from CleanTechnica draws a parallel between past panic buying of guns during the Obama administration and the current surge in electric vehicle (EV) purchases under the Trump administration. It explains that while the former was driven by fears of impending gun control laws, the latter is fueled by a real and sustained crisis in gasoline prices. With global oil prices projected to soar—potentially reaching $150 a barrel—due to geopolitical instability and the Trump administration’s foreign policies, Americans are facing sharply rising fuel costs that make traditional internal combustion engine (ICE) vehicles increasingly unaffordable to operate. Despite the Trump administration’s rollback of EV tax credits and subsidies, consumers rushed to buy EVs before these incentives expired, and now continue to purchase them as a financial hedge against volatile gas prices. Unlike the speculative panic buying of ammunition, EV ownership offers a practical solution: stable and predictable energy costs through electricity, which can be further stabilized with solar panels or time-of-use utility rates. The article concludes that while Trump
energyelectric-vehiclesEV-salesenergy-crisisoil-pricessustainable-transportationclean-energy"Energy Security" Makes Us Less Secure. Renewables Are The Answer - CleanTechnica
The article from CleanTechnica argues that the conventional notion of "energy security," heavily reliant on fossil fuels, paradoxically makes countries less secure due to hidden and substantial costs. Andrew Dessler, an atmospheric sciences professor, highlights that while debates often focus on visible costs like fuel prices or electricity bills, they overlook the extensive hidden subsidies fossil fuels receive. These include not only direct financial subsidies but also indirect costs embedded in healthcare, climate change impacts, and especially national security. The U.S. spends over $81 billion annually—about one-fifth of the Department of Defense base budget—to protect critical oil supply routes such as the Strait of Hormuz, costs that are not reflected at the pump but effectively subsidize oil consumption. This defense spending, combined with the economic vulnerabilities caused by global oil price fluctuations, means fossil fuels are far more expensive than they appear. Dessler emphasizes that fossil fuels’ global pricing makes countries economically vulnerable to supply disruptions, as seen recently when U.S. and Israeli strikes on
energyrenewable-energyfossil-fuelsenergy-securityclimate-changesubsidiesnational-securityUS Battery Makers Gave Up Way Too Soon On EV Sales
The article discusses the premature expiration of the $7,500 federal tax credit for electric vehicles (EVs) in the U.S. last September and its significant negative impact on domestic EV sales. While industry observers initially expected a sharp decline, a subsequent geopolitical conflict initiated by President Trump against Iran caused a spike in gas prices, which could have motivated more EV purchases. However, U.S. automakers and battery manufacturers had already scaled back their electrification plans, dampening potential growth. Global EV sales data for January 2026 showed a 6% year-over-year decline, primarily due to the U.S. and China rolling back EV incentives, whereas EV sales excluding these markets actually rose by 36%. The article highlights that the U.S. political landscape, with Trump’s re-election and a Republican-controlled Congress, led to the tax credit’s expiration being set for September 30, 2025, disrupting long-term industry plans. Automakers like Ford and GM have adjusted production downward, and
energyelectric-vehiclesbattery-manufacturingEV-salesfederal-tax-creditclean-energyautomotive-industryGermany’s Hydrogen Refueling Network Looks Impressive Until You Do The Math - CleanTechnica
The article critically examines Germany’s hydrogen refueling network, highlighting a common misconception created by aggregate metrics. While charts show a steady increase in hydrogen dispensed—from near zero in 2017 to about 59 tons per month in early 2026—this total volume figure is misleading when assessing the network’s viability. The key metric for infrastructure success is utilization per station, not total output. With roughly 72 stations in operation, the average hydrogen dispensed per station is about 30 kilograms per day, enough to fuel only 7 to 10 hydrogen vehicles daily. This is significantly lower than conventional gasoline stations, which typically serve 200 to 300 vehicles per day. H2 Mobility, the consortium behind the network, was formed in 2015 by industrial gas companies, oil majors, and vehicle manufacturers aiming to solve the chicken-and-egg problem of hydrogen vehicle adoption and fueling infrastructure. However, the network was built far ahead of actual demand, with fewer than 2,000 hydrogen passenger
energyhydrogen-fuelhydrogen-refueling-stationsclean-energy-infrastructurefuel-cell-vehiclessustainable-transportationenergy-transitionOpenAI, Oracle abandon 2 GW AI data center expansion in Texas
OpenAI and Oracle have decided to abandon their planned expansion of the Abilene, Texas AI data center from 1.2 gigawatts to 2 gigawatts, according to Bloomberg. This move follows prolonged financing negotiations and changing infrastructure demands for AI development. The Abilene site is part of the Stargate initiative, a large-scale joint venture involving OpenAI, Oracle, and SoftBank aimed at building advanced AI computing infrastructure. Despite halting the expansion, construction continues at the existing facility, and both companies remain committed to operating within the Stargate project, which still represents one of the most ambitious AI infrastructure efforts in the U.S. The decision to pause the expansion was influenced by financing challenges and shifting demand forecasts, prompting OpenAI to reassess its near-term infrastructure needs. Meanwhile, Meta Platforms is reportedly exploring leasing the additional capacity originally planned for the Abilene site. NVIDIA, a key supplier of AI processors, played a role in directing Meta toward this opportunity, emphasizing the
energydata-centerAI-infrastructureOpenAIOracleNVIDIAMeta-PlatformsGlobal warming nearly twice as fast in past decade, new climate study finds
A recent study by the Potsdam Institute for Climate Impact Research (PIK) reveals that global warming has nearly doubled in pace over the past decade compared to previous decades. Analyzing multiple global temperature datasets—including those from NASA, NOAA, HadCRUT, Berkeley Earth, and ERA5—the researchers found that the planet has warmed by approximately 0.35°C per decade since 2015, compared to just under 0.2°C per decade between 1970 and 2015. By filtering out natural climate variability factors such as El Niño, volcanic eruptions, and solar activity, the study highlights a clear and statistically significant acceleration in warming beginning around 2013-2015, with over 98% statistical certainty. The study also examined the exceptionally warm years of 2023 and 2024, confirming they remain the hottest on record even after adjusting for natural influences. Using two statistical models, the researchers identified a distinct shift in the warming rate in the early 2010
energyclimate-changeglobal-warmingtemperature-trendsclimate-scienceenvironmental-researchclimate-data-analysisLife EV officially owns Rad Power Bikes now
Life Electric Vehicles Holdings (Life EV) has officially acquired Rad Power Bikes, including its intellectual property, inventory, and certain operating assets. The acquisition follows Rad Power Bikes' bankruptcy filing after months of financial struggles despite raising nearly $330 million in venture capital. Life EV purchased Rad Power in December and plans to maintain the brand’s retail operations in the United States while expanding its presence in select key markets. Life EV, based in Florida, specializes in acquiring and scaling electric bicycle and micro-mobility brands. Besides Rad Power Bikes, it holds an equity stake in LEV Manufacturing, which owns the Serial 1 premium electric bicycle brand originally developed by Harley-Davidson. Life EV emphasized that the acquisition aligns with its broader North American expansion strategy and committed to supporting existing Rad Power customers regarding warranties and gift cards.
energyelectric-bikesmicro-mobilityLife-EVRad-Power-Bikeselectric-vehiclestransportation-technologyIAA Will Ensure Most EVs Sold in Europe Will Have Batteries Made in the EU, but Loopholes Threaten Its Impact - CleanTechnica
The proposed EU Industrial Accelerator Act (IAA) aims to ensure that by 2027, nearly two-thirds of electric vehicles (EVs) sold in Europe will have batteries produced within the EU. The legislation sets local content rules requiring EV batteries to include key components such as cells, cathode active materials (CAM), and battery management systems (BMS) made in Europe, with increasing requirements by 2030. Additionally, EVs will need to incorporate green steel and have 70% of their non-battery components produced domestically. This move is intended to bolster Europe’s battery industry, enhance supply chain resilience, and reduce dependency on foreign suppliers. While Transport & Environment (T&E) welcomed the IAA as a positive step toward supporting local battery manufacturing and securing clean technology supply chains, it also highlighted significant loopholes that could undermine the law’s effectiveness. Notably, the inclusion of EVs from free trade agreement (FTA) countries for purchase subsidies and the extension of local content requirements to
energyelectric-vehiclesbatterieslithium-ionEuropean-Unionbattery-manufacturingclean-technologyWind on Oʻahu: A Modest but Valuable Complement to Solar - CleanTechnica
The article from CleanTechnica discusses the role of wind energy as a complementary renewable resource to solar power on the island of Oʻahu. It begins by emphasizing the importance of accurately assessing Oʻahu’s electricity needs after electrifying all fossil fuel end uses, such as transportation and heating. This electrification reduces overall energy demand due to the higher efficiency of electric technologies compared to combustion engines. The analysis estimates that Oʻahu would require about 6,000 GWh of electricity annually to meet these needs, with total grid electricity slightly higher when accounting for transmission losses. The challenge for renewable energy planning is thus to reliably produce around eight terawatt-hours per year. Solar energy is identified as the largest renewable resource on Oʻahu, with potential from rooftop, parking canopy, agrivoltaic, vertical, and utility-scale solar installations capable of exceeding the island’s electricity demand. However, solar power peaks midday and declines in the evening when demand often rises, necessitating additional storage or complementary generation
energyrenewable-energywind-powersolar-energyelectricity-gridenergy-storageOahu-energy-systemSolar storms, AI forecasts, and the future of safe flight on Earth and in space
The article features an interview with Dr. Lulu Zhao, assistant professor at the University of Michigan and lead of NASA’s CLEAR Center, focusing on space weather and its impact on modern technology. Dr. Zhao’s research centers on forecasting solar energetic particles (SEPs)—high-energy charged particles from the Sun that can disrupt electronics in aircraft, satellites, and pose risks to astronauts. Her team aims to develop advanced predictive frameworks combining physics, computation, and AI to better understand and anticipate these space weather events. Addressing a recent Airbus software glitch, Dr. Zhao clarifies that while solar energetic particles are known to cause bit flips in electronics, no significant solar activity coincided with the incident. Instead, cosmic rays—high-energy particles from outside the solar system—are the more likely cause, especially given the event occurred at low latitude where Earth’s magnetic field is strongest and shields most solar particles. She emphasizes that even a single particle can flip a critical bit in a control system, causing malfunctions, and these
energyspace-weathersolar-energetic-particlesAI-forecastingaerospace-safetyradiation-effectssatellite-technologyUnlocking Vehicle-to-Grid at Scale - CleanTechnica
The article from CleanTechnica discusses the significant potential of Vehicle-to-Grid (V2G) technology, which enables electric vehicles (EVs) to act as flexible energy storage assets that support electricity grid stability, facilitate renewable energy integration, and reduce charging costs for EV owners. Despite growing recognition of V2G benefits, widespread deployment remains limited due to regulatory and technical barriers. The briefing highlights the European Union’s vehicle type-approval framework as a critical policy tool to unlock large-scale V2G adoption. Transport & Environment (T&E) advocates for introducing a voluntary “V2G-ready” label on the Certificate of Conformity for new EVs, contingent on meeting key requirements: adherence to interoperability standards like ISO 15118-20, compliance with European grid codes, inclusion of onboard chargers capable of DC-AC inversion, and mandated sharing of battery data under the Renewable Energy Directive. Importantly, manufacturers should not impose paywalls or activation fees restricting V2G access. The article
energyelectric-vehiclesvehicle-to-gridV2Grenewable-energyEV-charginggrid-integrationCan Shipping's Greenhouse Gas Emissions Be Captured At The Funnel? - CleanTechnica
The article from CleanTechnica examines the potential of Onboard Carbon Capture and Storage (OCCS) as a solution to reduce greenhouse gas emissions from fossil-fueled ships amid the shipping industry's slow transition to green fuels. While OCCS is technically feasible, its practical deployment faces significant challenges related to the additional energy consumption, space, weight, and operational reliability required onboard vessels during normal voyages and maintenance. The technology's scalability also depends heavily on downstream infrastructure, including the ability to measure, offload, store, and transfer captured CO2 to verified permanent storage sites—facilities that are currently scarce. Furthermore, the article highlights substantial data gaps regarding OCCS’s real-world technical performance, costs, and operational constraints, which raise doubts about optimistic claims of its effectiveness as a transitional decarbonization technology. The report commissioned by Transport & Environment (T&E) and conducted by Pre-Scouter underscores that without robust measurement, reporting, and verification (MRV) frameworks and adequate storage infrastructure,
energycarbon-capturemaritime-decarbonizationonboard-carbon-captureshipping-emissionsclean-technologysustainable-shippingCarbon capture underground? X-rays test CO2 storage in volcanic rocks
The article discusses a new study from MIT that investigates how carbon dioxide (CO2) can be stored underground in volcanic basalt rocks through a process called carbon mineralization. This process involves CO2-rich fluids reacting with elements like iron, calcium, and magnesium in basalt to form stable carbonate minerals, effectively locking carbon away for millions of years. Basalt is considered a promising storage medium due to its porous nature and mineral content, with pilot projects like Iceland’s CarbFix demonstrating that over 95% of injected CO2 can mineralize within two years. However, scientists have sought to better understand how the rock’s internal structure changes during mineral formation. To explore this, the MIT researchers conducted laboratory experiments using basalt samples from Iceland, injecting mineral-forming fluids while monitoring changes with X-ray CT scanning. The imaging revealed that mineral formation primarily clogs tiny microfractures connecting larger pores, significantly reducing the rock’s permeability (fluid flow capacity) but only minimally decreasing porosity (pore space). Despite the reduced
energycarbon-capturecarbon-storagebasaltmineralizationclimate-changeX-ray-imagingScientists develop gallium nitride microLED system for energy-efficient AI chips
Researchers at Germany’s Technische Universität Braunschweig (TU Braunschweig) are developing a novel energy-efficient AI chip system using gallium nitride (GaN) microLEDs combined with silicon electronics. This initiative, called the BRIGHT project, aims to create optical neuromorphic hardware that processes information using light instead of electricity, potentially reducing the massive energy consumption associated with AI workloads. Given that AI systems like ChatGPT already consume vast amounts of electricity—estimated at around 40 million kWh daily—and that AI-driven data center power demand could account for over half of total data center electricity by 2028, innovations like this are critical for sustainable AI growth. Gallium nitride is a wide-bandgap semiconductor known for its high electron mobility and thermal stability, making it suitable for high-power and high-frequency devices, including LEDs and laser diodes. Although initially plagued by crystal defects, breakthroughs in the 1990s led to the development of high-brightness blue LEDs using Ga
energygallium-nitridemicroLEDAI-chipssemiconductor-materialsenergy-efficiencyneuromorphic-hardwareOSHA probing fatality at Rivian warehouse
The Occupational Safety and Health Administration (OSHA) has launched an investigation into the death of a worker at a Rivian warehouse in Illinois. The incident occurred when 61-year-old Kevin Lancaster was reportedly pinned between a tractor trailer and a loading dock, suffering blunt traumatic compressional injuries. Emergency responders arrived at 1:40 p.m. local time on Thursday, but Lancaster was trapped for approximately 20 minutes before being freed and was later pronounced dead at a local medical center. It remains unclear whether Lancaster was employed directly by Rivian or a subcontractor. The investigation by OSHA could take up to six months. This fatality adds to ongoing scrutiny of Rivian’s safety record, particularly following a 2024 Bloomberg report that highlighted 16 serious safety violations at Rivian’s Illinois factory over 2019 and 2023. However, since that report, the company has received only one violation at the manufacturing plant and has reportedly improved its safety and health protocols. Rivian’s Normal, Illinois
energyelectric-vehiclesRivianmanufacturing-safetyautomotive-factoryOSHA-investigationwarehouse-safetyBill Gates’ TerraPower gets approval to build new nuclear reactor
The Nuclear Regulatory Commission (NRC) has granted TerraPower, a nuclear startup founded by Bill Gates in 2015, approval to build its Natrium nuclear reactor in Wyoming near an aging coal power plant. This marks the first NRC permit for a new nuclear reactor in nearly a decade. The Natrium reactor is designed in partnership with GE Vernova Hitachi and will generate 345 megawatts—smaller than typical modern reactors but larger than many small modular reactors. Notably, Natrium uses molten sodium for cooling instead of water, a first for commercial reactors approved by the NRC in over 40 years. This design allows the reactor to store excess heat in molten sodium tanks, enabling energy to be saved during low demand and used to supplement intermittent renewable sources like wind and solar, potentially lowering generation costs. TerraPower’s approval is significant because it followed the NRC’s traditional permitting process for private land, unlike some projects on Department of Energy property that follow different regulations. The company is among
energynuclear-reactorTerraPowermolten-sodium-coolingsmall-modular-reactorsenergy-storageclean-energy-technologyWhat does France’s nuclear carrier deployment mean for the Iran war?
France has deployed its only nuclear-powered aircraft carrier, the Charles de Gaulle, to the eastern Mediterranean in response to escalating tensions following the outbreak of the Iran war. This move comes shortly after Iran announced the closure of the Strait of Hormuz, a critical chokepoint through which about 20 percent of the world’s oil and liquefied natural gas passes. The Charles de Gaulle, weighing 42,500 tons and powered by two K15 nuclear reactors, carries around 20 Rafale fighter jets and two E-2C Hawkeye early warning aircraft, which will help secure regional airspace. The vessel was redirected from operations in the North Atlantic and is expected to take about 10 days to reach the eastern Mediterranean. The Charles de Gaulle, commissioned in 2001, is France’s most advanced naval asset and has a history of involvement in major conflicts, including Afghanistan, Libya, and operations against ISIS. It typically operates with 20 to 30 aircraft equipped with long-range SCALP
energynuclear-poweraircraft-carriermilitary-technologynuclear-reactorsmaritime-securitydefense-systemsWhile Hinkley Nuclear Was Being Built, The UK Grid Decarbonized - CleanTechnica
The article discusses the prolonged and costly development of the Hinkley Point C nuclear power plant in the UK, highlighting how its construction timeline and budget have significantly expanded since the project’s inception. Initially approved in 2016 with an expected cost of £18 billion and a 2025 operational date, the project now faces a revised cost estimate of approximately £35 billion (in 2015 pounds) and a delayed start date around 2030. These overruns exemplify a common pattern in large infrastructure projects, characterized by budget inflation, schedule delays, and under-delivery of benefits. The article traces the origins of Hinkley Point C back to the mid-2000s when the UK’s electricity grid was heavily reliant on coal and gas, with nuclear power providing a smaller share. At that time, replacing retiring coal and aging nuclear plants with new large-scale nuclear reactors seemed a logical strategy to maintain grid reliability and reduce emissions. EDF, after acquiring British Energy in 2008, partnered
energynuclear-powerUK-griddecarbonizationHinkley-Point-Celectricity-generationrenewable-energy-transition$500 Million To Be Invested In Mexican EV Chargers & EVs - CleanTechnica
A $500 million investment is set to boost electric vehicle (EV) infrastructure and adoption in Mexico, focusing initially on the Bajío region. Managed by Invisible Urban Charging Inc. and ATX Smart Mobility, the plan includes deploying 38 EV chargers and 140 electric buses in the coming months. This private sector-led initiative highlights a significant opportunity for EV growth in Mexico and Latin America, where the current ratio of cars per charger is approximately 280, far above the ideal 40 cars per charger. The emphasis on fleet electrification aims to familiarize the public with EVs, potentially easing consumer transition to electric vehicles. Mexico City, known for severe air pollution exceeding World Health Organization limits, stands to benefit from this shift to fully electric vehicles, which can significantly reduce harmful emissions. Experts stress the importance of replacing internal combustion engine vehicles with fully electric models rather than hybrids or extended-range electric vehicles, which still rely on fossil fuels. This investment aligns with broader regional trends, such as Canada's recent announcement of
energyelectric-vehiclesEV-chargersclean-energysustainable-transportationelectric-busesMexico-energy-investmentNew US design uses heat for computing with superior energy efficiency
Researchers at Lawrence Berkeley National Laboratory have developed a novel "thermodynamic computing" design that harnesses thermal noise—the random vibrations of electrons typically seen as detrimental—to power computations. Unlike classical and quantum computers that expend significant energy to suppress heat-induced noise or require extreme cooling, this approach leverages thermal fluctuations at room temperature to perform complex, nonlinear machine learning tasks akin to neural networks. The key innovation lies in programming physical devices with energy scales comparable to thermal energy to evolve states driven by these fluctuations, effectively turning noise from a problem into a resource. The team overcame two major challenges that previously limited thermodynamic computing: the slow equilibration times required for calculations and the restriction to simple linear operations. By using nonlinear components and digital simulations, they demonstrated that thermodynamic computers can be trained to perform calculations at specific times without waiting for equilibrium, enabling faster and more predictable processing with much lower power consumption. To address the stochastic nature of these systems, which makes standard AI training ineffective, researchers employed evolutionary simulations on the
energythermodynamic-computingneural-networksmachine-learningthermal-noiseenergy-efficiencycomputing-hardwareBattery Shortages & Wait Times At Swap Stations In Kenya’s Booming Electric Motorcycle Sectors Show That It's Time For Big Investors To Support These Companies - CleanTechnica
Kenya’s electric motorcycle sector has experienced remarkable growth over the past several years, evolving from just 44 electric motorcycles registered eight years ago to capturing a 15.3% market share of new motorcycle registrations in 2025. This surge follows steady increases from 0.5% in 2021 to 7.1% in 2024, with electric motorcycles accounting for 25,277 of the 168,286 new registrations in 2025. The overall motorcycle market also expanded significantly, indicating strong consumer adoption and signaling that electric motorcycles are moving beyond early adoption into mass market acceptance. However, this rapid expansion has led to operational challenges, notably battery shortages and long wait times at battery swap stations. These issues stem from factors such as faster-than-expected battery degradation, deployment of motorcycles outpacing battery availability, and import delays due to shipping and customs bottlenecks. These are typical growing pains in a scaling industry and can be mitigated through improved logistics, data-driven asset
energyelectric-motorcyclesbattery-shortageselectric-mobilityKenyaelectric-vehicle-adoptionbattery-swap-stationsStartup Aims To Help US Farmers With Green H2 & Wind Power
The article discusses a US startup, TalusAg, that is developing modular, solar- and wind-powered green hydrogen systems to produce ammonia fertilizer locally for farmers. Green hydrogen, produced via electrolysis of water, can replace conventional hydrogen derived mainly from natural gas in ammonia fertilizer production, offering a cleaner alternative. However, high electrolysis costs have historically hindered competitiveness. Recent geopolitical tensions, including disruptions in Middle Eastern natural gas supplies and rising fertilizer prices in the US, have increased interest in domestic green ammonia production. TalusAg launched a commercial pilot in Boone, Iowa, and recently announced plans to build two full-scale “Talus 10” ammonia production facilities in Minnesota, in partnership with Central Farm Service and CleanCounts. These facilities, powered by electricity from Blue Earth Light & Water, aim to supply ammonia for over 100,000 acres, covering a significant portion of Central Farm Service’s annual fertilizer needs. The project expects support from the Minnesota Renewable Development Account, highlighting the potential for local green
energygreen-hydrogenammonia-fertilizerrenewable-energyelectrolysisagriculture-technologysustainable-farmingNon-destructive method ‘sees’ EV battery health through metal casings
An international research team from the Helmholtz Institute Mainz and New York University has developed a non-destructive diagnostic method to assess the internal health of rechargeable batteries through their metal casings using zero-to-ultra-low-field nuclear magnetic resonance (ZULF NMR). This technique allows scientists to "see" inside batteries without opening them, overcoming a major challenge since conventional methods could not determine electrolyte condition without destroying the battery. By detecting and quantifying key chemical components such as solvents and lithium salts inside commercial battery cells—including pouch cells used in electric vehicles—the method provides critical insights into electrolyte degradation, a primary cause of battery failure and safety hazards like fires. The ability to monitor electrolyte volume and composition nondestructively has significant implications for battery safety and performance, especially in electric vehicles and renewable energy storage systems. Real-time, operando measurements could enable batteries to self-report issues such as range loss or chemical instability before catastrophic failure occurs. Beyond immediate diagnostics, this approach could advance understanding of electrochemical processes, aiding
energybattery-technologyelectric-vehiclesnon-destructive-testingnuclear-magnetic-resonancerenewable-energybattery-health-monitoringMolten salt reactor metals can last 3x longer using high purity salt
Researchers from the University of Liverpool and Copenhagen Atomics have demonstrated that using high-purity molten salts significantly reduces corrosion in molten salt reactors (MSRs), allowing metals like 316L stainless steel to last up to three times longer. Their study, published in the Journal of Nuclear Materials, showed that untreated salts containing moisture and oxides cause severe corrosion, metal loss, and surface degradation within 1,000 hours at temperatures up to 700°C. In contrast, purified salts resulted in negligible corrosion even after 3,000 hours, highlighting the critical role of salt purity in maintaining material integrity by preserving the protective chromium oxide layer on the steel surface. Molten salt reactors, a promising fourth-generation nuclear technology, use molten salt as both coolant and fuel, offering advantages such as a high boiling point that reduces explosion risk and eliminates the need for expensive pressure vessels. Historically, corrosion issues in molten fluoride salts limited MSR viability, often necessitating costly high-nickel alloys. This research suggests that controlling
energymolten-salt-reactornuclear-energycorrosion-resistancematerials-sciencestainless-steelhigh-purity-saltAnthropic’s People Power Is Part Of A Bigger Fight That Affects Clean Technology - CleanTechnica
The article discusses the broader implications of the U.S. government's ban on Anthropic, an AI company, from federal contracts and military-related private firms due to a dispute over AI deployment and accountability. The conflict began when Anthropic raised questions about how its AI was used in a Venezuelan military operation alongside Palantir’s systems, leading Palantir to escalate concerns to the Pentagon. The Department of Defense, led by Secretary Pete Hegseth, demanded Anthropic drop its ethical safety restrictions, including limits on mass surveillance and autonomous weapons. Anthropic’s refusal resulted in its designation as a “supply chain risk,” effectively cutting it off from significant government and corporate contracts. Despite this, Anthropic’s consumer app gained popularity, topping app store charts and attracting paying subscribers, signaling strong market demand for ethically governed AI. The article highlights the significance of this standoff beyond national security, emphasizing its relevance to the clean energy and electric vehicle sectors. AI is increasingly critical for managing renewable energy infrastructure,
energyclean-energyAI-in-energyrenewable-energyelectric-vehiclesenergy-consumptionAI-compute-energy'World-first' waste-burning reactor: China eyes 1000-year nuclear energy
Researchers at the Chinese Academy of Sciences (CAS) are finalizing the installation of superconducting particle accelerators for a pioneering Accelerator-driven subcritical system (ADS) nuclear reactor in Guangdong province, aiming to launch the world’s first megawatt-level waste-burning reactor by 2027. This innovative reactor addresses two major challenges in nuclear power: safety and long-term radioactive waste. By burning uranium 100 times more efficiently than conventional reactors and transmuting long-lived radioactive waste into shorter-lived isotopes, the ADS technology could reduce nuclear waste’s hazardous lifespan to less than a thousandth of its current duration, potentially providing a stable and green energy source for the next 1,000 years. The ADS system is a hybrid combining a nuclear reactor with a high-energy particle accelerator that fires proton beams at 80% the speed of light into a liquid lead-bismuth alloy, generating neutrons that convert otherwise waste uranium-238 into usable plutonium-239 fuel. Because the reactor depends on an external
energynuclear-energywaste-burning-reactorAccelerator-driven-subcritical-systemsclean-energysuperconducting-particle-acceleratorssustainable-energyAikido plans AI data centers inside floating wind turbine platforms
US startup Aikido Technologies has introduced AO60DC, an innovative floating offshore wind turbine platform that integrates AI computing capabilities with battery storage, enabling data centers powered entirely by renewable energy at sea. This approach addresses the rising energy and water demands of traditional AI data centers, which require significant power for GPUs and substantial water for cooling, often straining local resources. By situating AI compute offshore, Aikido aims to reduce reliance on terrestrial energy grids and freshwater sources, using the ocean as a natural heat sink to cool the systems efficiently. The AO60DC platform is scalable, supporting IT loads from 30 MW to 1 GW, with each unit hosting 10-12 MW of AI-grade compute powered by a 15-18 MW turbine and integrated battery storage. Its design combines the turbine substructure and data center within a single steel unit, lowering capital and operational costs, and features a proprietary "flat-pack" semi-submersible platform that enables assembly up to ten times faster than conventional
energyrenewable-energyfloating-wind-turbinesAI-data-centersbattery-storageoffshore-platformsgreen-technologyTop 10 most expensive technological achievements in human history
The article outlines the top 10 most expensive technological achievements in human history, emphasizing that these monumental projects represent humanity’s collective ambition and collaboration rather than individual efforts. Leading the list is the International Space Station (ISS), costing $150 billion, assembled over more than a decade by 15 nations. The ISS not only serves as a space laboratory but has also driven innovations like memory foam and advanced water filtration systems. Following the ISS is ITER, an ambitious nuclear fusion reactor under construction in France, with costs estimated between $22 and $65 billion. ITER aims to produce more energy than it consumes, potentially revolutionizing clean energy and ending fossil fuel dependence. Other notable entries include the Hubble Space Telescope ($13–14 billion), which has vastly expanded our understanding of the universe and contributed to medical imaging technologies; the Gerald R. Ford-class aircraft carrier ($13 billion), the most expensive warship designed primarily for military deterrence; and the James Webb Space Telescope ($9.7–10.8 billion
energynuclear-fusionInternational-Space-StationITERclean-energytechnological-achievementsspace-technologyIran war pushing China to rethink its military AI and energy security
The ongoing conflict around Iran has prompted significant strategic reflection within China, as Beijing closely monitors the war’s implications for global power dynamics, energy security, and military technology. While China has maintained a cautious and diplomatic stance, calling for de-escalation and dialogue, the crisis underscores several risks to its economic and strategic interests. China is heavily dependent on Middle Eastern energy supplies, importing about 12 percent of its crude oil from Iran, and disruptions—especially in critical shipping routes like the Strait of Hormuz—could jeopardize its energy security. Additionally, instability in the region threatens broader Chinese investments tied to its global economic initiatives, potentially impacting financial flows and infrastructure projects across Asia, Africa, and the Middle East. The conflict also exposes limitations in China’s military capabilities compared to the United States and its allies. The rapid, high-precision operations conducted by the US and Israel highlight a level of global military reach and operational flexibility that China has yet to achieve, despite its growing defense budget and technological advancements.
energyartificial-intelligencemilitary-technologyenergy-securityChinaMiddle-East-conflictstrategic-partnershipUS Navy funds nuclear submarine missile control upgrade for Trident II
The US Navy has awarded General Dynamics Mission Systems a $255 million contract to sustain and modernize the fire control system for the Trident II D5 ballistic missile, ensuring its compatibility with both the current Ohio-class and future Columbia-class ballistic missile submarines. This upgrade is critical for maintaining the precision, reliability, and operational continuity of the sea-based leg of the US nuclear triad as the Navy transitions to the next-generation Columbia-class submarines. The contract covers lifecycle support, development, production, and installation of the new fire control systems through 2032, with most work conducted in Pittsfield, Massachusetts. The Trident II Fire Control System serves as the digital interface that integrates the submarine’s navigation, mission computers, and missile launch tubes, managing targeting data, ballistic trajectories, and launch parameters while submerged. It supports up to 24 Trident II missiles on Ohio-class submarines and will be adapted for Columbia-class boats to maintain seamless operational compatibility. This modernization effort underpins the continuity of the
robotenergymilitary-technologymissile-control-systemssubmarine-technologynuclear-deterrencedefense-systems70% in 5 mins: BYD’s new EV battery rivals petrol refueling speeds
Chinese EV leader BYD has unveiled its Blade Battery 2.0, a next-generation electric vehicle battery capable of charging from 10% to 70% in just five minutes and reaching 97% in about nine minutes—charging speeds comparable to refueling a gasoline car. The battery supports a driving range of over 621 miles under CLTC conditions and maintains strong charging performance even in extreme cold (down to -22°F). BYD aims to address “charging anxiety” by replicating the convenience and speed of gas refueling, potentially accelerating wider EV adoption. To complement the battery, BYD plans to deploy around 20,000 high-power “flash charging” stations across China by year-end, with peak outputs of about 1,500 kW—significantly exceeding Tesla’s current 500 kW superchargers in China. The Blade Battery 2.0 will debut in premium models such as the Yangwang U7 and the updated Denza Z9 GT, the
energyelectric-vehiclesEV-batteryfast-chargingBYDbattery-technologycharging-infrastructureSwiss scientists develop stretchable polymer electrolyte for batteries
Swiss researchers at Empa’s Laboratory for Functional Polymers have developed a novel silicone-based stretchable polymer electrolyte aimed at improving solid-state batteries. Unlike conventional rigid solid electrolytes, this new material is soft and elastic, making it suitable for flexible battery applications, including medical devices such as pacemakers. The team overcame a key challenge—silicone’s natural nonpolar nature, which prevents ion conduction—by chemically modifying the polymer backbone with functional groups to enable efficient ion transport while maintaining elasticity. The stretchable electrolyte is currently being tested in various battery prototypes, including button cells, with potential for flexible batteries when paired with appropriate electrode materials. Beyond flexibility and safety, the material can be processed into thin films just a few micrometers thick, is scalable for industrial production, and is expected to be more cost-effective than conventional solid polymer electrolytes. The researchers are focusing on further enhancing ionic conductivity and seeking industrial partners to commercialize the technology. This innovation contributes to the broader advantages of solid-state batteries,
energybatteriespolymer-electrolytesolid-state-batteriesflexible-batteriessilicone-polymerbattery-technologyBYD Launches Next-Generation Blade Battery & Flash Charging - CleanTechnica
BYD has introduced its second-generation Blade Battery alongside a new Flash Charging system, marking a significant advancement in electric vehicle (EV) technology and infrastructure. The Flash Chargers, capable of delivering over 1 MW of power, feature T-shaped charging piles with two suspended guns each supplying 1500 kW. This allows EV batteries to charge from 10% to 70% in just 5 minutes and up to 97% in 9 minutes under normal temperatures, with impressive performance maintained even at -30°C. The integrated approach, leveraging BYD’s extensive engineering expertise across multiple disciplines, aims to overcome the traditional “chicken or egg” problem by simultaneously enhancing both vehicle and charger capabilities. BYD’s new Blade Battery offers a 5% increase in energy density compared to its predecessor and supports ultra-fast charging without significantly degrading battery life, backed by improved warranty terms. This development could reduce reliance on larger, heavier batteries by alleviating range anxiety through rapid recharging. To support widespread adoption
energybattery-technologyelectric-vehiclesfast-chargingenergy-densitylithium-iron-phosphaterenewable-energyChina's compressed air energy station to power 600,000 households
The Huai’an Salt Cavern Compressed Air Energy Storage (CAES) demonstration project in Jiangsu Province, China, has become the world’s largest fully operational compressed air energy storage station. Featuring two 300 MW non-supplementary combustion CAES units, the facility has a total installed capacity of 600 MW and an energy storage capacity of 2,400 MWh, with about 71% conversion efficiency. The project uses abandoned salt mine caverns located 1,150 to 1,500 meters underground to store compressed air during low-demand periods, which is then released to generate electricity during peak demand, supporting grid stability through peak shaving and frequency regulation. The project employs advanced “molten salt + pressurized thermal water” high-temperature adiabatic compression technology that stores and reuses compressed heat without fossil fuel combustion, offering significant low-carbon benefits. With a total investment of $520 million, the station is expected to generate 792 million kWh annually, enough to power
energycompressed-air-energy-storageCAESrenewable-energygrid-stabilityenergy-storagelow-carbon-technologyElectrified & Lightweight Semi Trailers Key To Battery-Powered Freight - CleanTechnica
The article discusses the innovative approach of electrifying semi trailers rather than tractors to reduce emissions and improve efficiency in freight transport across Europe. Trailer Dynamics, a German company, has developed an electrified semi trailer called the eTrailer, which features an electric axle with two motors, individual wheel control, and integrated batteries managed via the trailer kingpin. This design allows the eTrailer to assist both diesel and battery-electric tractors, reducing fuel consumption by up to 50% on challenging routes and increasing the range of battery-electric tractors from about 400 km to over 800 km. The system uses real-time data and sensors to optimize performance and ensure safe operation, supporting but never independently propelling the tractor. Despite its benefits, the eTrailer comes at a significantly higher cost than conventional trailers, with prices ranging from €140,000 to €220,000 depending on battery size, compared to €30,000 to €80,000 for standard trailers. To address this, Trailer Dynamics primarily offers the eTrailer
energyelectric-vehiclesbattery-technologyfreight-transportdecarbonizationelectric-semi-trailersefficiency-gainsParking Lots, Rooftops, & Farms: Mapping Oʻahu’s Solar Potential - CleanTechnica
The article "Parking Lots, Rooftops, & Farms: Mapping Oʻahu’s Solar Potential" from CleanTechnica examines the substantial solar energy opportunities on the island of Oʻahu, Hawaiʻi, in the context of a fully electrified energy system that excludes aviation, shipping, and military fuel uses. Oʻahu benefits from a strong and consistent solar resource due to its geographic location near 21° north latitude, with solar capacity factors ranging from 18-20% for fixed rooftop systems and about 23% for utility-scale single-axis tracking systems. Existing assessments by the Hawaiʻi Natural Energy Institute and the National Renewable Energy Laboratory (NREL) estimate that about 1,862 MW of utility-scale solar capacity could be installed on suitable land, potentially generating 3,700 to 4,000 GWh annually—roughly half of the island’s electricity needs in an electrified economy. In addition to utility-scale solar, rooftop solar is a significant contributor, with nearly half
energysolar-powerphotovoltaicrenewable-energysolar-capacityrooftop-solarutility-scale-solarAEVA Registers Progress on EV Charging in Strata Title Apartment Buildings - CleanTechnica
The Australian Electric Vehicle Association (AEVA) ACT branch has launched a publicly accessible register of strata title apartment buildings in Canberra that offer electric vehicle (EV) charging facilities for tenants and owners. This initiative addresses a growing demand in the Australian Capital Territory (ACT), which leads the nation in EV adoption per capita, with over 14,000 registered EVs and more than 22% of new car sales being plug-in vehicles as of early 2026. The register aims to assist prospective buyers and renters in identifying EV-friendly apartments, highlighting those strata complexes that have enabled on-site charging, in contrast to others that obstruct such installations. Peter Campbell, a long-time AEVA member and strata committee veteran, emphasized the diversity of charging solutions across the 22 listed sites, ranging from individually metered outlets to shared charging points managed by third-party operators. The register, compiled from member input, strata managers, and public sources like PlugShare, serves as a valuable resource but comes with a disclaimer about potential
energyelectric-vehiclesEV-chargingsustainable-transportationrenewable-energysmart-gridelectric-mobilityBYD rolls out EV batteries with 5-minute ‘flash charging.’ But there’s a catch.
Chinese automaker BYD has introduced the Blade Battery 2.0 system, capable of charging an electric vehicle from 10% to 70% in just five minutes, with a near-full charge taking about nine minutes total. This rapid charging performance extends to cold temperatures (–4˚F/–20˚C), where the battery can charge from 20% to 97% in under 12 minutes. The battery pack will debut in BYD’s Yangwang U7 luxury sedan but requires pairing with BYD’s proprietary Flash Charging EV chargers, which deliver up to 1.5 megawatts of power. BYD currently operates 4,200 Flash charging stations across China and plans to expand by 16,000 more by year-end, incorporating grid-scale batteries to ease grid demand. The Blade Battery 2.0 uses lithium-iron-phosphate (LFP) chemistry, which is less energy-dense than nickel-manganese-cobalt (NMC) but significantly
energyelectric-vehiclesbattery-technologyfast-charginglithium-iron-phosphateEV-chargersBYDSpotlight On Texas As Trump Makes Solar Power Great Again
The article highlights the surprising growth of solar power in Texas despite former President Donald Trump's administration's opposition to renewable energy. While Trump sought to bolster fossil fuels and curb renewables, geopolitical tensions and rising fuel prices have strengthened the economic case for wind and solar energy. Texas, traditionally a conservative state with strong fossil fuel ties, has become a national leader in renewable energy, particularly wind and now solar power, rivaling California in installed solar capacity. This shift underscores how financial incentives are increasingly overriding political rhetoric against renewables. Recent developments in Texas illustrate this trend clearly. Origis Energy secured $545 million in financing for solar projects in Ector County, Texas, aiming to add 413 megawatts of solar capacity this summer as part of a larger 700 MW complex. Similarly, Zelestra announced two major solar plants in Lamar and Hopkins counties totaling 441 megawatts, expected to be operational by the end of 2027 and supporting hundreds of local jobs. These projects are part of a
energysolar-powerrenewable-energyTexasenergy-storagewind-powerclean-energyWhy Small Hydrogen Markets Are Likely to Shrink - CleanTechnica
The article from CleanTechnica examines the future of small, distributed hydrogen markets and the potential role of imported green methanol as a hydrogen source. While methanol offers advantages in transport and storage due to existing global shipping infrastructure and the ability to produce hydrogen onsite via catalytic cracking, the economic viability of such supply chains depends on the scale and durability of hydrogen demand in smaller markets. Currently, the global hydrogen market is about 95 to 100 million tons annually, dominated by two major sectors: oil refining and ammonia production. Other uses, including methanol synthesis, steel production, transportation, heating, and various smaller applications, represent a much smaller share of demand. A critical issue highlighted is that nearly all current hydrogen production relies on fossil fuels, mainly through steam methane reforming and coal gasification, releasing roughly 900 million to 1 billion tons of CO2 annually—comparable to the global aviation sector’s emissions. Therefore, decarbonizing existing large-scale hydrogen production in refining, ammonia,
energyhydrogenclean-energydecarbonizationfuel-productiongreen-methanolindustrial-energyTop Selling Electric Vehicles in the World — January 2026 - CleanTechnica
In January 2026, global plugin electric vehicle (EV) registrations declined by 6% year-over-year (YoY) to nearly 1.2 million units, with battery electric vehicles (BEVs) down 4% and plug-in hybrids (PHEVs) down 8%. This rare simultaneous drop is largely attributed to the expiration of key incentives in the U.S. (October 2025) and China (end of 2025), the world’s first and third largest EV markets. However, excluding these two countries, global EV sales actually surged 36% YoY, driven by strong growth in emerging markets, particularly in Asia (India, Indonesia, Malaysia, Philippines, Singapore, South Korea) and other countries like Azerbaijan, Belarus, Poland, and Uruguay. Overall, plugin vehicles captured an 18% share of the global auto market in January, with BEVs accounting for 12%. Chinese EV manufacturers are increasingly focusing on exports to offset thin domestic margins, leading
energyelectric-vehiclesBEVPHEVautomotive-marketclean-energyEV-sales-trends'Dry' batteries use waste heat to slash cooling electricity use by 86%
Researchers at NYU Tandon School of Engineering have developed a zeolite-based thermal battery system that can reduce electricity consumption for data center cooling by 86% by utilizing waste heat from nearby industrial facilities. This innovative approach integrates data centers with industrial plants, enabling the use of low- to medium-temperature waste heat (below 200°C) to "charge" zeolite materials, which are then transported—typically within a median distance of 57 kilometers—to data centers. At the data center, the dried zeolite facilitates cooling by adsorbing water vapor, effectively acting as a heat sink and replacing conventional electricity-intensive chillers. This integration can reduce the combined electricity use of both facilities by over 75%, improving data center power usage effectiveness by 12%. The technology leverages inexpensive, porous crystalline zeolites, which retain thermal energy without significant loss over time, making them suitable for long-distance transport and storage. While the system significantly cuts electricity use, it increases overall water consumption by 15-
energythermal-batterieswaste-heat-recoveryzeolite-materialsdata-center-coolingenergy-efficiencysustainable-cooling12,000 New EV Fast Chargers Planned For Germany In Four Years - CleanTechnica
German energy company EnBW plans to install 12,000 new fast electric vehicle (EV) charging ports, each capable of 400 kW, across Germany within the next four years. This expansion is part of EnBW's broader strategy to increase its fast charger network from the current 8,000 points to 20,000 by 2030. The company is partnering with XCharge to provide the necessary hardware and software, aiming to diversify its supplier base to enhance network quality and resilience amid global supply chain uncertainties. EnBW currently operates over 900,000 charging points across 17 European countries and emphasizes the use of 100% green electricity for its fast-charging network. Some charging sites feature solar panel canopies, although not all do, and the company ensures continuous operation by connecting to the grid when solar generation is insufficient. This significant infrastructure growth in Germany reflects a strong commitment to sustainable transportation, contrasting with some resistance to EV and clean energy adoption seen in other regions like the United
energyelectric-vehiclesEV-chargingfast-chargersrenewable-energygreen-electricitysustainable-technologyVinEnergo Moves Offshore With 10 GW Pipeline & A Target That Will Take Some Proving - CleanTechnica
VinEnergo, the energy subsidiary of Vietnam's VinGroup, has announced an ambitious international expansion plan with an initial 10 GW project portfolio spanning the Philippines, Denmark, and Sweden. Over the next three years, the company aims to reach a combined domestic and international capacity of 100 GW, with the international pipeline expected to exceed 20 GW by early 2026. Additional projects in Southeast Asia and Africa are also in development. However, the feasibility of these targets depends heavily on securing capital, navigating permitting processes, and establishing strong local partnerships to bring projects to financial close. Domestically, VinEnergo demonstrates significant organizational breadth by managing diverse energy technologies that reflect Vietnam’s evolving grid needs. It is simultaneously developing a large 4,800 MW LNG-to-power facility and multiple wind projects totaling over 1,700 MW, balancing the need for dispatchable gas capacity with renewable energy growth. This mix underscores the practical challenges of Vietnam’s energy transition, where gas provides grid stability amid increasing renewable
energyrenewable-energyoffshore-windLNG-powerenergy-infrastructureenergy-transitionenergy-projectsA Pseudo Book Review: Solvable: How We Healed The Earth, And How We Can Do It Again - CleanTechnica
The article presents a reflective and personal account of meeting Susan Solomon, a pioneering atmospheric scientist renowned for her critical role in linking chlorofluorocarbons (CFCs) to ozone layer depletion. Solomon’s research was instrumental in the creation of the 1987 Montreal Protocol, which is celebrated as one of the most successful environmental treaties, leading to the ongoing recovery of the ozone layer. The author highlights Solomon’s unique ability to translate complex scientific data into accessible, actionable knowledge that bridged the gap between science, public awareness, and international policy. Her visit to Hanoi, where she received a Special Prize for Female Innovators, symbolized the potential for global scientific collaboration to address pressing environmental challenges. Central to Solomon’s message, as elaborated in her book "Solvable: How We Healed The Earth, And How We Can Do It Again," is a framework based on the "three Ps": environmental threats must be personal, perceptible, and practical to spur effective action. The
energyrenewable-energyclimate-changeenvironmental-scienceozone-layersustainabilityclean-technologyVinFast Reorganizes Brand & Product Lineup As it Expands Globally - CleanTechnica
VinFast has restructured its electric vehicle lineup into three distinct brand tiers to support its global expansion and competitive strategy across different market segments. The top tier, Lac Hong, represents the company's ultra-luxury marque, showcasing exclusive, technologically advanced vehicles inspired by Vietnamese culture and national symbols. The core VF series continues to serve mainstream consumer markets with models ranging from the compact VF 3 to the flagship VF 9 and the seven-seat MPV 7. The third tier, Green, targets commercial mobility and fleet services with vehicles designed specifically for urban transport and service operators. As part of this reorganization, VinFast introduced two new ultra-luxury EV concepts, the Lac Hong 800S and 900S, which will join the previously announced 900 LX model. These vehicles emphasize executive-level comfort, craftsmanship, and advanced features such as reclining “zero-gravity” seats, automated doors, and high-end entertainment systems. The 900S model is tailored for chauffeur-driven luxury, featuring a
energyelectric-vehiclesVinFastautomotive-technologyelectric-drivetrainluxury-EVsustainable-mobilityUS Builders Are Still Pushing The Solar Power Envelope
The article highlights the ongoing momentum of the US solar industry despite political headwinds, emphasizing the growing role of builders and real estate firms in advancing solar power integration. Unlike traditional solar development, where solar companies must first secure property rights, builders like Clayco are combining property acquisition, financing, and solar installation into a unified process. This integrated approach reduces costs and accelerates project timelines while unlocking new financial opportunities. Startups like SolaREIT exemplify this trend by focusing on renewable energy additions for property owners, signaling strong growth potential in the collaboration between real estate and solar sectors. A notable development is Clayco’s launch of a Power and Energy division dedicated to utility-scale solar and energy storage projects. With over 3,800 employees and a full-service design-build model, Clayco aims to leverage advanced engineering and construction techniques to become a major player in the US solar and storage market. The company’s focus on solar rather than wind reflects current market dynamics, where solar benefits from more flexible site selection
energysolar-powerrenewable-energyenergy-storageconstructionutility-scale-solarclean-energyUS firm tests upgraded Hadley H13 rocket engine for hypersonic flight
Ursa Major, a US aerospace and defense company, has successfully conducted the first hot-fire tests of its upgraded Hadley H13 liquid rocket engine, designed for hypersonic flight and small launch vehicles. The H13 is an enhanced version of the flight-proven Hadley H11 engine, delivering approximately 5,000 lbs of thrust at sea level and about 6,500 lbs in vacuum. Running on liquid oxygen and kerosene with an oxygen-rich staged combustion cycle, the engine features significant design improvements, updated materials, and advanced manufacturing processes—including 80% additive manufacturing—that increase performance, reusability, and reduce production lead times and costs. The H13 can be reused more than twice as many times as previous variants, making it Ursa Major’s highest performing and lowest cost-per-flight engine to date. The Hadley H13 is designed as an off-the-shelf propulsion solution, enabling integration into multiple platforms without custom development, thus supporting diverse mission profiles with greater reliability and
energyrocket-enginehypersonic-flightadditive-manufacturingreusable-propulsionliquid-oxygenaerospace-materialsHow High-Speed Charging, Pull-Thrus, & Smart Partnerships Are Supercharging EVgo's Success - CleanTechnica
The article highlights EVgo’s successful strategy in rapidly expanding its electric vehicle (EV) charging network by focusing on high-speed infrastructure, strategic partnerships, and user-friendly technology. EVgo’s “eXtend” model, where partners own the hardware and EVgo operates it, has driven significant growth, with the number of eXtend stalls doubling to 1,070 by the end of 2025 and the total network reaching 5,100 operational stalls. The company is also targeting expansion into local retail locations like Kroger in 2026, emphasizing convenience and accessibility for EV drivers. Technologically, EVgo is positioning itself as a leader in ultra-fast charging, surpassing Tesla in charging speed by deploying 350 kW chargers nationwide, compared to Tesla’s predominant 250 kW V3 Superchargers. They are also adopting Tesla’s NACS (J3400) connectors to future-proof their network. Innovations like Autocharge+, which enables seamless plug-and-charge sessions without app interaction
energyelectric-vehiclesEV-charginghigh-speed-chargingEVgocharging-infrastructureclean-energyZeno raises $25M to speed up production of its battery-swap motorbikes
Zeno, an East African electric motorbike startup, has raised $25 million to accelerate production of its battery-swap motorbikes, the Emara. The funding includes a $20.5 million equity round led by Congruent Ventures with participation from Active Impact and Lowercarbon Ventures, and a $4.5 million debt facility from Camber Road and Trifecta Capital. Previously, Zeno raised $9.5 million in a seed round led by Lowercarbon Ventures and Toyota Ventures. Since its inception, Zeno has produced over 800 Emara bikes and established more than 150 charging locations across four East African countries. The Emara motorbike offers significant advantages for the region’s transportation needs, including 50% lower operating costs compared to internal combustion engine bikes, a range of about 100 kilometers per charge, and a carrying capacity of up to 250 kilograms. Priced at approximately $1,300 without a battery and $2,000 with one, the bike
energyelectric-vehiclesbattery-swapmodular-powerclean-energyelectric-motorbikesrenewable-energy7 solid-state battery tech that could change the future of EV cars
The article discusses seven promising solid-state battery technologies poised to transform electric vehicle (EV) performance by addressing current limitations in range, charging speed, and safety. Solid-state batteries replace conventional liquid electrolytes with solid materials, offering higher energy density, enhanced thermal stability, and longer lifespans. Among these technologies, lithium-metal solid-state batteries use pure lithium metal anodes to significantly increase energy storage and prevent dendrite formation, improving safety and charging speed. Sulfide solid-state batteries feature fast lithium-ion transport and softness that facilitates manufacturing large, high-capacity battery packs suitable for mass-market EVs. Other notable technologies include oxide ceramic solid-state batteries, which offer chemical stability and high-voltage operation but face manufacturing challenges due to their rigidity; polymer solid-state batteries, which provide flexibility and easier large-scale production despite slower ion conduction; and halide solid-state batteries, a newer class combining strong ionic conductivity with electrochemical stability and lower cost. The article also mentions thin-film solid-state batteries, characterized by
energysolid-state-batterieselectric-vehicleslithium-metal-batteriessulfide-electrolytesoxide-ceramic-batteriespolymer-electrolytesPhotos: UK engineer builds working electric car using 500 recycled disposable vapes
A UK engineer, Chris Doel, has innovatively repurposed around 500 discarded disposable vape lithium cells to create a battery pack that powers a small electric car, a Reva G-Wiz. This compact city car, originally equipped with heavy lead-acid batteries and a modest 17-horsepower motor, was transformed by replacing its original battery with a custom-built pack of recycled vape cells arranged into 14 modules producing roughly 50 volts and about 2.1 kWh of usable energy. Doel’s project highlights the potential for reusing lithium cells from single-use electronics, which often retain significant charge despite being discarded. To safely integrate the vape cell battery, Doel fabricated an aluminum enclosure with insulation and vibration-dampening materials, fitting it into the car’s rear seat area. The design includes a battery management system monitoring voltage, current, and temperature, with individual fuses for each module and safety features to reduce fire risk. The G-Wiz’s simple electrical system was
energyelectric-carlithium-batterybattery-recyclingelectric-vehiclesustainable-energybattery-management-systemRivian is betting its future on one of the fastest EV launches in US history
Rivian is aiming for one of the fastest launches of a new all-electric vehicle in U.S. history with its upcoming R2 SUV, a critical product for the company’s future profitability and market position. The company expects to sell between 20,000 and 25,000 R2 units in its first year, with initial deliveries starting in June. If Rivian meets even the lower end of this target, the R2’s sales pace would outstrip nearly all comparable electric vehicles priced under $60,000, except for the Tesla Model Y, which reached 20,000 sales in about four months. Rivian’s goal is to hit this milestone in roughly six months, matching the Honda Prologue’s recent performance and beating other competitors like the Chevy Equinox EV and Ford Mustang Mach-E. The R2 launch faces significant challenges, including the loss of the $7,500 federal EV tax credit and increased vehicle costs due to tariffs and regulatory changes under the Trump administration. Despite these
energyelectric-vehiclesEV-marketRivian-R2automotive-industrysustainable-transportationelectric-SUVElectrifying Oʻahu: Shrinking the Island’s Energy System Before Decarbonizing It - CleanTechnica
The article "Electrifying Oʻahu: Shrinking the Island’s Energy System Before Decarbonizing It" from CleanTechnica emphasizes the importance of redefining Oʻahu’s energy system boundaries to focus on the island’s civilian economy rather than the entire state’s energy flows. Large quantities of petroleum used for aviation fuel, maritime bunkering, and military logistics dominate Hawaii’s overall energy statistics but largely support activities beyond the island’s local economy. By excluding these external uses, the analysis narrows the primary energy consumption on Oʻahu to about 39,000 gigawatt hours (GWh) annually, primarily from petroleum-based electricity generation, transportation fuels, and smaller shares from renewables like solar, wind, biomass, and heat pumps. A Sankey diagram visualizes these energy flows, showing that only around 6,000 GWh of this energy is converted into useful services, while the remaining 33,000 GWh is lost as rejected energy due to inefficiencies inherent
energyrenewable-energydecarbonizationelectricity-generationenergy-transitionOahu-energy-systemsustainable-energyIran threatens strike on Israel's most secretive nuclear complex
Iran has issued a warning that it may target Israel’s Dimona nuclear facility if the United States and Israel pursue regime change in Tehran. This threat, voiced by an Iranian military official and reported by state-linked media, places one of Israel’s most sensitive and secretive strategic sites at the center of escalating tensions. The warning follows statements from U.S. and Israeli leaders suggesting their military strategies aim to weaken Iran’s current government and foster political change. The situation unfolds amid expanding military operations involving Iran, Israel, and their regional allies. The Dimona site, officially known as the Shimon Peres Negev Nuclear Research Center, is widely believed by experts to be integral to Israel’s nuclear weapons program, despite Israel’s policy of nuclear ambiguity and its non-signatory status to the Nuclear Non-Proliferation Treaty (NPT). The facility, operational since the early 1960s, is thought to have produced plutonium for nuclear weapons, with estimates suggesting Israel possesses around 90 warheads.
energynuclear-energynuclear-weaponsnuclear-materialsMiddle-East-conflictstrategic-infrastructureradiological-safetyUS: New solid state EV batteries capture sulfur cathode potential
Researchers at the University of Chicago Pritzker School of Molecular Engineering (UChicago PME) have developed a novel one-step milling process to enhance the use of sulfur as a cathode material in solid-state batteries. Sulfur, abundant and low-cost, offers a high theoretical capacity (1675 mAh/g) but has been underutilized due to its insulating nature and poor electronic conductivity. The new process powders sulfur, solid-state electrolyte, and conductive carbon together, creating a metastable interphase that improves electrolyte interaction with sulfur, resulting in a discharge capacity of about 1500 mAh/g—close to sulfur’s theoretical maximum. This method addresses inefficiencies of previous mixing techniques and boosts battery performance without adding new materials or coatings. Additionally, the researchers tackled the issue of battery "breathing," where materials expand and contract during charge-discharge cycles, causing mechanical stress. They paired a silicon negative electrode with a lithium sulfide positive electrode, exploiting sulfur’s unique expansion behavior to offset the contraction of
energysolid-state-batteriessulfur-cathodeelectric-vehiclesbattery-materialslithium-ion-alternativesbattery-technology10 MWe steam turbine to power next-gen sodium-cooled US nuclear reactor
US-based Aalo Atomics has partnered with Baker Hughes to supply a 10 MWe steam turbine generator set for its experimental sodium-cooled nuclear reactor, the Aalo-X. This turbine will convert thermal energy from the reactor into electricity aimed at powering AI data centers. The collaboration leverages Baker Hughes’ modular design approach, aligning with Aalo’s “plug-and-play” philosophy for modular reactors. The turbine is expected to be delivered by the end of 2026, supporting Aalo’s goal of achieving first criticality—the point of self-sustaining nuclear reaction—by the end of 2025. Aalo Atomics is developing the Extra-Modular Reactor (XMR), designed to fill the niche between microreactors and Small Modular Reactors (SMRs), specifically targeting the continuous, high power demands of AI infrastructure. Unlike traditional water-cooled reactors, the XMR uses liquid sodium for cooling, enabling higher energy density and a smaller footprint. The pilot Aalo-X produces
energynuclear-reactorsteam-turbinemodular-reactorsodium-cooled-reactorAI-data-centerspower-generationNew dampening device designed to protect buildings from earthquakes
A new earthquake-dampening device patented in December 2025 offers a simple, low-cost solution to protect buildings and infrastructure from seismic activity, wind, and industrial vibrations. Developed by Prof. Moussa Leblouba at the University of Sharjah, the device consists of a hollow cylinder filled with steel balls and a central shaft lined with radial rods. It dissipates energy through friction generated as the rods move through the ball bearings, absorbing about 14% of vibration energy in lab trials. Unlike traditional dampers that rely on fluids or deformable metals and often require replacement after major events, this purely mechanical system requires no electricity, remains operational during power outages, and can be easily repaired by replacing individual parts. The device’s affordability, ease of on-site assembly, and retrofit capability make it particularly suitable for developing countries where expensive seismic engineering is often impractical. Additionally, it can recover its original shape after shaking, allowing continuous protection without costly immediate replacements. Beyond earthquake protection, the technology has potential
energyearthquake-protectionvibration-dampingstructural-engineeringmaterials-scienceseismic-safetymechanical-designDonut Lab Battery Works at 100° Celsius, Proves More Skeptics Wrong - CleanTechnica
The article from CleanTechnica addresses growing evidence supporting the legitimacy of Donut Lab's high-temperature battery, which operates effectively at 100° Celsius. Independent laboratory tests have confirmed that the battery maintains full function even after exposure to such extreme heat, challenging earlier skepticism. Notably, when the battery pouch's thin membrane was breached during testing, there was no fire or significant outgassing, which would be expected if the battery contained a conventional liquid organic electrolyte like those in standard lithium-ion batteries. This strongly supports Donut Lab's claim that their battery uses a solid-state electrolyte, distinguishing it from typical lithium-ion designs. The article emphasizes that Donut Lab’s battery is not a production lithium-ion battery and likely involves advanced materials and doping strategies that alter electrode properties and voltage characteristics. These innovations place the battery in a novel category, explaining why it has faced disbelief and resistance from competitors. The author urges readers to move beyond speculation and trust Donut Lab’s disclosures, noting that while full engineering specifications are
energybattery-technologysolid-state-batteryhigh-temperature-batterylithium-ion-alternativeenergy-storagebattery-innovationRenewables And Fossil Fuels In Times Of War - CleanTechnica
The article from CleanTechnica discusses how the ongoing US/Israel conflict with Iran is significantly disrupting global energy and financial markets, intensifying the debate over the role of renewables versus fossil fuels in national energy strategies. It highlights contrasting approaches by major powers: China, under President Xi Jinping, has committed to reducing greenhouse gas emissions by 7-10% by 2035 and increasing non-fossil fuel energy sources to over 30%, signaling a strong push toward renewables. Conversely, former US President Donald Trump’s policies favored fossil fuel dominance, aiming to strengthen US petroleum production while limiting support for alternative energy, a stance now questioned amid rising gas prices and energy insecurity. The conflict has caused major disruptions, including the shutdown of key facilities in Qatar and Saudi Arabia and near halts in tanker traffic through the Strait of Hormuz, leading to increased natural gas prices and concerns over energy supply during harsh winter conditions. This environment has boosted interest in renewable technologies such as solar panels and heat pumps,
energyrenewable-energyfossil-fuelselectric-vehiclesclimate-changeenergy-marketsclean-energyDonut Lab Survives 100º C Test. Is That Good Enough? - CleanTechnica
The article discusses the ongoing controversy surrounding Donut Lab’s solid-state battery technology, which claims significant advancements such as an energy density of 400 Wh/kg—nearly double that of typical lithium-ion cells—a five-minute charge time, an operating temperature range from -30º C to 100º C, a 100,000 cycle lifespan, and the use of zero rare earth materials. To address skepticism, Donut Lab has published independent validation data from VTT, the Finnish state research institute, which conducted a series of tests on the battery’s performance, particularly at elevated temperatures of 80º C and 100º C. These tests involved applying mechanical pressure to the cell, charging and discharging it under controlled conditions, and measuring capacity retention and stability. Despite the promising data showing the battery performing better at higher temperatures than at room temperature, doubts remain in the industry. The article highlights that while Donut Lab’s new test results demonstrate the battery’s ability to operate under extreme heat and maintain
energysolid-state-batterybattery-technologyenergy-densityhigh-temperature-batterybattery-testingDonut-LabStrong Demand for Volvo EX60 Leads to Volvo Cars Expanding Production - CleanTechnica
Volvo Cars is experiencing strong demand for its new electric SUV, the EX60, prompting the company to expand production at its Torslanda plant in Sweden. This surge in orders, particularly from key European markets such as Sweden and Germany, has exceeded Volvo’s internal forecasts just a month after the vehicle’s public reveal. Notably, over 3,000 orders have been placed in Sweden alone, supported by a new Care offer that includes three years of free home charging, enhancing the appeal and simplicity of ownership. The EX60’s demand outpaces that of the smaller, lower-cost EX30 model launched a few years ago, despite the EX30 targeting a traditionally popular mass-market segment in Europe. In response to the unexpected high demand, Volvo is engaging with labor unions to potentially keep the Torslanda plant open for an extra week during the summer—a first in the company’s history—to increase production capacity while maintaining quality. The EX60 is currently only available in Europe, with plans to review and
energyelectric-vehiclesVolvo-EX60EV-productionclean-energysustainable-transportationautomotive-industryA Backup Battery For The Rest Of Us - CleanTechnica
The article "A Backup Battery For The Rest Of Us" by Zachary Shahan chronicles the author's long-standing interest in solar power and backup energy solutions, shaped by personal experiences with extended power outages in New England during the 1990s. After enduring weeks without electricity due to severe storms like Hurricane Bob, the Perfect Storm, the April Fool’s Blizzard, and an ice storm, Shahan initially relied on a gasoline generator despite its noise and fumes. Over time, as solar photovoltaic (PV) technology and battery storage became more accessible, he gradually moved toward adopting these cleaner energy options, purchasing a small 2-kilowatt PV system around 2015. In recent years, Shahan's attention shifted to portable battery systems reviewed on CleanTechnica, such as those from Bluetti, Jackery, and Anker Solix. After careful comparison, he chose the Anker Solix system, appreciating its technical support and product features. A key technical consideration was the compatibility of his existing solar
energybackup-batterysolar-powerphotovoltaicspower-outagerenewable-energyenergy-storageBill Gates-backed firm wins first-ever US permit for 345 MW reactor
The U.S. Nuclear Regulatory Commission (NRC) has granted the first-ever construction permit for a commercial-scale advanced nuclear reactor to TerraPower, a company backed by Bill Gates. The permit covers the Natrium reactor, a 345-megawatt sodium-cooled fast reactor planned for Kemmerer, Wyoming, near a retiring coal plant. This milestone marks the first time the NRC has approved construction of an advanced nuclear plant, signaling a significant regulatory breakthrough for next-generation nuclear energy in the U.S. TerraPower intends to begin construction soon, aiming for operation in the early 2030s. The Natrium reactor features a unique design that integrates a molten salt-based energy storage system, enabling the plant to boost output from its base 345 MW to 500 MW during peak electricity demand. This capability distinguishes it as the only advanced reactor with built-in grid-scale storage. The reactor will use high-assay low-enriched uranium (HALEU), with U.S. Department of Energy support
energynuclear-energyadvanced-reactorsTerraPowerenergy-storagemolten-salt-storageNatrium-reactorBig Tech Signs White House Data Center Pledge With Good Optics and Little Substance
Several major tech companies, including Microsoft, Meta, OpenAI, Google, Oracle, and Amazon, signed a nonbinding pledge at a White House event under the Trump administration, aimed at ensuring that the costs of data centers do not increase consumers’ utility bills. President Trump framed the pledge as a response to bipartisan concerns about rising electricity costs linked to data center expansion, emphasizing that tech companies should meet their own power needs, potentially by building their own power plants. The pledge aligns with ongoing initiatives by these companies to invest in renewable energy sources and collaborate with utilities, but it largely reiterates existing commitments rather than introducing new measures. However, experts and industry insiders criticized the pledge as largely symbolic, noting that meaningful protections for consumers would require action by utility regulators or Congress, not just voluntary commitments from tech firms. The nonbinding nature of the pledge and the private nature of utility contracts make it difficult to verify compliance or assess the real impact on electricity costs. Public opposition to data centers remains strong, with polls
energydata-centerselectricity-consumptiontech-companiesutility-billspower-managementenergy-policyAutomakers Drop Out of Carbon Credit Pool with Tesla - CleanTechnica
The article discusses recent shifts in the European Union’s carbon credit pooling arrangement involving Tesla and several major automakers. Tesla has historically earned billions from regulatory credits by selling zero-emission vehicles and pooling these credits with other automakers like Ford, Honda, Mazda, Subaru, Stellantis, and Toyota. This pooling allowed these companies to meet EU fleet carbon emissions targets by blending Tesla’s fully electric vehicle sales with their own, which might not have met the regulations independently. However, a recent EU regulatory change relaxed the 2025 fleet emissions requirements, allowing automakers to average their emissions over the 2025–2027 period instead of meeting the target strictly in 2025. As a result of this regulatory easing, some automakers, including Toyota, Stellantis, and Subaru, have opted out of the Tesla-centered credit pool, based on recent filings. These companies currently do not feel the need to pool credits with Tesla but could rejoin later if desired. Stellantis’s decision may be influenced by
energyelectric-vehiclescarbon-creditsemissions-regulationsautomotive-industryEU-fleet-emissionsTeslaNational energy corridor agreement brings Canada closer to a ‘United Canada’ grid - Clean Energy Canada
Ten Canadian provinces and territories have agreed to collaborate on developing new interprovincial transmission infrastructure to enhance electricity trade and maximize the use of clean power across the country. This initiative aims to strengthen Canada’s electricity grid, promoting energy sovereignty, competitiveness, and affordability by enabling the flow of low-cost renewable energy across regions. Improved long-distance transmission will reduce reliance on expensive fossil fuels, resulting in cost savings for both residential and industrial electricity consumers. Clean Energy Canada advocates for a "United Canada" grid, emphasizing the need to treat interregional transmission as a national priority with urgent federal support to unlock private investment and accelerate project development. The agreement’s signatories have committed to pushing for federal investment and a national electricity strategy, recognizing that while provinces must align their energy policies, federal involvement is crucial for financing and streamlining approvals. This collaboration represents a significant step toward realizing Canada’s potential as a clean energy superpower by creating a more integrated and efficient national electricity system.
energyclean-energyelectricity-gridrenewable-energyenergy-transmissionenergy-infrastructureCanada-energy-policySolid-state magnesium-air battery bends 120 degrees without leaks
Researchers at the University of Tsukuba in Japan have developed an all-solid-state magnesium-air rechargeable battery featuring a nitrogen-doped porous graphene cathode and a solid polymer electrolyte infused with magnesium chloride. This design addresses long-standing issues of chemical degradation caused by chloride ions in traditional magnesium-air batteries, which damage components and reduce performance over repeated cycles. The graphene cathode resists chloride attack while maintaining high catalytic activity for oxygen reactions, outperforming platinum-based cathodes. The solid-state electrolyte enhances safety and mechanical integrity by eliminating leakage risks associated with liquid electrolytes. The battery demonstrated remarkable flexibility, maintaining performance even when bent to 120 degrees without electrolyte leakage, suggesting potential applications in flexible electronics, wearable devices, electric vehicles, and stationary storage. By using magnesium—a more abundant and less costly metal than lithium or platinum—the technology could reduce supply chain risks and lower costs. This advancement offers a practical pathway toward durable, high-capacity magnesium-air batteries, potentially enabling safer and more affordable electrification compared to conventional lithium
energysolid-state-batterymagnesium-air-batterygraphene-cathodeflexible-batteryrechargeable-batterybattery-materialsScientists dig 2,600 feet underground to test ancient clay for nuclear waste storage
A team of international researchers led by Germany’s GFZ Helmholtz Centre for Geosciences has begun deep drilling beneath a mountain in Switzerland to evaluate the suitability of Opalinus clay (OPA) formations for long-term nuclear waste storage. The project, part of the DEBORAH initiative, targets the Mont Terri underground rock laboratory, where the team has completed the first 55 meters of drilling and plans to reach a depth of approximately 800 meters. Opalinus clay, dating back 175 million years to the Jurassic Period and found in Southern Germany and Switzerland, is considered a promising natural barrier due to its potential to isolate radioactive waste safely for thousands of years. The researchers are extracting cylindrical rock cores to analyze the interaction between the clay and surrounding rock layers with underground water systems, a critical factor for assessing the long-term stability of nuclear waste repositories. The Mont Terri site, operational since 1966 and used by multiple international partners, provides a unique environment to study these hydrogeological
energynuclear-waste-storagegeological-storageclay-materialsradioactive-wasteunderground-researchhydrogeologyTrump’s War on Iran Could Screw Over US Farmers
The article highlights the growing risk that escalating conflict in the Strait of Hormuz poses to global fertilizer supplies, which could severely impact American farmers during the critical spring planting season. The region is a major hub for exporting key fertilizer components—phosphates, nitrogen (including urea and ammonia), and potash. Recent drone strikes on Qatar LNG facilities have taken nearly 20% of the world’s natural gas supply offline, causing a spike in gas prices and forcing Qatar Energy to halt production of nitrogen fertilizers like urea. Iran, another major exporter of nitrogen fertilizers, is also involved in the conflict, further tightening supplies. Prices for urea in the US have already risen by nearly 15% in a week, and the blockade of the Strait of Hormuz is slowing exports from other regional producers. The situation is exacerbated by Saudi Arabia’s significant role in US phosphate imports, with other regional players like Jordan, Egypt, and Israel also contributing to the market. Some manufacturers are preemptively shutting
energyfertilizernatural-gasnitrogen-fertilizerglobal-supplyagricultureoil-and-gasMacBook Neo, iPhone 17e, and everything else Apple announced this week
Apple announced several new products this week, including a budget-friendly iPhone 17e, an upgraded iPad Air with the M4 chip, new MacBook Pro models with M5 Pro and M5 Max chips, and an updated MacBook Air with the M5 chip. The iPhone 17e, priced at $599 and available March 11, features the A19 chip, 256GB storage, improved wireless charging with MagSafe and Qi2, a 48MP camera, and a new C1X cellular modem that offers double the speed and better battery efficiency compared to its predecessor. It comes in black, white, and soft pink. The new iPad Air, powered by the M4 chip, is 30% faster than the previous M3 model and significantly faster than the M1 version, with enhancements aimed at AI performance, including a 12GB unified memory and increased memory bandwidth. It retains the $599 starting price for the 11-inch model and $
energyIoTmaterialswireless-chargingAI-chipsbattery-lifesemiconductor-technologyNext-Generation BYD Blade Battery & Flash Charging Debuts Tomorrow - CleanTechnica
BYD is set to launch its next-generation Blade Battery and Flash Charging technology on March 5th in Shenzhen, alongside several new EV models incorporating these advancements. The event is highly anticipated as a potential breakthrough in the electric vehicle (EV) industry, promising significant improvements such as more powerful 240 kW motors, reduced vehicle weight, longer driving ranges, and faster charging times comparable to traditional refueling. New models expected at the launch include updated versions of the Tang and Seal 08, with possible reveals of production versions of previously seen concept vehicles and enhanced intelligent driving features. This next-generation technology aims to disrupt the EV market by delivering vehicles that outperform many internal combustion engine (ICE) cars in efficiency, power, and cost. The launch also explains BYD’s recent sales dip in China, attributed to clearing old inventory and preparing for the new product rollout. The introduction of BYD’s flash charging platform is poised to accelerate the global transition from ICE vehicles by forcing competitors to innovate or collaborate, particularly
energybattery-technologyelectric-vehiclesflash-chargingBYDclean-energyEV-innovationOʻahu’s Real Energy System: Stripping Away Aviation, Shipping, & Military Demand - CleanTechnica
The article from CleanTechnica examines Oʻahu’s energy system by isolating local civilian energy demand from large-scale uses such as aviation fuel, maritime bunkering, and military logistics, which often dominate Hawaiʻi’s overall energy statistics. These sectors primarily support activities beyond the island economy, such as aircraft leaving the islands, ships crossing the Pacific, and national military operations. By narrowing the focus to energy that powers daily life on Oʻahu, the analysis highlights a more manageable system that local policies and infrastructure investments can influence directly. Hawaiʻi’s energy system is unique because each island operates an independent electricity grid with no inter-island electrical transmission, requiring separate analysis of supply, demand, and renewable resources per island. Oʻahu, home to about 70% of the state’s population and the main commercial hub, accounts for roughly 60-65% of statewide energy demand. The island’s energy flows are visualized using a Sankey diagram, showing primary energy inputs dominated by crude oil
energyrenewable-energyHawaii-energy-systemisland-energy-gridselectricity-generationenergy-infrastructuresustainable-energySchool Of The Nations Acquires Electric School Buses From BasiGo, Making It The First School In Kenya To Transition To E-Mobility - CleanTechnica
School of the Nations in Kenya has become the first school in the country to adopt electric school buses, marking a significant step toward sustainable student transportation. The school acquired its first electric bus from BasiGo, a pioneering East African startup specializing in electric public transport. BasiGo has already deployed 132 electric buses across the region, collectively avoiding over 4,500 tons of CO2 emissions and saving more than 1.6 million liters of diesel while transporting over 11 million passengers. The initial electric bus for the school is a refurbished 25-seat BYD model, previously used in Nairobi’s public transport system, demonstrating durability and safety at a more affordable price point than new vehicles. This transition aligns with the school’s commitment to sustainability and student well-being, offering clean, quiet transport while providing a practical example of environmental responsibility to students. BasiGo plans to deliver a total of 11 electric vehicles, including 10 Ma3E electric vans, to fully electrify the school’s transport
energyelectric-busese-mobilitysustainable-transportKenyaBasiGoemissions-reductionNew MacBook Neo arrives with A18 Pro chip and 16-hour battery life
Apple has launched the MacBook Neo, its most affordable MacBook to date, starting at $599 and targeting students, everyday users, and the education sector. The laptop features a vibrant color selection reminiscent of early 2000s iBooks and modern iMacs, weighs 2.7 pounds, and sports a 2408 x 1506 resolution display with up to 500 nits brightness. It includes a 1080p webcam, side-firing Dolby Atmos speakers, and a Touch ID sensor available only on the $699 model, which also upgrades storage to 512 GB. Powered by the A18 Pro chip—previously exclusive to the iPhone 16 Pro series—the MacBook Neo marks a shift in Apple’s chip strategy by placing an iPhone-class processor in a MacBook. Apple claims the device delivers up to 50% faster daily browsing performance than a leading Intel Core Ultra 5 PC laptop, with battery life up to 16 hours. To meet the
energybattery-lifeApple-A18-Pro-chiplaptop-technologyportable-computingconsumer-electronicsdisplay-technologyExperience Changes Perception - Bums on Seats! - CleanTechnica
The article "Experience Changes Perception - Bums on Seats!" from CleanTechnica recounts Marc Anderson’s personal experience taking his 78-year-old father on a 3,000+ kilometer road trip from Brisbane to Townsville in an Xpeng G6 electric vehicle (EV). Initially skeptical, his father expressed common concerns about EVs, including range anxiety, charging availability, and battery reliability. However, the trip demonstrated that these worries were largely unfounded. The route was carefully planned with charging stops that coincided naturally with breaks for food and rest, and the fast charging capabilities (up to 150kW) meant the vehicle was ready to go before they were, making charging stops convenient rather than disruptive. The journey also highlighted psychological barriers to EV adoption, such as the lack of familiar engine sounds and gear shifts, which initially made the father feel the car was slower than it actually was. Experiencing the EV’s smooth ride, handling, and rapid acceleration—comparable to high
energyelectric-vehiclesEV-chargingbattery-technologysustainable-transportationXpeng-G6road-trip-experienceNew Electric Boat To Banish Emissions From Offshore Wind Farms
The article discusses a significant development in the offshore wind industry aimed at eliminating emissions from the vessels that support offshore wind farms. While the electricity generated by offshore turbines is clean, the workboats used for construction and maintenance typically run on marine gasoil, a fossil fuel. Liverpool-based Bibby Marine is addressing this issue by introducing hybrid-electric Commissioning Service Operational Vessels (eCSOVs) designed to reduce operational costs and carbon emissions. These vessels use dual fuel generator sets to charge onboard batteries, enabling electric propulsion that can cut operational costs by up to 40% and save as much as $1 million annually. When offshore charging stations are available, these vessels can operate fully on electric power, potentially reducing costs by 70% and saving $1.8 million per year. Bibby Marine highlights that as electrification technology matures, capital costs for these vessels are becoming competitive, and shore power infrastructure is expanding. Offshore charging systems can be integrated into upcoming wind farm projects, offering operators a
energyoffshore-windelectric-boatsmarine-electrificationrenewable-energyhybrid-electric-vesselsclean-technologyPuget Sound Energy Is Paying Customers To Get Battery Systems - CleanTechnica
Puget Sound Energy (PSE) is incentivizing customers to install home battery systems by offering rebates through its Flex Batteries Program. Homeowners receive $75 per kWh of battery storage, up to $1,000, plus an additional $0.50 per kWh for participating in grid support events, up to $500 annually. This initiative aims to alleviate grid strain during peak energy demand periods and enhance grid stability in the Greater Seattle area by leveraging a network of distributed home batteries as a virtual power plant, potentially reducing the need for new natural gas peaker plants. The batteries promoted in this program are 15 kWh Lithium Iron Phosphate (LFP) units from FranklinWH, which can scale up to 225 kWh. Each battery weighs approximately 357-388 pounds and measures 45.2 x 29.5 x 11.8 inches, designed for wall or floor mounting. They come with a 15-year warranty and can be paired with home solar power systems
energybattery-storagelithium-iron-phosphatevirtual-power-plantrenewable-energyhome-energy-systemsenergy-rebate-programsUS coal mines to turn into underground water batteries with new method
Researchers at Oak Ridge National Laboratory (ORNL) have developed advanced hydrodynamic and chemical modeling tools that enable the repurposing of thousands of abandoned US coal mines into underground reservoirs for Pumped Storage Hydropower (PSH). This innovation addresses a key limitation of traditional PSH, which requires significant elevation differences typically found only in mountainous regions. By utilizing deep mine shafts as lower reservoirs, the approach allows energy storage facilities to be built in flatter areas, reducing construction costs and accelerating deployment timelines. This method offers a sustainable solution for long-duration energy storage essential for a carbon-neutral grid while revitalizing former mining communities. The ORNL team’s models also tackle significant technical challenges such as chemical erosion and structural stability within the chemically active and complex mine environments. These simulations predict how water interacts with native minerals to assess corrosion risks and ensure the integrity of mine walls under high-pressure water movement, mitigating potential fractures or collapses. Moving forward, the researchers plan to conduct comprehensive techno-economic and system efficiency analyses to
energyenergy-storagepumped-storage-hydropowerunderground-water-batterycoal-mine-repurposinghydrodynamic-modelingcarbon-neutral-gridNorway's hydrogen energy system to store summer solar power for winters
Norwegian startup Photoncycle has raised USD 17.5 million (EUR 15 million) in Series A funding to develop a seasonal solid-state hydrogen energy storage system that enables homes to store excess solar power generated in summer for use during winter. This technology addresses the critical challenge of long-duration, seasonal energy storage in renewable systems. The system, designed for distributed, household-level use, aims to reduce reliance on imported fossil fuels for heating, cut household energy bills, and enhance energy independence through a subscription model that includes solar panels, storage, servicing, and access to energy trading markets. Photoncycle plans to commercially launch the system first in Denmark and the Netherlands, with a manufacturing plant targeted to be operational by 2027, capable of providing seasonal storage for approximately 140,000 homes. The funding round was led by NordicNinja and Voima Ventures, with participation from other investors, supporting the initial phase of a planned expansion to a 1.4 terawatt-hour annual energy storage manufacturing
energyhydrogen-storagerenewable-energyseasonal-energy-storagesolar-powerenergy-transitionenergy-independenceWho needs data centers in space when they can float offshore?
The article discusses a novel approach to addressing the growing power demands of AI data centers by situating them offshore, leveraging consistent wind power and natural cooling from seawater. A startup plans to deploy a floating data center off the UK coast by 2028, powered by a 15-18 megawatt offshore wind turbine feeding a 10-12 megawatt data center. This offshore model offers several advantages: proximity to a reliable power source, reduced opposition from local communities concerned about noise and pollution, and simplified cooling due to cold seawater—an issue that is particularly challenging for proposed orbital data centers. However, the offshore environment also presents significant challenges, including the corrosive nature of seawater and the need to secure equipment against movement caused by waves. While submerged servers avoid direct wave impact, they must be robustly protected. The concept is not entirely new; Microsoft experimented with underwater data centers off Scotland in 2018, achieving low failure rates by using inert nitrogen gas to protect servers.
energydata-centersoffshore-windrenewable-energycooling-technologysustainable-infrastructureunderwater-serversUS swaps nuclear rods for control drums to advance next-gen reactors
Engineers at Idaho National Laboratory (INL) have achieved a significant advancement in the development of the MARVEL microreactor by successfully assembling and testing a novel Reactivity Control System (RCS) that replaces traditional vertical nuclear control rods with high-precision rotating control drums. Unlike bulky control rods that require vertical space, these compact drums rotate around the reactor core’s periphery, using reflective and absorber materials on opposite sides to finely regulate neutron flow and reactor power. This innovation is critical for MARVEL’s compact design—standing just 15 feet tall and 4 feet wide—enabling portability and rapid deployment while maintaining precise control of the reactor’s output. The transition from concept to hardware presented mechanical challenges, including higher-than-expected friction and backlash, which required redesigns such as larger gearheads and improved dampers to ensure rapid and reliable drum rotation, especially during emergency shutdowns (“scrams”). The RCS is built to rigorous NQA-1 nuclear quality standards and features tunability to
energynuclear-energymicroreactorreactor-control-systemenergy-innovationclean-energyadvanced-reactorsAptera rolls out first solar EV from assembly line, eyes certification
Aptera, a US-based solar mobility startup, has launched the first solar-powered electric vehicle (sEV) from its new 14-station assembly line in California, marking a significant transition from hand-built prototypes to a structured production process. This milestone supports the company’s efforts toward regulatory self-certification, EPA approval, and initial customer deliveries targeted for later this year. The vehicles from this validation line will undergo rigorous testing—including thermal, brake, and destructive tests—to ensure quality and compliance. The production process also enables optimization of assembly methods and station layouts, with the company expanding its manufacturing workforce to support this shift. After more than a decade of development and overcoming delays, Aptera’s sEV has demonstrated impressive efficiency and aerodynamic performance during real-world testing, including a coast-down test that outperforms conventional vehicles. The vehicle features integrated solar panels capable of generating up to 24 miles of daily range under ideal sunlight and offers up to 400 miles of range with fast charging in under an hour,
energysolar-energyelectric-vehiclessustainable-transportationvehicle-manufacturingenergy-efficiencyautomotive-technologyChina aims space solar plant to charge satellites and tame typhoons
China is advancing the Zhuri “Chasing the Sun” project, an ambitious initiative to build a space-based solar power station in geostationary orbit by 2030. This facility, envisioned as a kilometer-wide circular structure 36,000 kilometers above Earth, aims to generate gigawatt-level clean energy continuously, overcoming limitations of ground-based solar panels such as night cycles and weather. The project also plans to use high-frequency microwave beams not only to transmit energy back to Earth but potentially to influence weather patterns by heating atmospheric moisture, thereby taming typhoons by altering their intensity and paths. Beyond Earth-facing applications, the space solar station is designed to serve as a “space-based power bank” to wirelessly charge satellites, space stations, and deep-space probes, potentially extending mission lifespans and enabling future lunar bases and space internet networks. Since its start in 2013, the project has progressed from theory to practical milestones, including a 75-meter ground test tower and advancements
energysolar-powerspace-based-energywireless-power-transmissionclimate-interventionsatellite-chargingrenewable-energyCarmaker League Table Shows EV Supply Chains Are Becoming Even Cleaner — Thanks To Strong EU Rules - CleanTechnica
The fourth edition of the Lead the Charge Auto Supply Chain Leaderboard highlights significant progress among global automakers in creating cleaner, more sustainable electric vehicle (EV) supply chains. Driven largely by stringent EU regulations, particularly the Batteries Regulation, carmakers are increasingly adopting low-carbon materials like steel and aluminum, improving transparency, and engaging suppliers directly to address environmental and social impacts. Industry leaders such as Tesla, Volvo, Mercedes, Ford, and Volkswagen are advancing at twice the pace of other companies, with Tesla ranking first overall and Volvo leading in supply chain decarbonization. Notably, EU automakers (except Stellantis) dominate the top rankings, while some large manufacturers like Toyota and Chinese state-owned companies lag behind despite their scale. The report also underscores rapid improvements among Chinese automakers, with Geely emerging as a top East Asian performer by implementing best practices in battery decarbonization, recycling, and human rights. BYD, the largest EV maker globally, has begun establishing supplier codes of conduct
energyelectric-vehiclessupply-chaindecarbonizationsustainable-materialsautomotive-industryEU-regulationsHow Mass Distortion of Reality Occurs - CleanTechnica
The article from CleanTechnica explores the phenomenon of a consistent global community supporting fascist leaders, racism, xenophobia, fossil fuels, and a particular interpretation of Christianity that contradicts its core teachings of love and compassion. This pattern is observed across diverse regions including the US, Europe, the Philippines, Australia, and South America. The author questions why groups that are anti-immigration also tend to support fossil fuel industries and fascist ideologies, noting that these positions are often intertwined despite seeming contradictions. The article suggests that these beliefs are not purely based on logic but are deeply influenced by social communities, family, and early developmental experiences, which are further reinforced by online communities and social media algorithms that create echo chambers and reinforce specific narratives. The piece highlights how internet platforms enable people to form strong bonds within virtual communities that can sometimes surpass real-world connections, leading individuals down ideological "rabbit holes." These online and offline influences converge to create a shared worldview among extreme right-wing groups, aligning them on issues
energyfossil-fuelscleantechsocial-mediamisinformationpropagandaenvironmental-policyAptera Celebrates The 3-Wheeled Electric Vehicle Of The Future
Aptera, a solar-powered electric vehicle (EV) startup known for its innovative three-wheeled design, recently celebrated a significant milestone with the first vehicle rolling off its low-volume validation assembly line. This step marks progress toward full-scale production and is crucial for completing essential testing programs such as thermal validation, brake performance, and destructive testing. These tests support Aptera’s efforts to achieve regulatory self-certification, EPA certification, and ultimately deliver sellable vehicles. The validation line also helps the company refine its assembly process for greater efficiency as it expands its validation fleet. Founded in 2006, Aptera initially aimed to create an electric car powered by onboard solar panels but faced financial difficulties due to high battery and solar cell costs, leading to liquidation in 2011. The company revived in 2020 with a focus on producing an "autocycle," a three-wheeled vehicle that combines features of motorcycles and cars, requiring only a standard driver’s license in the U.S. Aptera
energyelectric-vehiclesolar-powerEV-batteriesrenewable-energyautomotive-technologyclean-energyAurora supercomputer harnesses AI to stabilize fusion plasma
The Aurora supercomputer at the U.S. Department of Energy’s Argonne National Laboratory is being leveraged to tackle the complex challenge of fusion energy by simulating plasma behavior inside tokamaks. As one of the world’s fastest exascale machines, capable of performing a quintillion calculations per second, Aurora enables researchers to model the extreme physics of plasma confined by magnetic fields at temperatures exceeding those of the sun’s core. This modeling is critical because plasma instabilities, such as magnetic islands and disruptions, can abruptly halt fusion reactions or damage reactor components. Aurora’s advanced computational power allows scientists to solve multi-dimensional equations representing trillions of particles, improving understanding of plasma flow and edge physics relevant to ITER, the international fusion project aiming to achieve 150 million degrees Celsius. In addition to simulations, Aurora is instrumental in training artificial intelligence models that predict imminent tokamak disruptions. Using extensive historical experimental data from facilities like DIII-D and the Joint European Torus, AI systems developed on Aurora can assign disruption risk
energyfusion-energysupercomputerAIplasma-simulationtokamakexascale-computingOver 3,000 One-Megawatt EV Charging Stations Planned By BYD For Europe - CleanTechnica
BYD plans to install over 3,000 ultrafast electric vehicle (EV) charging stations across Europe by the end of the year, each capable of delivering one megawatt (1,000 kW) of power. These chargers far exceed the typical ultrafast chargers currently available, which usually range between 180 kW and 350 kW. Theoretically, this could allow compatible EVs—primarily BYD, Zeekr, and Xpeng models, all Chinese brands—to gain over 200 miles of range in about five minutes. BYD’s strategy appears to be focused on outpacing competitors by offering extreme charging speeds combined with low-cost EV production to dominate the market. However, the article questions the practical necessity of such high charging speeds for most drivers, noting that even 250 kW chargers can feel too fast for some users who prefer longer breaks during charging stops. The move by BYD may be more about business strategy and market positioning than immediate
energyelectric-vehiclesEV-charging-stationsultrafast-chargersBYDrenewable-energyclean-technologyIs Climate Change Making This A Snowier Winter? - CleanTechnica
The article from CleanTechnica explores the paradox of a snowier winter in the US Northeast amid ongoing climate change. Despite general expectations that global warming leads to milder winters with less snow, regions like New England have experienced record-breaking snowfall in early 2026, including a blizzard comparable to the historic Blizzard of ’78. This has caused confusion and misinformation, exemplified by former President Trump’s claim that increased snowfall disproves global warming, which the article refutes as a climate falsehood. The key scientific explanation lies in the complex interplay between warming temperatures and atmospheric moisture. As the atmosphere warms, it holds more moisture—about 4% more per 1°F rise—which can result in heavier snowfall when cold Arctic air is present. While most US locations (64%) have seen a decline in snowfall since the 1970s, about 36% have experienced increases, particularly in coastal New England where sea surface temperatures, such as in the Gulf of Maine, have risen faster than
energyclimate-changesnowfallwinter-weatherglobal-warmingNOAAenvironmental-impactBLUETTI Elite 400 — Goldilocks of Portable Power Stations? - CleanTechnica
The BLUETTI Elite 400 portable power station is reviewed as a well-balanced, "Goldilocks" option—not too big or small—offering substantial energy storage and power capacity suitable for a variety of needs. Key specifications include a 3,840 Wh energy storage capacity, 2,600 W continuous power, 3,900 W surge power, and rapid charging from 0–80% in 70 minutes at 2,800 W. It features multiple output ports (4 AC outlets, USB-A, USB-C, and a cigarette lighter port) and weighs 86 pounds, making it the lightest 3.8 kWh power station available. Its design includes a suitcase-style handle and wheels for portability, and its discreet, speaker-like appearance allows it to blend into home environments comfortably. In practical use, the reviewer found the Elite 400 effective for powering multiple devices simultaneously, such as laptops, phones, and an Apple Watch, without issues. Battery drain was
energyportable-power-stationbattery-storagerenewable-energyclean-technologypower-capacityenergy-efficiencyThe Architecture of Deceit: How America is Repeating the Philippine Nightmare - CleanTechnica
The article "The Architecture of Deceit: How America is Repeating the Philippine Nightmare" reflects on parallels between the 1986 Philippine People Power Revolution and the January 6 Capitol insurrection in the United States. The author, a Filipina journalist with personal ties to both countries, recounts a contentious exchange with a Filipina MAGA supporter who equated the peaceful overthrow of Ferdinand Marcos with the violent Capitol attack, distorting historical facts. This confrontation highlights the spread of misinformation and the politicization of history, as well as the deep divisions fueled by populist and nationalist rhetoric in both nations. The author expresses concern over how populist distortions threaten democratic values and clean politics, emphasizing the need for truth and integrity, especially in the context of advocating for clean energy and environmental causes. The personal anecdote underscores broader themes of identity, immigration, and the challenges of navigating political discourse amid rising polarization. Ultimately, the piece warns against repeating historical mistakes and stresses that genuine progress requires confronting deceit and
energyclean-energyclimate-changeenvironmental-conservationwater-conservationsustainable-technologygreen-technologyHawaiʻi’s Energy Reality: Population, Petroleum, and the Island Divide - CleanTechnica
The article "Hawaiʻi’s Energy Reality: Population, Petroleum, and the Island Divide" from CleanTechnica examines the unique challenges of Hawaiʻi’s energy consumption and distribution, emphasizing the state's fragmented island grid system and its heavy reliance on petroleum-based fuels. Hawaiʻi consists of multiple electrically isolated island grids with no inter-island electricity transmission, meaning each island must independently generate and balance its electricity supply. However, liquid fuels such as gasoline, diesel, and aviation fuel are transported between islands and imported from global markets, creating an asymmetry between electricity and fuel distribution that is crucial for understanding energy demand and decarbonization strategies. Population distribution heavily influences energy consumption, with about 70% of Hawaiʻi’s 1.44 million residents living on Oʻahu. Yet, Oʻahu accounts for only about 60-65% of the state’s total energy demand, slightly less than its population share, due to factors like aviation, tourism, agriculture, and longer travel distances on neighbor
energyrenewable-energydecarbonizationisland-gridselectricity-transmissiontransportation-energyHawaii-energy-systemElectric "Love Bus" To Begin Operating On Its New Expanded Metro Manila Route - CleanTechnica
The electric "Love Bus" service in Metro Manila is expanding its route to include a new loop connecting Robinsons Galleria and Eastwood City, marking its first operation within a central business district corridor. Beginning Monday, ten additional Comet electric buses, each with a 30-passenger capacity, will operate daily from 6 a.m. to 9 p.m., potentially extending to 10 p.m. depending on demand. The rides will continue to be free. The new route focuses on high-traffic commercial and mixed-use areas along the Ortigas and C5 corridors, serving key locations such as Estancia Mall, MMDA headquarters, Arcovia Mall, and Eastwood City. This expansion follows a memorandum of agreement signed by the Metropolitan Manila Development Authority (MMDA) and Global Electric Transport (GET) Philippines, with support from private-sector sponsors including Robinsons Land Corporation, Megaworld Corporation, Ortigas Land, and International Solid Waste Integrated Management Specialist. The project exemplifies a public
energyelectric-busespublic-transportationsustainable-mobilityclean-energyemissions-reductionMetro-ManilaHow We Think About Energy Is Irrational. That's A Problem - CleanTechnica
The article from CleanTechnica critiques the prevailing mindset around energy, particularly the emphasis on fossil fuel "energy dominance," which it argues is irrational and counterproductive. It highlights that extracting, refining, and consuming fossil fuels like oil and methane is highly inefficient—only about 10 to 15% of the original energy content is effectively used, with the rest wasted. This wastefulness is not accidental but serves the interests of incumbent fossil fuel producers who profit from inefficiency and use those profits to maintain political influence. The article contrasts this with the efficiency and strategic advantages of renewable energy and electrification, noting that most businesses prefer renewables due to their efficiency, cost stability, and reduced geopolitical risks. Bill McKibben is cited to emphasize that government policies, such as those under the Trump administration, often promote fossil fuel use and exports under the guise of energy dominance, despite the inefficiency and environmental harm. This approach is at odds with sensible energy strategies that prioritize efficiency and sustainability. The article points
energyrenewable-energyfossil-fuelsenergy-efficiencyclean-energy-technologyenergy-policyenergy-wasteThe Gas Cult: The Real Religion Behind The Latest War In The Middle East - CleanTechnica
The article from CleanTechnica critiques the current U.S. approach to conflicts in the Middle East, particularly focusing on the recent military actions against Iran. It argues that rather than demonstrating strength, the U.S. is clinging to outdated 20th-century strategies centered on controlling oil resources through military force. This approach, described as the “Wrecking Ball” Doctrine, involves dismantling state infrastructure and leadership without plans for reconstruction, resulting in prolonged chaos and power vacuums that adversaries are well-positioned to exploit. A core problem identified is the U.S. cultural and political obsession with fossil fuels, which has become almost a "state religion" within certain political factions. This fixation drives policies that prioritize securing oil markets despite the country’s decreasing physical dependence on oil, sidelining more effective intelligence and strategies. Meanwhile, China is portrayed as capitalizing on the resulting instability by investing economically in destabilized regions through initiatives like the Belt and Road, thereby expanding its influence while the U.S.
energyfossil-fuelsMiddle-East-conflictoil-marketsglobal-economyenergy-securitygeopoliticsWe Must Prepare To Fight The Next PHEV Scam - CleanTechnica
The article from CleanTechnica warns about an impending regulatory loophole automakers may exploit with plug-in hybrid electric vehicles (PHEVs), particularly in the truck and SUV segments. Currently, manufacturers like GM and Stellantis lag behind competitors such as Honda in fleet fuel efficiency due to their focus on larger vehicles with lower miles per gallon (MPG). With recent relaxations in federal emissions mandates and reduced tax incentives, these automakers have delayed their transition to fully electric vehicles (EVs), prioritizing short-term profits from internal combustion engine (ICE) trucks. However, a potential political shift following the 2026 midterms could restore strict EPA emissions standards, pressuring automakers to comply without having adequately ramped up battery production for full EVs. Automakers are expected to push PHEVs as a regulatory “cheat code” because the EPA’s fleet average calculations use a harmonic mean that heavily favors vehicles with even modest electric capability. By distributing limited battery capacity across many PHEVs instead
energyelectric-vehiclesPHEVbattery-technologyemissions-regulationsautomotive-industryclean-energyThe Hybrid Electric Train: The Train The Philippines Built & The Industry That Never Followed - CleanTechnica
The article details the development and legacy of the Philippines' Hybrid Electric Train (HET), a locally engineered five-coach train introduced in 2016 by the Department of Science and Technology (DOST) through its Metals Industry Research and Development Center (MIRDC). The HET was a milestone project aimed at demonstrating Filipino capability in designing and building complex rolling stock, moving beyond the Philippine National Railways' (PNR) long-standing reliance on aging, secondhand diesel trains from Japan. The hybrid design combined a diesel engine powering a generator with electric traction motors and regenerative braking, offering a practical transitional technology between diesel and fully electrified rail systems, which the country did not yet possess. Despite completing a 5,000-kilometer validation run and entering limited commercial service in 2019, the HET did not proceed to mass production or establish a domestic rail manufacturing industry. The project highlighted institutional challenges, including cautious operational assessments by PNR management focused on safety, maintenance, infrastructure compatibility
energyhybrid-electric-trainrail-technologyregenerative-brakingsustainable-transportationlocal-engineeringPhilippinesApple unveils new MacBook Air and MacBook Pro with M5
Apple has announced new MacBook Air and MacBook Pro models powered by its latest M5 chips, which feature Apple’s most advanced CPU cores to date. These chips are optimized for intensive AI tasks, delivering up to four times faster AI processing compared to the previous M4 chips. While casual users may not immediately notice these AI-centric improvements, the upgrades enhance overall performance, including faster 3D rendering and video editing capabilities. The MacBook Air offers up to 18 hours of battery life—an improvement of six hours over the last Intel-based models—and includes a 12MP Center Stage camera, a three-mic array, Spatial Audio with Dolby Atmos support, two Thunderbolt 4 ports, MagSafe charging, and a headphone jack. The Air comes in 13-inch and 15-inch versions, starting at $1,099 and $1,299 respectively, with new color options and a doubled base storage of 512GB. The MacBook Pro models, aimed at professional and technical
energybattery-lifeAI-chipsMacBook-AirMacBook-ProM5-chipThunderbolt-4Pockets of the Future: How Clean Tech Is Already Outrunning Fossil Fuels - CleanTechnica
The article "Pockets of the Future: How Clean Tech Is Already Outrunning Fossil Fuels" by Michael Barnard discusses the global acceleration of clean technologies and decarbonized solutions, focusing on how proven innovations can be scaled and diffused to new regions without reinventing them. Barnard emphasizes the concept that "the future is already here, it’s just unevenly distributed," highlighting his approach of identifying successful clean tech "pockets of the future" worldwide and applying those solutions where conditions allow. This method helps overcome local resistance such as the "not-invented-here" syndrome and NIMBYism, facilitating faster adoption of clean technologies. A key example Barnard presents is the use of mass timber construction in Canada, particularly a new 12-story, 500-bed student residence at BCIT. Mass timber, a highly engineered wood product, offers significant advantages over traditional concrete, including greater strength-to-weight ratio, factory precision, and the ability to add floors on existing buildings
energyclean-technologydecarbonizationmass-timbersustainable-materialsconstruction-innovationgreen-buildingFerry Pollution Worse than Cars in Many European Port Cities - CleanTechnica
A recent study by Transport & Environment (T&E) reveals that ferries in European port cities emit more CO₂ and toxic air pollutants than millions of cars, posing significant environmental and public health challenges. In 2023, 1,043 ferries across Europe emitted 13.4 million tonnes of CO₂, equivalent to the emissions of 6.6 million cars. Major port cities like Barcelona, Dublin, and Naples experience ferry-related sulfur oxide (SOx) pollution levels exceeding those from all cars in those cities combined. Dublin is currently the most polluted ferry port in Europe, with Las Palmas expected to take this position by 2027 due to new emission regulations in the North-East Atlantic. The study highlights that the average European ferry is 26 years old, indicating an urgent need for fleet renewal. Electrification presents a promising solution, as ferries are relatively easy to convert to battery power due to their fixed routes and smaller size. T&E estimates that over 60% of Europe's
energyelectric-ferriesCO2-emissionsair-pollutionmaritime-transportbattery-poweremission-regulationsItaly building advanced 1,600 ton submarines to replace old vessels
Italy has commenced construction of advanced submarines to modernize its naval fleet, replacing aging vessels from the 1980s. The first keel-laying ceremony was held for the U212 Near Future Submarine (U212 NFS) at Fincantieri’s Muggiano shipyard. The initial submarine, designated NFS1 S530, began construction in 2022 and is expected to enter service by 2029, with the full four-submarine program slated for completion by 2032. These new submarines represent a significant technological leap over the previous U212A class, featuring enhanced Italian technological integration, improved stealth, endurance, operational efficiency, and cyber resilience. Key innovations include the use of lithium-ion propulsion batteries, a new-generation combat system with advanced command and weapon control, and design improvements such as an extended pressure hull and redesigned combat information center. The submarines will displace 1,600 tons, measure approximately 59 meters in length, accommodate a crew of
energylithium-ion-batteriessubmarine-technologynaval-engineeringadvanced-materialspropulsion-systemsenergy-storage-systems270-year-old physics trick leads to affordable sodium battery tech
Researchers from institutes in India, Australia, and the UK have developed a novel cathode material for sodium-ion batteries by leveraging a 270-year-old physics phenomenon known as the Leidenfrost effect. Their innovation centers on creating an "atomic highway" inside the cathode to facilitate rapid and repeated movement of sodium ions without damaging the battery structure. They used an iron-based phosphate-pyrophosphate compound, Na₄Fe₃(PO₄)₂(P₂O₇), which naturally forms a stable three-dimensional tunnel-like structure ideal for sodium ion flow. To enhance conductivity, they substituted 1% of iron atoms with indium, increasing atomic spacing and enabling easier ion movement. In addition to improving the cathode composition, the team employed the Leidenfrost effect—a phenomenon where droplets hover on a vapor cushion over a hot surface—to synthesize the cathode material in an environmentally friendly, furnace-free process. This method produced fused porous particles that absorb electrolyte fluid efficiently, ensuring smooth sodium
energysodium-ion-batterycathode-materialenergy-storageclean-energybattery-technologymaterials-scienceRolls-Royce F130 engine passes key tests to power US B-52J bomber
Rolls-Royce has successfully completed critical altitude and operability tests for its F130 engine, which is set to replace the Pratt & Whitney TF33 engines on the US Air Force’s Boeing B-52J Stratofortress bomber. Conducted at the Arnold Engineering Development Complex in Tennessee, these tests demonstrated the F130’s capability to perform long-duration, high-altitude missions and maintain stability under realistic flight conditions. Boeing also verified the engine’s Integrated Drive Generator for reliable electrical power. With testing concluded on time and within budget, Rolls-Royce will now proceed to system integration and dual-pod testing at NASA’s Stennis Space Center. Designed for long life and low maintenance, the F130 engine aims to reduce sustainment costs and simplify logistics through full interchangeability in the B-52J’s dual-pod configuration. Rolls-Royce plans to manufacture the engine at its Indianapolis facility, reflecting over $1.5 billion invested in US operations over the past decade. The US
energyaerospace-engineeringjet-engineRolls-RoyceB-52J-bombermilitary-technologypropulsion-systemsScotland becomes first UK nation to legalize water cremations
Scotland has become the first UK nation to legalize alkaline hydrolysis, or “water cremation,” marking the first new funeral option in the region since 1902. This process offers an environmentally friendly alternative to traditional burial and flame-based cremation by using a pressurized chamber with hot water and alkaline chemicals to accelerate natural decomposition. The body is wrapped in a biodegradable shroud, and after several hours, only bone fragments remain, which are then processed into a fine powder and returned to families in an urn. The Scottish government emphasizes that this method will be regulated with the same strict standards as existing funeral practices, though it may take up to nine months before the first facility opens due to planning and regulatory requirements. Alkaline hydrolysis is already legal in 28 U.S. states and several other countries, and it is praised for its significantly lower carbon emissions—reducing CO2 output by about seven times compared to traditional cremation. The process also avoids toxic air emissions and the need for
energysustainable-technologyalkaline-hydrolysiseco-friendly-cremationenvironmental-impactfuneral-innovationcarbon-emissions-reductionIran's missile power and Hormuz disruption raise global energy stakes
The reported killing of Iran’s Supreme Leader Ayatollah Ali Khamenei in U.S. and Israeli airstrikes marks a critical escalation in the conflict, forcing Tehran to choose between measured retaliation and broader regional warfare. Despite significant damage, Iran’s Islamic Revolutionary Guard Corps (IRGC) remains a potent threat, possessing hundreds to thousands of domestically produced short- and mid-range missiles and drones capable of striking U.S. and allied bases across the Middle East, including in Qatar, Bahrain, the UAE, Iraq, and potentially Israel. Historically, Iran’s retaliatory strikes have been limited in casualties, but with Khamenei’s death, the IRGC may adopt a more aggressive posture, potentially employing saturation missile attacks that could overwhelm defenses, disrupt critical infrastructure, and escalate regional tensions. A key strategic focus for Iran is the Strait of Hormuz, a vital chokepoint through which 20-25% of global oil trade passes daily. Iran has long threatened to disrupt this waterway,
energymissile-technologyIranStrait-of-Hormuzoil-trademilitary-conflictregional-securityFrance to expand nuclear arsenal, extend protection to European allies
France announced a major shift in its nuclear defense policy, expanding its nuclear arsenal and extending elements of its protection to European allies amid growing security tensions. President Emmanuel Macron revealed plans to increase the current stockpile of about 300 nuclear warheads, though France will no longer publicly disclose the total number. A key component is the development of a new nuclear-armed submarine, The Invincible, set to launch in 2036, enhancing France’s sea-based deterrent. Macron emphasized that nuclear strike authority remains centralized under the French president, with no automatic nuclear guarantees to partner countries; the strategy focuses on deterrence by signaling a high cost to any attack on France. Eight European nations— the UK, Germany, Poland, the Netherlands, Belgium, Greece, Sweden, and Denmark—have joined an “advanced deterrence” framework, allowing participation in French nuclear exercises and potentially hosting French nuclear-capable bombers. This initiative aims to complicate adversaries’ strategic calculations by dispersing French nuclear forces across Europe
energynuclear-energydefense-technologysubmarine-technologystrategic-deterrencemilitary-materialsEuropean-securityNuclear Reactor Restart in Japan Will Likely Displace Natural Gas Electricity Generation - CleanTechnica
On February 9, 2026, Japan restarted Unit 6 of the Kashiwazaki-Kariwa Nuclear Power Station, its largest nuclear plant, which had been offline since the 2011 Fukushima disaster. This reactor, with a capacity of 1,356 MW, is expected to produce about 9,500 gigawatthours annually once fully operational, likely by mid-March. The restart marks Tokyo Electric Power Company’s (TEPCO) first reactor to resume operations after mandatory safety inspections and upgrades. The increased nuclear generation is projected to displace significant fossil fuel use, primarily natural gas, which accounted for 33% of Japan’s electricity generation in 2024. Specifically, Unit 6 could reduce liquefied natural gas (LNG) imports by approximately 1.3 million tons annually, equivalent to 62 billion cubic feet of natural gas. Japan currently operates 15 nuclear reactors with a combined capacity of 33 gigawatts, generating 83 ter
energynuclear-powerelectricity-generationnatural-gasLNG-importsJapan-energy-policyrenewable-energySierra Club Endorses John Cavanaugh for Congress - CleanTechnica
The Sierra Club has officially endorsed State Senator John Cavanaugh in his 2026 campaign for Nebraska’s Second Congressional District seat in the U.S. House of Representatives. The endorsement highlights Cavanaugh’s strong environmental record, including his advocacy for clean energy, public health, and opposition to polluting industries. As a state senator, he introduced the Affordable American Energy and Jobs Act (LB 1186), aimed at promoting renewable energy projects, creating local jobs, and addressing energy affordability. The Sierra Club praised his efforts to protect Nebraska’s natural resources, such as the Ogallala Aquifer and local rivers, and his support for cleaning up pollution from facilities like the Alt En ethanol plant. In addition to endorsing Cavanaugh, the Sierra Club pledged to mobilize its volunteer base to support his campaign through voter outreach and public advocacy, emphasizing their commitment to electing leaders who prioritize environmental protection and clean energy. The organization framed Cavanaugh as a necessary champion against federal rollbacks on environmental protections and climate action
energyclean-energyrenewable-energyenvironmental-protectionclimate-actionsustainable-energyenergy-policyNew Berkshire Hathaway CEO Ignores Financial Risks of Fossil Fuels in First Letter to Shareholders - CleanTechnica
In his first letter to shareholders as Berkshire Hathaway CEO, Greg Abel acknowledged challenges such as rising electricity demand and increasing wildfires that affect affordable and reliable energy delivery. He emphasized the CEO’s role as Chief Risk Officer, highlighting the importance of managing risks to the company. However, Abel did not address the financial risks posed by Berkshire Hathaway’s significant fossil fuel investments, particularly coal plants, which contribute to climate change and exacerbate wildfire severity. This omission is notable given that PacifiCorp, a Berkshire Hathaway subsidiary, has already been held liable for over $1 billion in damages related to Oregon wildfires in 2020. Environmental advocates, including Emma Colman of the Sierra Club, criticized Abel for failing to recognize climate risk as a financial risk. The Sierra Club, a leading grassroots environmental organization, called for Berkshire Hathaway to accelerate its transition to cleaner energy and retire its coal plants to protect both shareholder value and customer interests. The article underscores the tension between Berkshire Hathaway’s current energy portfolio and the growing imperative
energyclean-energyfossil-fuelsclimate-riskcoal-plantswildfire-impactBerkshire-HathawayDid Tesla Just Pull in a Year's Worth of Orders for the Cybertruck? - CleanTechnica
The article from CleanTechnica discusses a recent surge in Tesla Cybertruck orders following a temporary price reduction on the base all-wheel-drive (AWD) model. Originally unveiled seven years ago with a starting price of $49,990, the Cybertruck's base price was briefly lowered to about $59,990 before rising again. This short-term discount appears to have triggered a significant influx of orders, pushing the estimated delivery date from June 2016 to April 2017, effectively filling roughly a year’s worth of production capacity. Despite this surge, the actual volume of orders is relatively modest in the context of Tesla’s broader goals. Assuming Tesla produces about 2,000 Cybertrucks per month—based on last year’s sales of approximately 20,000 units—the backlog likely represents around 20,000 to 30,000 vehicles. This figure falls far short of Elon Musk’s ambitious annual sales target of 150,000 to 250,000 units. Moreover, with the
energyelectric-vehiclesTeslaCybertruckclean-technologysustainable-transportationautomotive-energy-storageThe Falling Cost Gap Between EU & Chinese Batteries - CleanTechnica
The article from CleanTechnica discusses the narrowing cost gap between European Union (EU) and Chinese battery production, emphasizing the importance of “Made-in-EU” criteria in public funding to support local battery manufacturing. Currently, EU-made batteries are significantly more expensive—about 90% higher than Chinese batteries—primarily due to limited economies of scale rather than inherent structural disadvantages. The analysis highlights that scaling up production within Europe, supported by policies such as the Industrial Accelerator Act (IAA), can reduce costs by nearly one-third through improved manufacturing efficiency, labor proficiency, and automation. By 2030, the cost difference could shrink to approximately $14/kWh from the current $41-43/kWh, translating to an additional €300-750 per electric vehicle, which is framed as a sovereignty premium ensuring economic security and resilience against geopolitical risks. The article stresses that access to batteries, components, and critical minerals is vital for Europe’s economic security, especially given vulnerabilities to trade weaponization seen with rare
energybatterieselectric-vehiclesEuropean-Unionmanufacturing-scalesupply-chain-resiliencebattery-materialsThe New War of the Currents - CleanTechnica
The article "The New War of the Currents" from CleanTechnica draws a parallel between the historic battle over electrical power standards between Edison’s Direct Current (DC) and Tesla’s Alternating Current (AC) and the current debate surrounding bidirectional charging technology in electric vehicles (EVs). EVs, acting as mobile batteries, have the potential to support electricity grids by storing renewable energy and feeding it back when needed, a concept known as vehicle-to-grid (V2G). Despite promising pilot projects by companies like Octopus, BYD, EON, BMW, Mobilize, and Renault, widespread adoption of V2G is hindered by a lack of standardization in charging technology. The core issue lies in the incompatibility between the grid’s AC power and the EV battery’s DC power, requiring inverters to convert electricity flow directionally. Some manufacturers, such as Renault and BYD, integrate bidirectional inverters within the car, enabling affordable AC wallbox chargers to handle V
energyelectric-vehiclesvehicle-to-gridbidirectional-chargingrenewable-energyenergy-storageelectric-gridWhen 70% Of Stations Go Dark: The Fragility Of California’s Hydrogen System - CleanTechnica
The article discusses the fragility of California’s hydrogen refueling infrastructure, highlighted by a recent fatal explosion involving a pressurized hydrogen tanker truck in Colton, California. This tragic incident resulted in one death and one serious injury, leading to a pause in compressed hydrogen delivery operations linked to the site while investigations continue. The disruption exposed the vulnerability of California’s hydrogen supply chain, which relies heavily on centralized production and truck delivery to a relatively small network of about 50 public hydrogen stations. Currently, approximately 70% of these stations are offline, with around 40% explicitly out of fuel and many others affected by mechanical issues or unspecified reasons, leaving only about 15 stations operational. The article draws parallels to a similar incident in Germany in 2024, where an explosion at a hydrogen facility caused a weeks-long disruption affecting roughly 25% of the country’s hydrogen refueling stations. Despite Germany’s larger network, the centralized production and limited redundancy in delivery created significant operational fragility. California’s situation
energyhydrogen-fuelfuel-cell-vehicleshydrogen-infrastructureenergy-logisticsrenewable-energyenergy-storageMake America Car Pool Again
The article "Make America Car Pool Again" discusses the decline and potential resurgence of carpooling in the United States amid rising fuel and electricity costs. Historically, carpooling gained popularity during periods of economic hardship and fuel crises, peaking around 1980 when nearly 25% of Americans participated. However, by 2019, carpooling had significantly declined to about 9%, partly due to competition from ride-hailing services like Uber and Lyft and changing commuting patterns accelerated by the COVID-19 pandemic. Despite these challenges, transportation stakeholders such as TransAction have sought to revive carpooling through initiatives like carpool matching services and promoting informal systems like "slugging" and "Casual Carpool." Recent developments suggest a renewed interest in carpooling driven by economic pressures such as rising gasoline prices, increasing electricity costs from AI data centers, and new urban policies like congestion pricing and higher tolls in metropolitan areas. The article also highlights how carpooling has historically served as a
energycarpoolingtransportationfuel-conservationelectric-vehiclesride-sharinghigh-occupancy-vehicleFrom Subsidies to Scrap: The Real Story of Hydrogen Vehicle Fleets - CleanTechnica
The article from CleanTechnica examines the challenges and realities facing hydrogen vehicle fleets, particularly buses and heavy vehicles, as subsidies wane and operational difficulties mount. Several cities, including Aberdeen, a German municipality, Paris, and Liverpool, have experienced failures or abandonment of hydrogen bus programs due to high operating costs, unreliable refueling infrastructure, and the lack of truly low-carbon hydrogen. In contrast, battery electric buses are proving to be more cost-effective, reliable, and suitable for fleet operators. The article highlights that hydrogen buses, while fundamentally electric vehicles with fuel cells and hydrogen tanks added, face structural and financial hurdles that complicate their continued use and resale value. A key issue discussed is the potential and challenges of converting hydrogen fuel cell buses to battery electric vehicles. Although technically feasible—since both share electric drivetrains—conversion requires removing expensive hydrogen components, reinforcing vehicle structures, installing large battery packs, and re-certifying the vehicles. Conversion costs, estimated between $300,000 and $500,000
energyhydrogen-vehiclesfuel-cell-technologybattery-electric-buseselectric-transportationclean-energyvehicle-conversionTesla Germany Operating At 40 Percent Capacity — Handlesblatt - CleanTechnica
The article from Handelsblatt, cited by CleanTechnica, reports that Tesla’s Gigafactory in Grünheide, Germany, is operating at less than 40 percent capacity in 2025, producing approximately 149,040 vehicles—significantly down from 211,235 in 2023 and 192,801 in 2024. This represents a utilization rate of about 39.7 percent against the factory’s designed capacity of over 375,000 vehicles annually. The reported profit margin for 2025 was very low at 0.74 percent. These figures have raised concerns about the plant’s performance and future, especially amid tensions involving the workers’ union IG Metall, which Tesla management views as a threat to its operations and expansion plans. Elon Musk reportedly stated that while the factory will not close, expansion is unlikely unless it remains free from union influence. Tesla’s plant manager, André Thierig, strongly disputed Handelsblatt’s report, accusing the publication of biased and un
energyTeslaGigafactoryelectric-vehiclesbattery-productionautomotive-manufacturingrenewable-energyVTT test confirms Donut Lab cells hit 110% capacity in extreme heat
Finnish startup Donut Lab has released independent test results from the VTT Technical Research Centre of Finland, demonstrating that its solid-state battery performs exceptionally well under extreme heat conditions. Unlike traditional lithium-ion batteries, which typically degrade or face safety risks above 60–70°C (140–158°F), Donut Lab’s battery maintained high capacity and efficiency at 80°C (176°F) and 100°C (212°F). Specifically, the battery delivered about 110% of its rated capacity at 176°F and around 107% at 212°F, with no visible damage and stable recharge performance. This resilience is attributed to the battery’s design, which excludes flammable liquid electrolytes, allowing for a higher maximum operating temperature and enhanced safety. These results come amid skepticism from industry experts and competitors who questioned Donut Lab’s earlier claims of breakthrough performance and production readiness, with some labeling the technology as potentially overstated. In response, Donut Lab has shifted its approach by commissioning and publicly
energysolid-state-batteryhigh-temperature-performancebattery-technologyenergy-storagebattery-testingthermal-stabilityPhotos: 2026 Chevrolet Corvette ZR1X outpaces $4M Ferrari and McLaren under $210K
The 2026 Chevrolet Corvette ZR1X represents the pinnacle of the C8 Corvette platform, combining a 5.5-liter twin-turbo V8 engine producing 1,064 horsepower with a front-mounted electric motor adding 186 horsepower and 145 lb-ft of torque. This hybrid setup delivers a total output of 1,250 horsepower and features an all-wheel-drive system with an eight-speed dual-clutch transmission. The ZR1X achieves remarkable performance figures, including a 0-60 mph time as low as 1.68 seconds on prepared surfaces and a quarter-mile time of 8.675 seconds at 159 mph. It can reach top speeds between approximately 225 mph and 233 mph depending on aerodynamic configuration. Beyond straight-line speed, the electric motor enhances handling by reducing understeer and improving front-end grip, remaining active up to 160 mph. This contributes to a more manageable and controllable power delivery, smoothing torque delivery during turbo spool-up and allowing
energyhybrid-powertrainelectric-motorautomotive-technologyhigh-performance-vehiclescarbon-ceramic-brakesall-wheel-drivePressure-free solid batteries achieve liquid-like conductivity
Chinese researchers have developed a flexible composite solid electrolyte for all-solid-state lithium batteries that achieves ionic conductivity comparable to liquid electrolytes while operating without external pressure. This innovation addresses a key challenge in solid-state batteries, which traditionally face a trade-off between fast ion transport and mechanical stability. The new electrolyte features a layered composite structure with alternating sheets of perpendicularly aligned inorganic nanosheets (LixMyPS3, where M is Cd or Mn) and polyethylene oxide polymer layers. The inorganic layers provide continuous superionic pathways for ion conduction, while the polymer layers offer mechanical flexibility and maintain close electrode contact, enabling liquid-like ionic conductivity (up to 10.2 mS cm⁻¹ at 25°C) without the need for heavy stack pressure. The pressure-free operation simplifies battery design by eliminating the need for complex clamping systems, potentially reducing manufacturing complexity and cost. The researchers demonstrated the electrolyte's performance in working battery cells, including Li||LiNi0.8Co0.1Mn0
energysolid-state-batteriessolid-electrolytesionic-conductivitybattery-materialslithium-batteriesbattery-safety14 New EV Chargers Installed At Dollywood - CleanTechnica
The article highlights the recent installation of 14 new electric vehicle (EV) charging ports at Dollywood, an amusement park located near the Great Smoky Mountains National Park in rural Tennessee. This development is significant because it represents the expansion of EV infrastructure beyond traditional urban coastal areas into more rural and red-state regions, which have historically been slower to adopt EV technology. The Great Smoky Mountains National Park is the most visited national park in the U.S., attracting over 12 million visitors annually, making the addition of EV chargers at nearby Dollywood particularly impactful for supporting EV drivers traveling in the area. In addition to the 14 EV charging ports, Dollywood also installed 10 solar-powered umbrella charging units, further promoting sustainable energy use. The presence of these chargers not only facilitates longer-distance travel for EV owners but also raises public awareness of EV technology among millions of visitors. The article underscores that while the number of chargers may seem modest, their strategic placement in a rural tourist destination helps fill critical gaps in
energyelectric-vehiclesEV-chargersrenewable-energysolar-powersustainable-transportationclean-energy100% Electric Vehicles = 20% Of New Car Sales In Europe In January - CleanTechnica
In January 2026, electric vehicles (EVs) continued to gain significant traction in Europe, with battery electric vehicles (BEVs) accounting for 20% of new car sales—a notable increase from 17% in 2025 and 12% in January 2024. The overall passenger plugin vehicle market grew 22% year-over-year (YoY) to 298,000 registrations, driven by a 16% YoY rise in BEVs to 195,000 units and a 33% YoY surge in plugin hybrids (PHEVs) to 102,000 units, marking the highest January growth for PHEVs since 2021. Meanwhile, traditional petrol and diesel vehicles saw steep declines of 26% and 22% respectively, while plugless hybrids increased their market share from 35% to 39%. Overall, 69% of new passenger vehicles sold were electrified in some form, up from 59% a year earlier, suggesting
energyelectric-vehiclesBEVplug-in-hybridsautomotive-marketclean-technologyEuropeWar & Oil - Falllout From The Attack On Iran - CleanTechnica
The article "War & Oil - Fallout From The Attack On Iran" from CleanTechnica discusses the recent U.S.-endorsed attack on Iran, highlighting concerns about the lack of a clear strategic plan from American leadership. Lindsey Graham’s remarks on Meet The Press reveal uncertainty about the future of Iran and the U.S. role in shaping it, with Graham emphasizing that the outcome depends on the Iranian people rather than a defined U.S. strategy. The article criticizes this absence of planning as dangerously negligent, especially given the human costs of war. Economist Paul Krugman’s analysis is also featured, drawing parallels between the current conflict and the 1979 Iranian Revolution, which triggered severe economic consequences like oil embargoes, soaring energy prices, and inflation. Krugman notes that while Iran remains a significant oil producer, its share of global oil production is relatively modest, suggesting the direct impact on oil prices might be less severe now than in 1979. However, he warns that the broader
energyoilgeopoliticsMiddle-East-conflicteconomic-impactOPECenergy-pricesWar in Iran Spiked Oil Prices. Trump Will Decide How High They Go
The article discusses the recent surge in oil prices triggered by escalating tensions and attacks in the Iran region, with Brent crude prices jumping nearly 13% to almost $80 a barrel. The key factor influencing future price movements is how the White House, under President Trump, manages the conflict and how Iran and other oil producers respond. Iran’s control over the Strait of Hormuz—a critical shipping route through which one-fifth of the world’s oil passes—adds significant risk to global oil supply. Although the strait has not been officially closed, a near halt in traffic and increased attacks on ships have created a "voluntary closure," raising concerns about supply disruptions. Experts highlight that typical OPEC responses, such as increasing production to stabilize prices, may be less effective given the geographic concentration of the conflict. Past incidents, like the 2019 drone attacks on Saudi oil facilities blamed on Iran, demonstrate how targeted strikes on infrastructure can cause sharp price spikes. Analysts warn that if Iran escalates its use of
energyoil-pricesIran-conflictOPECStrait-of-Hormuzdrone-strikesoil-infrastructureUS President Trump Makes Renewable Energy Great Again
The article discusses how US President Donald Trump’s recent escalation of conflict with Iran has disrupted global oil supply chains, causing oil prices to surge and increasing costs for American consumers. This geopolitical tension has inadvertently strengthened the case for renewable energy, which, unlike during previous Middle East conflicts under Presidents George H.W. Bush and George W. Bush, is now more technologically advanced and mainstream. Wind and solar power have significantly improved in efficiency, supported by advances in electrification technologies such as heat pumps, distributed energy storage, and smart grid systems that enable two-way electricity flow and integration with distributed energy resources like EV chargers and home batteries. The article also highlights the evolution of electric vehicles (EVs) as a key factor in the renewable energy transition. While EVs were scarce and expensive in the 1990s, federal investments during the Obama administration helped reduce costs and increase adoption. Under President Biden, EVs became mainstream with incentives like the $7,500 tax credit introduced in 2022. However,
energyrenewable-energysolar-powerwind-energyelectric-vehiclesenergy-storagegrid-technologyBYD Sales Crash Hard in February — CHARTS - CleanTechnica
In February 2026, BYD experienced a significant decline in sales across multiple vehicle categories, continuing a downward trend seen in the broader Chinese electric vehicle (EV) market. Pure electric passenger vehicle sales dropped 36.3% year over year to 79,539 units, and combined January-February sales were down 35% compared to the same period last year. Plugin hybrid (PHEV) sales fared worse, falling 44% in February and 36.7% over the first two months, totaling 108,243 units in February. Overall new energy vehicle (NEV) passenger vehicle sales declined 41% year over year in February, with a 36% drop when combining January and February figures. Commercial vehicle sales also showed weakness, with all-electric bus sales down 26.3% year over year in February (334 units), though slightly up 5% for the combined two months. Non-bus commercial vehicle sales fell sharply by 50.1
energyelectric-vehiclesBYDnew-energy-vehicleshybrid-vehiclescommercial-electric-buseselectric-vehicle-sales-trendsApple bakes in AI smarts into its new $599 iPhone 17e
Apple has introduced the iPhone 17e, a budget-friendly model priced at $599, set for release on March 11, 2026. This new iPhone features the A19 chip found in the base iPhone 17 and supports Apple Intelligence. It offers 256 GB of storage, doubling the entry-level capacity from the previous generation. Notably, the iPhone 17e now includes MagSafe and Qi2 wireless charging capabilities, allowing up to 15W charging. The device comes in black, white, and a new soft pink color. Additional enhancements include the C1X cellular modem, which Apple claims is twice as fast as the previous C1 modem in the iPhone 16e while consuming 30% less energy. The camera remains a 48-megapixel sensor, consistent with the iPhone 16e. The phone features a 6.1-inch Super Retina XDR display protected by Ceramic Shield 2, offering triple the scratch resistance of its
energymaterialswireless-chargingsmartphone-technologycellular-modembattery-efficiencyIP68-ratingHuge cryogenic cold boxes lowered underground for LHC's major upgrade
CERN engineers have successfully installed two large cryogenic “cold boxes” deep underground near the ATLAS and CMS detectors as part of the High-Luminosity Large Hadron Collider (HiLumi LHC) upgrade. Manufactured by Linde in Germany, these cold boxes are essential components of the new refrigeration systems designed to cool the collider’s superconducting magnets to an ultra-low temperature of 1.9 kelvins (−271.3 °C), just a few degrees above absolute zero. This extreme cooling is necessary to enhance the magnets’ performance, thereby increasing the collider’s luminosity—the rate of particle collisions—which allows physicists to gather more data and explore fundamental particles with greater precision. The refrigeration system works by first precooling helium to 4.5 kelvins on the surface before it is further cooled underground to 1.9 kelvins through pressure reduction in the magnet cryostats, aided by four cold compressors integrated into the cold boxes. Installation of the cry
energycryogenicssuperconducting-magnetsparticle-acceleratorhelium-coolingLarge-Hadron-ColliderHiLumi-LHC-upgradeNASA tests method to extract oxygen from simulated lunar soil
NASA’s Carbothermal Reduction Demonstration (CaRD) team has successfully tested a method to extract oxygen from simulated lunar soil using concentrated sunlight, marking a significant advancement for the Artemis program. This process, driven solely by solar energy, involves heating lunar regolith simulant in a specialized reactor to trigger a chemical reaction that releases oxygen and produces carbon monoxide as a byproduct. Since lunar soil is nearly half oxygen by mass, trapped within metal oxides, this technique effectively “breaks the bonds” to harvest oxygen directly on the Moon, reducing the need to transport heavy life-support supplies from Earth. This achievement supports NASA’s In-Situ Resource Utilization (ISRU) strategy, which aims to enable astronauts to live off local materials on the Moon and Mars by producing air, water, and fuel on-site. The technology not only promises to lower the cost and increase the sustainability of long-term lunar missions but also has potential applications on Mars, where similar hardware could convert the carbon-dioxide-rich atmosphere into
energymaterialslunar-explorationoxygen-extractionsolar-energyIn-Situ-Resource-UtilizationNASAScientists build benchtop device to advance wireless charging for EVs
Researchers at Tokyo Metropolitan University have developed a benchtop device that simulates wireless charging for electric vehicles (EVs), aiming to advance dynamic wireless power transfer (DWPT) technology. This rotating apparatus replicates the movement of an EV’s receiving coil over transmitter coils embedded in roadways, simulating vehicular speeds of up to 25 miles per hour while transferring 3 kilowatts of power. By accurately mimicking the electromagnetic environment of highway-embedded coils, the device allows detailed study of power transmission efficiency and the effects of coil misalignments, a common real-world challenge that impacts coupling efficiency and charging performance. The innovation addresses a significant barrier in DWPT research: the high cost and impracticality of building full-scale test tracks with embedded transmitter coils, which limits experimentation to well-funded institutions. This benchtop simulator enables smaller labs to conduct realistic testing and analysis of wireless charging dynamics, potentially accelerating the development and adoption of wireless charging systems. Such systems could reduce the need for large
energywireless-chargingelectric-vehiclesdynamic-wireless-power-transferEV-battery-technologypower-transmissionTokyo-Metropolitan-UniversityUS 6th‑gen fighter jet engine tech signal shift in air dominance strategy
The upcoming US sixth-generation fighter jet, designated the F-47 and expected to fly in 2028, is being developed under the Next Generation Air Dominance (NGAD) program to replace the F-22 Raptor. Boeing and the US Air Force have kept most specifications classified, but the F-47 is anticipated to be a long-range air superiority fighter capable of speeds around Mach 2 and a range exceeding 1,000 nautical miles. A recent Pratt & Whitney video, while primarily showcasing the XA-103 adaptive engine’s digital twin development, briefly reveals a possible F-47 render featuring a modified delta wing, tailless design, and high cockpit, though this image may be intentionally misleading. The XA-103 engine, developed under the Next Generation Adaptive Propulsion (NGAP) program, is expected to enhance the F-47’s performance by increasing its range by 25% and thrust by 10% compared to the F-35 engine. It incorporates advanced thermal management
energyaerospace-engineeringfighter-jet-technologyadaptive-propulsiondigital-twinAI-in-aviationadvanced-engine-systemsHigh-temperature modular reactor to be built at US' experiment station
Houston-based company ZettaJoule is set to build an innovative high-temperature gas-cooled modular reactor, the ZJ0, at the Texas A&M Engineering Experiment Station (TEES) in College Station, Texas. The reactor is designed to operate at temperatures up to 1,742°F (950°C), enabling applications such as synthetic fuels production, hydrogen generation, steelmaking, chemical processing, desalination, and data center support. The ZJ0 technology builds on decades of safe operation experience from Japan’s High Temperature Engineering Test Reactor, combining Japanese innovation with Texas’ energy leadership. The partnership between ZettaJoule and TEES, part of the Texas A&M University System, aims to advance research and workforce training in next-generation energy systems, while emphasizing safety and transparency. The addition of the ZJ0 reactor would make Texas A&M the only U.S. university with more than two nuclear research reactors on campus, enhancing its status as a premier nuclear engineering institution. This collaboration is expected
energynuclear-reactorhigh-temperature-reactorZettaJouleTexas-A&Madvanced-energy-systemsenergy-innovationDüren’s Hydrogen Bet: The Math Behind a Looming Liability - CleanTechnica
The article examines the economic and operational challenges facing Düren, Germany, in its ambitious hydrogen program, particularly focusing on a new 10 MW green hydrogen production plant under construction at Brainergy Park in Jülich. Unlike Aberdeen, Scotland—a city that independently developed a hydrogen bus fleet and refueling infrastructure with well-documented costs—Düren benefits from federal funding and regional hydrogen initiatives. However, the financial math remains challenging. Aberdeen’s experience revealed high capital and operating expenses, with hydrogen fuel costs reaching £20-25 per kilogram and energy costs per kilometer significantly exceeding those of diesel and battery electric buses. Low utilization rates further exacerbated the economic inefficiency, leading to the early retirement of the fleet. Düren’s hydrogen efforts began with a small fleet of fuel cell buses, which faced technical issues and were later expanded to about 20 buses. Hydrogen refueling is provided at a Shell-operated forecourt station, part of a network that has seen closures due to low demand, reflecting limited passenger fuel
energyhydrogen-energyfuel-cell-busesgreen-hydrogenelectrolysisrenewable-energyhydrogen-infrastructure'World’s first commercial fusion power plant' inches closer to reality
A German company, Proxima Fusion, has signed a Memorandum of Understanding (MoU) with the Free State of Bavaria, energy company RWE, and the Max Planck Institute for Plasma Physics (IPP) to develop Europe’s first commercial stellarator fusion power plant. The collaboration aims to advance fusion energy by first building a demonstration stellarator called Alpha near the IPP in Garching, Germany. Alpha is expected to be the first stellarator to achieve net energy gain—producing more energy than it consumes—when operational in the 2030s. This milestone will validate key fusion technologies under real-world conditions, accelerating the development of the subsequent commercial power plant, Stellaris, planned for Gundremmingen, Bavaria. The partnership integrates world-class research, private financing, and public support to establish Bavaria as a leading hub for fusion energy innovation and industrialization. The projects are anticipated to generate thousands of jobs and supplier contracts across various sectors, supporting Europe’s goal to reduce energy import dependence
energyfusion-powerstellaratorProxima-Fusionrenewable-energyenergy-innovationcommercial-fusionThe Subaru Uncharted EV: Two Video Reviews - CleanTechnica
The Subaru Uncharted EV is receiving positive attention compared to Subaru’s previous electric model, the Solterra, primarily due to its improved range and more affordable pricing. The Uncharted offers about 308 miles of range and starts below $40,000, with the base trim featuring front-wheel drive. While some higher trims have less range and higher prices, potential buyers should check for applicable state EV incentives, which may reduce the effective cost. The GT trim, priced slightly above $40,000, was reviewed positively, especially for its surprisingly spacious rear seating despite its compact crossover appearance. Key features of the Uncharted EV include a 74.7 kWh battery, a 14-inch touchscreen with Apple CarPlay and Android Auto, dual wireless chargers, a 6-speaker audio system, cloth upholstery, heated front seats, power driver seat, driver assist technology, and regenerative braking. Reviewers praised the vehicle for being comfortable, quiet, and fun to drive, with a sporty and attractive exterior design
energyelectric-vehiclesbattery-technologyEV-chargingSubaru-Unchartedclean-energysustainable-transportationVinFast Opens a New Dealer to Serve the Areas North of Manila - CleanTechnica
VinFast, the Vietnamese electric vehicle (EV) manufacturer, has expanded its presence in the Philippines by opening a new showroom and service hub in Caloocan, just 8 kilometers north of Manila. Developed in partnership with AutoIcon Group, this facility marks VinFast’s 30th operational dealership in the country and is strategically located in Balintawak, a key transport gateway to North Luzon. The site showcases VinFast’s full local battery-electric lineup—including the VF 3, VF 5, VF 6, VF 7, and VF 9—and offers comprehensive aftersales services such as preventive maintenance, mechanical and electrical repairs, and body and paint work. This expansion aligns with VinFast’s strategy to place retail and service centers in high-traffic corridors, targeting both urban customers and commuters from nearby provinces who are increasingly considering EVs. VinFast’s leadership emphasizes that the Caloocan opening signals strong momentum heading into 2026 and reflects the company’s commitment to promoting
energyelectric-vehiclesEV-charging-stationssustainable-mobilityclean-energyautomotive-technologyVinFastNIO & Bosch Sign Strategic Cooperation Agreement - CleanTechnica
During German Chancellor Friedrich Merz’s first official visit to China, NIO Inc. and Bosch signed a strategic cooperation agreement to collaborate on advanced smart electric vehicle (EV) technologies. The partnership, involving NIO’s brands NIO, ONVO, and firefly, will focus on key EV systems such as drive-by-wire chassis, battery management, braking, steering, powertrain, body electronics, and sensing modules. This collaboration aims to leverage the complementary strengths of both companies across the industrial value chain to drive innovation and support high-quality development in the smart EV sector. The agreement also highlights the strengthening of China-Germany cooperation in energy transition and high-end manufacturing, contributing to sustainable global development and enhanced bilateral economic ties. The signing took place alongside a China-Germany Economic Advisory Committee symposium attended by over 60 business leaders, where NIO’s founder and CEO William Li represented China’s automotive industry. Discussions centered on green and low-carbon development, digital transformation, supply chain resilience, and bilateral investment.
energyelectric-vehiclesbattery-management-systemssmart-mobilityautomotive-technologyenergy-transitionsustainable-developmentNIO Deliveries Rise 58% in February — Charts - CleanTechnica
In February 2025, NIO achieved a significant increase in vehicle deliveries, reaching 20,797 units—a 57.6% rise compared to 13,192 deliveries in February 2024. This strong performance occurred despite a general downturn in EV sales across China. Since its inception, NIO has delivered a cumulative total of 1,045,571 vehicles. While the company provided limited commentary on the sales figures, it highlighted recent recognition of its manufacturing facilities as National Green Factories by China’s Ministry of Industry and Information Technology. This designation reflects NIO’s excellence in green management practices across the product lifecycle and aligns with China’s dual-carbon strategy and green manufacturing goals. NIO’s factories incorporate advanced sustainability measures, including real-time energy and carbon management systems, water recycling, industrial waste reuse, and environmentally friendly manufacturing processes that reduce emissions of volatile organic compounds. These initiatives position NIO as a leader in sustainable automotive manufacturing, transforming its factories from energy consumers into contributors to environmental sustainability
energygreen-manufacturingsustainabilitycarbon-managementautomotive-industryrenewable-resourcesenvironmental-technologyHonor launches its new slim foldable Magic V6 with a 6,600 mAh battery
Honor has unveiled its new foldable smartphone, the Magic V6, ahead of Mobile World Congress in Barcelona. The device emphasizes slimness, measuring 4mm thick when unfolded and 8.75mm folded, slightly thinner than last year’s model. A standout feature is its large 6,600 mAh battery, a significant increase from the previous 5,820 mAh, supporting fast charging at 80W wired and 66W wireless via Honor’s SuperCharge technology. Honor also introduced a new silicon-carbon battery technology with 32% silicon density, potentially enabling foldable batteries exceeding 7,000 mAh in the future. The Magic V6 sports a 7.95-inch main AMOLED display (2352 x 2172 resolution) and a 6.52-inch cover display (2420 x 1080 resolution), both with LTPO 2.0 technology allowing variable refresh rates from 1 to 120Hz for improved power efficiency and content clarity. The
energybattery-technologyfoldable-smartphonessilicon-carbon-batterySuperChargeAMOLED-displaymobile-devices-materialsChina's new 250 Wh/kg organic battery can survive extreme temperatures
Researchers from Tianjin University and South China University of Technology have developed a new flexible organic battery based on a conductive polymer called Poly (benzofuran dione) (PBFDO). Unlike traditional organic batteries that suffer from poor conductivity and low energy density due to cathode dissolution, this n-type conductive polymer naturally conducts electrons, enhancing structural stability and ion transport. The resulting battery boasts an energy density of approximately 250 Wh/kg, comparable to commercial lithium-ion batteries used in electric vehicles, and significantly higher than typical lithium iron phosphate (LFP) batteries. In addition to its high energy density, the battery demonstrates an exceptional operating temperature range from -70°C to 80°C, far surpassing conventional lithium batteries that degrade below -20°C or above 50°C. The battery is also mechanically flexible, able to withstand bending, compression, and puncture without catching fire or exploding, due to its non-oxygen-releasing chemistry which reduces the risk of thermal runaway. This combination of safety, flexibility
energyorganic-batteryconductive-polymerenergy-densitybattery-technologyflexible-batterytemperature-toleranceChina’s BYD tests record-breaking 1,500 kW flash charger in Shenzhen
China’s BYD is advancing its next-generation ultra-fast EV charging technology with internal tests of a 1,500 kW Flash Charging system in Shenzhen. The system, designed only for vehicles capable of handling over 1,000 kW input power—such as BYD’s Tang 9, Song Ultra, Seal 07, Denza Z9 GT, and FCB Tai-series—features a charging station layout similar to a traditional fuel station, including liquid-cooled charging guns and T-shaped gantries. Charging automatically stops at 97% state of charge, and a dedicated Flash Charging app on Android enables users to locate stations and start charging within about 10 seconds without QR code scanning. Early pricing revealed at the demonstration site is 1.3 yuan (approximately 0.18 USD) per kWh, which includes a service fee, and early adopters may receive up to 1,000 kWh of free electricity annually. BYD’s Flash Charging system significantly outpaces current
energyelectric-vehiclesfast-chargingBYDmegawatt-chargerEV-infrastructureultra-fast-chargingAnother One Bites the Dust: Aberdeen’s Hydrogen Bus Fleet Ends In Failure - CleanTechnica
Aberdeen’s experiment with a fleet of 25 hydrogen double-decker buses, once hailed as a pioneering step in clean transport and a foundation for a local hydrogen economy, has ended in failure. Despite initial optimism and significant investment—including an £8.3 million program supported by the Scottish Government and EU funding, plus an additional £4.5 million award—the buses faced mixed operational performance and infrastructure challenges. The council has decided to retire and attempt to sell the fleet, but the prospects for recouping capital are low due to the lack of a robust secondary market for hydrogen buses. These vehicles require specialized refueling infrastructure, maintenance expertise, and supply contracts, limiting potential buyers to operators already equipped for hydrogen technology or willing to invest heavily for a small, aging fleet. The hydrogen double-decker market remains niche and stagnant, with limited deployment primarily involving the Wrightbus StreetDeck Hydroliner in Aberdeen, London, and Northern Ireland. London, after an initial batch likely influenced by political factors, has
energyhydrogen-fuelclean-transporthydrogen-busessustainable-energypublic-transportationrenewable-energyMulti-Brand EV Distributor Opens Roadshow - CleanTechnica
The United Asia Automotive Group Inc. (UAAGI) has launched its 2026 “On the Move” roadshow in the Philippines, showcasing a diverse lineup of electrified vehicles from multiple Chinese and China-linked brands including BAIC, Chery, Foton, Jetour, Lynk & Co, and Radar. This event, held at SM Mall of Asia, offers Filipino consumers the opportunity to test drive over 20 vehicles spanning hybrids, plug-in hybrids (PHEVs), range-extended electric vehicles (REEVs), and full battery-electric vehicles (BEVs), alongside traditional internal combustion engine (ICE) models. UAAGI’s strategy emphasizes technology diversity to address the country’s uneven charging infrastructure and the transitional needs of buyers moving away from pure combustion engines, highlighting PHEVs and REEVs as practical interim solutions. Key models featured include the BAIC B60e Beaumont rEV, a full-size 7-seat REEV with a 1.5-liter turbocharged engine
energyelectric-vehiclesEV-adoptionhybrid-vehiclesbattery-technologycharging-infrastructurerange-extended-electric-vehiclesE-Bike Battery Swapping Expands In New York City
The New York City Department of Transportation (DOT) has successfully piloted an e-bike battery swapping program aimed at enhancing safety and convenience for e-bike delivery riders. Between 2022 and 2025, e-bike batteries—particularly non-certified ones—were linked to 900 fires in NYC, causing 30 deaths and 400 injuries. To address this, the pilot launched in March 2024 with five swapping stations in Brooklyn and Manhattan, providing certified, fully charged batteries and reducing the need for home charging, which is a major fire risk. Over five months, 120 riders used the stations nearly 1,000 times, with 84% previously charging at home. The pilot showed that more than half of participants stopped or reduced home charging, improving safety and productivity by allowing riders to spend more time working without carrying extra batteries. Following the pilot’s success, DOT announced plans to expand the program citywide, focusing on high-traffic neighborhoods such as most of Manhattan, Downtown Brooklyn, Williamsburg
energybattery-swappinge-bikeelectric-vehiclesNew-York-Cityclean-energybattery-safetyDenza Officially Launches in Philippines with D9 DM-i MPV - CleanTechnica
Denza, the premium new energy vehicle (NEV) brand and high-end division of BYD, has officially launched in the Philippines with the introduction of the Denza D9 DM-i, a plug-in hybrid executive MPV. The launch event in Manila marks the brand’s strategic entry into the Philippine luxury automotive market, which BYD considers important due to its growing sophistication and demand for intelligent, refined, and sustainable vehicles. The D9 DM-i features a powerful hybrid powertrain combining a 1.5-liter turbocharged gasoline engine, dual electric motors, and a 40 kWh Blade Battery, delivering 401 horsepower, all-wheel drive, and a total driving range of 980 kilometers, including 180 kilometers on electric power alone. The vehicle’s interior emphasizes luxury and comfort, with Nappa leather upholstery, zero-gravity second-row seats with multiple adjustments and massage functions, and advanced infotainment and sound systems. This launch is part of Denza’s broader global expansion beyond its initial
energynew-energy-vehiclesplug-in-hybridelectric-vehicleautomotive-technologybattery-technologyBYDFluorine & Tofu Brine Lead To Battery Breakthroughs In China - CleanTechnica
Chinese researchers led by Chen Jun at Nankai University have developed a breakthrough lithium metal battery featuring an energy density exceeding 700 watt-hours per kilogram and stable performance at extremely low temperatures (around -50°C). This advancement addresses key challenges in electric vehicle (EV) adoption, namely energy density and low-temperature functionality. The team achieved this by replacing traditional oxygen-based electrolyte solvents with novel fluorinated hydrocarbon molecules, creating a lithium-fluorine coordination system that improves ion transfer and charge efficiency. Laboratory tests demonstrated the battery’s ability to maintain nearly 400 Wh/kg at -50°C, a significant improvement over existing technologies. The research, published in Nature, highlights that the fluorine-based electrolytes offer low viscosity, high oxidation stability, and enhanced ionic conductivity, enabling efficient lithium plating and stripping with a Coulombic efficiency of up to 99.7%. These properties allow lithium-metal pouch cells to operate with minimal electrolyte amounts while achieving high energy densities. Beyond laboratory success, the team has partnered
energybattery-technologylithium-metal-batteryfluorine-electrolyteelectric-vehiclesenergy-densitylow-temperature-performanceHow The Olympics Bought Attention To A Pattern Of Sportswashing - CleanTechnica
The article from CleanTechnica critically examines the phenomenon of "sportswashing," particularly in the context of the Olympics, where major sporting events are used to distract from or greenwash the environmental impacts of their sponsors. While sports play a vital social and economic role—bringing communities together, boosting local economies, and promoting healthier lifestyles—there is growing concern about the sustainability commitments of sports organizations and their sponsors. The article highlights the problematic involvement of fossil fuel companies, which invest billions in sports sponsorships to improve their public image despite their significant contributions to climate change. Focusing on the 2026 Winter Olympics in Italy, the article acknowledges some positive steps, such as the International Olympic Committee's pledge for 100% renewable electricity during the Games and infrastructure upgrades by Italy’s largest electricity company, Enel, aimed at benefiting local residents post-event. However, the sponsorship by Italian oil and gas giant Eni undermines these efforts. Eni promotes natural gas as a cleaner energy source, but the article ref
energyrenewable-energysustainabilitysportswashingfossil-fuelsclimate-crisisenergy-infrastructureThe billion-dollar infrastructure deals powering the AI boom
The article highlights the massive financial investments and infrastructure developments fueling the current AI boom, emphasizing the enormous computing power required to run advanced AI models. Nvidia CEO Jensen Huang estimates that $3 to $4 trillion will be spent on AI infrastructure by 2030, with major tech companies like Meta, Oracle, Microsoft, Google, and OpenAI leading the charge. The article traces the origins of this surge to Microsoft’s landmark $1 billion investment in OpenAI in 2019, which established Microsoft as OpenAI’s exclusive cloud provider and laid the foundation for a partnership that has since grown to nearly $14 billion. Although OpenAI has recently diversified its cloud partnerships, the model of AI companies aligning closely with specific cloud providers has become standard, with Amazon investing $8 billion in Anthropic and Google Cloud acting as a primary computing partner for others. Oracle’s emergence as a major AI infrastructure player is underscored by two blockbuster deals with OpenAI: a $30 billion cloud services contract revealed in mid-
energyAI-infrastructurecloud-computingdata-centersNvidiaMicrosoft-AzureOpenAIThe Return Of The Esmeralda 7 Solar Power Project - CleanTechnica
The article discusses the resurgence of the Esmeralda 7 solar power project cluster in Esmeralda County, Nevada, despite previous setbacks. The cluster comprises seven large-scale solar and battery storage projects totaling several gigawatts of capacity. Last fall, Interior Secretary Doug Burgum issued an order that appeared to halt these projects, raising concerns about the future of renewable energy development in the region. However, Nevada Governor Joe Lombardo, a Republican and rare renewable energy advocate within his party, actively opposed the restrictions, emphasizing the economic importance of renewable energy to Nevada’s key industries such as mining and data centers. Lombardo’s efforts included direct engagement with President Donald Trump during a November meeting in Washington, D.C., where he briefed Trump on the significance of solar energy to Nevada’s economy. Following this, Trump reportedly instructed Burgum to allow the projects, signaling a potential reversal of the earlier restrictions. Lombardo publicly reaffirmed his commitment to protecting Nevada’s solar industry and highlighted the state’s reliance
energysolar-powerrenewable-energybattery-storageenergy-transmissionclean-energy-projectsNevada-energy-policyTesla Vehicles Finally Come To Africa - CleanTechnica
Tesla has officially entered the African vehicle market for the first time by launching the Model 3 and Model Y in Morocco starting mid-2025. Morocco was a natural first choice due to its geographic proximity to Europe, where Tesla already has a strong presence, and an existing local fanbase that has independently imported Tesla vehicles. Tesla had previously established a Supercharger network in Morocco and maintained a limited presence on the continent focused on energy products like Powerpacks and Powerwalls, which are available in South Africa. The new official dealerships in Morocco will provide customers with access to new vehicles, full service, and warranties. While Morocco represents Tesla’s initial foothold in Africa, the article highlights South Africa as a much larger and potentially more lucrative market, with nearly 600,000 new vehicle sales projected in 2025—almost three times Morocco’s volume. However, over 96% of South African sales are currently internal combustion engine (ICE) vehicles. The growing popularity of electrified vehicles is evidenced by the
energyelectric-vehiclesTeslarenewable-energyPowerwallelectric-mobilityAfrica-electric-marketXiaomi launches 17 Ultra smartphone, an AirTag clone, and an ultra slim powerbank
Xiaomi has unveiled several new gadgets ahead of the Mobile World Congress in Barcelona, including the Xiaomi 17 Ultra smartphone, an AirTag-like tracking device, a smartwatch, and an ultra-slim power bank. The flagship Xiaomi 17 Ultra, co-branded with Leica, features advanced camera technology such as a 50MP main sensor with a 1-inch aperture, a 200MP telephoto camera with variable focal length (3.2x to 4.3x optical zoom), and a 50MP ultrawide camera. It is powered by Qualcomm’s Snapdragon 8 Elite Gen 5 processor and sports a 6.9-inch HyperRGB OLED display. The phone supports fast charging with a 6,000 mAh battery (6,800 mAh in the Chinese version), 90W USB PD-PPS wired charging, and 50W wireless Hypercharge. A special Leica edition celebrates the camera company’s centenary with a premium aluminum-alloy body, Leica-themed
energysmartphonebattery-technologywireless-chargingmaterialsIoT-deviceswearable-technologyUAW: Stellantis Can’t Blame Workers Or EVs For Losses - CleanTechnica
The article from CleanTechnica highlights the United Auto Workers (UAW) criticism of Stellantis management following the company’s significant financial losses in 2025, which led to zero profit-sharing bonuses for its North American workers. While General Motors and Ford employees received substantial profit-sharing checks, Stellantis workers were left empty-handed, causing frustration and disappointment. UAW Vice President Rich Boyer condemned Stellantis for prioritizing shareholder payouts over investing in the future and for cutting essential plant resources, which contributed to the company’s poor financial performance. Stellantis has attempted to blame its financial woes on the transition to electric vehicles (EVs) and a cooling market, but the article argues this is a scapegoat for management’s failures. Unlike GM and Ford, which heavily invested in EV platforms and battery production, Stellantis lagged behind, underfunding engineering, software development, and supplier budgets. The company also raised prices on aging internal combustion models, resulting in lost market share. The article asserts
energyelectric-vehiclesautomotive-industryStellantisUAWEV-transitionprofit-marginsWe’re At War With Iran — Buy An EV To Avoid $6+ Gas Prices - CleanTechnica
The article from CleanTechnica discusses the onset of a conflict between the U.S., Israel, and Iran, termed “Operation Epic Fury,” highlighting the significant geopolitical and economic consequences, particularly for American drivers. It argues that the notion of a quick, surgical military strike leading to regime change in Iran without economic fallout is unrealistic. Instead, the article warns of a high likelihood (60-70%) of a severe and sustained global oil shock, which could push U.S. gasoline prices above $6 per gallon. This is largely due to the strategic vulnerability of the Strait of Hormuz, a narrow chokepoint through which a substantial portion of the world’s oil supply passes. Iran’s asymmetric warfare tactics, including the use of naval mines and attack drones, could disrupt maritime insurance and tanker traffic, drastically reducing oil flow and causing global panic in oil markets. The article explains that even partial disruptions could cause crude oil prices to rise from around $70 per barrel to $130-$140 per barrel due to
energyelectric-vehiclesoil-pricesgasoline-crisisMiddle-East-conflictenergy-securityoil-supply-chainChina's BYD claims world record EV range with 644-mile electric run
China’s BYD has announced a significant upgrade to its Denza Z9 GT electric vehicle, claiming a world-record range of up to 644 miles on a single charge under the CLTC testing cycle. This marks a substantial 64% improvement over the previous Z9 GT model, which offered a maximum range of 391 miles. Additionally, regulatory filings suggest that the standard Denza Z9 sedan, using the same battery technology, could achieve an even higher range of up to 664 miles, potentially surpassing the Z9 GT, though Denza has not officially claimed the longest-range title for this model. The new Z9 GT also features BYD’s next-generation driver assistance system, God’s Eye 5.0, which includes advanced capabilities such as Navigate on Autopilot (NOA) for guided city and highway driving, and Automatic Emergency Steering (AES) for active safety interventions. The launch of the Z9 GT on September 20, 2024, marks a strategic
energyelectric-vehiclesbattery-technologyBYDEV-rangedriver-assistance-systemsautonomous-drivingUS lab's new facility to tackle rising grid strain from data centers
The U.S. Department of Energy’s Oak Ridge National Laboratory (ORNL) has launched the Next-Generation Data Centers Institute (NGDCI) to address the rapidly increasing energy demands of AI data centers. Currently, data centers consume over 4% of U.S. electricity, but this figure is projected to rise to as much as 17% by 2030, largely driven by the intensive power requirements of AI workloads. NGDCI aims to develop innovative science and technology solutions—including advanced cooling, power management, and integrated grid operation—to ensure that future AI infrastructure remains secure, efficient, and reliable without compromising grid stability. Building on ORNL’s existing MEGA-DC project, which models the economic and technical impacts of data center growth on infrastructure, NGDCI envisions data centers as adaptable national assets that can enhance grid resilience. The institute will collaborate with major industry partners such as AMD, NVIDIA, and Carrier Energy to co-design power-aware architectures and grid-supportive systems. Lever
energydata-centersAI-infrastructuregrid-resiliencepower-managementcooling-technologiesOak-Ridge-National-LaboratoryChina develops new polymer solar cells with 19.1% efficiency
Researchers from Wuhan University of Technology in China have developed a new polymer solar cell (PSC) that achieves a power conversion efficiency (PCE) of 19.1% while maintaining exceptional operational stability. Published in the journal Matter, the study reveals that by incorporating small-molecule acceptors into polymer matrices, the team improved molecular packing and charge transport, resulting in flexible devices that retain 97% of their initial efficiency after 2,000 hours of exposure to air. This corresponds to an extrapolated device lifetime exceeding 100,000 hours, marking a significant advancement toward the commercial viability of PSCs. The research addresses the longstanding challenges of insufficient performance and stability in polymer solar cells by elucidating the photochemical degradation mechanisms of polymer acceptors. Specifically, the study identifies weak chemical bonds in polymeric acceptors that reduce photostability and demonstrates that blending small molecules mitigates chain entanglement and free volume, enhancing both photochemical and thermal stability. These findings not only improve the efficiency and durability
energypolymer-solar-cellsphotovoltaic-materialspower-conversion-efficiencyorganic-photovoltaicssolar-energymaterial-stabilityNASA Is Making Big Changes to Speed Up the Artemis Program
NASA Administrator Jared Isaacman announced major changes to accelerate the Artemis lunar program in response to concerns over slow progress and rising competition from China’s space efforts. Key adjustments include canceling the Exploration Upper Stage and Block IB upgrades for the Space Launch System (SLS) rocket, using the existing upper stage for Artemis II and III, and standardizing the upper stage for Artemis IV and subsequent missions. Notably, Artemis III will no longer include a lunar landing; instead, the Orion spacecraft will dock with commercial landers like SpaceX’s Starship or Blue Origin’s Blue Moon in lunar orbit, making Artemis IV the first mission to land on the moon under this revised plan. NASA aims to increase the Artemis flight rate to annual launches starting in mid-2027. The changes address longstanding issues with the SLS rocket’s low flight frequency and technical delays, such as hydrogen and helium leaks that have caused months-long postponements. Historically, NASA launched crewed missions roughly every three months during earlier programs, but
energyspace-explorationNASAArtemis-programrocket-technologylunar-missionsspace-launch-systemRange Anxiety Anxiety vs. Actual Electric Car Convenience - CleanTechnica
The article "Range Anxiety Anxiety vs. Actual Electric Car Convenience" from CleanTechnica revisits a piece originally published over 11 years ago, addressing misconceptions about electric vehicle (EV) charging and range anxiety. The author critiques media narratives that exaggerate the inconvenience of EV charging times, which foster a heightened fear of range anxiety among potential EV buyers. This fear stems from applying traditional gasoline car refueling habits—driving until near empty and then quickly refueling—to EVs, which operate on a fundamentally different usage and charging pattern. The key takeaway is that EVs eliminate the frequent, time-consuming stops for gas by enabling convenient overnight charging at home, effectively acting like a "magic energy fairy" that refuels the car while the owner sleeps. The author shares personal experience, noting that while gas refueling took about 10 minutes every two weeks, EV charging requires just a few seconds to plug in at home, with a full charge ready by morning. Although long trips require more planning, the
energyelectric-vehiclesEV-chargingrange-anxietybattery-technologyclean-energysustainable-transportationSierra Club Releases First Trove of Emails, Texts, and Calendars from Trump’s Department of the Interior - CleanTechnica
The Sierra Club has released the first batch of emails, texts, and calendars obtained from the Department of the Interior related to the Trump administration’s early 2025 actions. The documents reveal bipartisan congressional concern over the administration’s mass firings and funding freezes, which halted critical projects including disaster relief efforts for wildfire- and tornado-affected communities and essential drinking water infrastructure. Communications show frantic inquiries from both Republican and Democratic lawmakers seeking updates and explanations for these disruptions. Notably, the records include messages from Rep. Ryan Zinke’s Chief of Staff about emergency meetings to address suspended water infrastructure repairs in Montana and evidence of funding cuts affecting local facilities like the Fresno Dam. The released materials also highlight numerous meeting requests from fossil fuel, mining, and other industry representatives, alongside involvement from staffers linked to Elon Musk’s so-called Department of Government Efficiency (DOGE). These DOGE personnel were embedded within Interior and other agencies, influencing decisions on budget freezes, contract suspensions, and staffing cuts. Although many of
energygovernment-policyinfrastructurefossil-fuelsenvironmental-impactfunding-freezedisaster-recoveryVolkswagen Reaches 2 Million Electric Vehicle Deliveries - CleanTechnica
Volkswagen has reached a significant milestone by delivering its 2 millionth fully electric vehicle (EV), marking its strong presence in the global EV market. The milestone vehicle was a Volkswagen ID.3 produced at the Zwickau factory and delivered in Dresden, Germany. While other manufacturers like BYD and Tesla have also achieved high EV sales, Volkswagen stands out as one of the few brands to reach this cumulative total. The company highlights its leadership in the European battery electric vehicle (BEV) market, with a diverse lineup ranging from the compact ID.3 to the long-range ID.7. Volkswagen’s EV journey began in 2013 with the launch of the e-up! and has since expanded its portfolio to include models like the e-Golf and the current ID family. Volkswagen emphasizes that its strong market position, especially in Germany and Europe, reflects the competitiveness and appeal of its electric vehicles. Key contributors to Volkswagen’s EV sales include the ID.3 (approximately 628,000 units
energyelectric-vehiclesVolkswagenbattery-electric-vehicleselectromobilitysustainable-transportationelectric-car-salesThe System Case Against Hydrogen for Grid Storage - CleanTechnica
The article "The System Case Against Hydrogen for Grid Storage" from CleanTechnica challenges the common assumption that hydrogen is essential for long-duration energy storage in power grids. It argues that this premise arises from an overly narrow definition of the storage problem, which often focuses solely on rare, multi-week low renewable output periods (dunkelflaute) rather than the full spectrum of grid storage needs. Grid storage must address multiple timescales: seconds to minutes for frequency and voltage stability, intra-day shifting of solar energy to evening peaks, multi-day weather variability, and strategic reserves for extended low renewable periods. Hydrogen is unsuitable for short-term and intra-day storage due to slow response times and inefficiencies, whereas lithium-ion batteries and power electronics dominate these markets with fast response and increasing cost-effectiveness. For longer durations, the article highlights proven technologies like pumped hydro storage, which provides 8 to 24 hours of storage with high round-trip efficiency, long asset life, and low operating costs. China’s
energyhydrogen-storagegrid-storagebattery-systemsrenewable-energyenergy-infrastructureenergy-storage-technologyHow Sustainable Were The 2026 Olympics, Really? - CleanTechnica
The 2026 Milano Cortina Winter Olympics were promoted by the International Olympic Committee (IOC) as a model of sustainability, emphasizing environmental protection, biodiversity conservation, and the use of low-carbon technologies. The IOC set minimal standards for the host country, including no minimum spectator capacity to ensure venue legacy use and integration of infrastructure improvements into long-term regional development plans. The Games were intended to raise awareness of climate action and showcase sustainable solutions, particularly protecting sensitive mountain ecosystems. However, multiple environmental organizations, including WWF Italia and Mountain Wilderness, criticized the Games for failing to meet these sustainability promises. Transparency requests were ignored, and a planned dialogue between the IOC and sustainability groups was canceled. Critics described the sustainability claims as misleading, pointing to significant environmental damage such as the felling of two hectares of forest within a UNESCO World Heritage Site to build a bobsled track. Additionally, the Games’ carbon footprint was substantial, with greenhouse gas emissions comparable to millions of cars driving from Paris to Rome. The Italian government
energysustainabilityclimate-actionlow-carbon-technologiesenvironmental-impactresource-managementsustainable-infrastructureHow Europe Can Meet Hydrogen Fuel Mandates Without Hydrogen Fuels - CleanTechnica
The article discusses how European Union member states can meet the 2030 renewable energy transport mandates under RED III without necessarily deploying hydrogen fuels directly in vehicles. RED III requires that at least 5.5% of energy supplied to transport come from advanced biofuels and renewable fuels of non-biological origin (RFNBOs) combined, with a minimum 1% specifically from RFNBOs such as renewable hydrogen or hydrogen-derived synthetic fuels. While direct use of renewable hydrogen in fuel cell vehicles or synthetic fuels is the cleanest compliance pathway, it is currently economically challenging due to high hydrogen costs compared to diesel and electricity on a per useful energy basis, making operators reluctant to adopt hydrogen fuel cell vehicles. An alternative compliance route is through the refinery sector, where renewable hydrogen can replace grey hydrogen used in processes like hydrocracking and desulfurization. This substitution reduces refinery emissions and generates compliance credits toward the transport RFNBO subtarget, even though the final fuels sold remain conventional petrol or
energyhydrogen-fuelrenewable-energyclean-energyEU-energy-policytransport-energyRFNBO4 Takeaways From The Nation’s Biggest Heat Pump Expo - CleanTechnica
The article summarizes key insights from the nation’s largest heat pump expo held in Las Vegas, focusing on innovations in heat pump water heaters (HPWHs) for residential and commercial use. A wide range of residential HPWHs were showcased by numerous manufacturers including GE, Bradford White, LG, Navien, Rheem, and others, with many companies emphasizing their strong commitment to the technology. While few entirely new models debuted, several brands introduced significant updates or recently entered the market, such as Navien’s dual fuel heat pump with gas backup and Noritz’s new tankless HPWH. Commercial heat pump water heaters also featured prominently, with many boiler manufacturers unveiling various central HPWH configurations, refrigerants, and sizes tailored to different building needs. Notable innovations included cascading central HPWH systems and smaller capacity units slated for release. Additionally, air-to-water heat pumps, which can provide both space heating and hot water, were highlighted as a growing trend, with companies like Mitsubishi, Daikin, Samsung
energyheat-pumpswater-heatersHVACrenewable-energyenergy-efficiencyclean-technologyWorld's largest CO2 methanation test facility goes online in Japan
Two Japanese companies, Inpex Corporation and Osaka Gas Co., Ltd., have launched one of the world’s largest CO2 methanation test facilities, capable of processing 400 normal cubic meters of CO2 per hour. Located in Niigata Prefecture, the plant converts captured CO2 into synthetic methane (e-methane) using catalyst-powered hydrogenation reactors. The facility, funded by Japan’s New Energy and Industrial Development Organization (NEDO), began demonstration operations in February 2026 and can supply the annual gas needs of approximately 10,000 households. The synthetic methane produced has been successfully injected into a natural gas pipeline, achieving a methane concentration of 96 percent. The project integrates Inpex’s project management and site operations with Osaka Gas’s catalytic methanation technology to optimize production efficiency. The facility has been certified under Japan’s Clean Gas Certificate System, recognizing the environmental value of the e-methane produced and its contribution to CO2 neutrality. This initiative supports Japan’s
energysynthetic-methaneCO2-methanationcarbon-neutralclean-energyhydrogenation-reactorsgas-technologyMeet The Offshore Wind Project That Survived The Trump Chopper
The article discusses the resilience of the Coastal Virginia Offshore Wind (CVOW) project, a 2.6-gigawatt offshore wind farm led by Dominion Energy, which survived political opposition during the Trump administration. Despite former President Donald Trump's efforts to halt five offshore wind projects along the Atlantic Coast, including attempts to impose pre-construction reviews and ban new offshore leases, CVOW continued progressing. The project began in 2013 with a lease secured under the Obama administration and launched a pilot phase with two 6-megawatt turbines in 2020. Trump’s administration, while hostile to offshore wind, was unable to fully derail the project due to ongoing momentum and institutional support within the Bureau of Ocean Energy Management (BOEM). Dominion Energy capitalized on technological advancements, upgrading to Siemens Gamesa’s larger 14-15 megawatt turbines for the full 176-turbine array, with pre-construction starting in 2023. Political support from Virginia’s Republican Governor Glenn
energyoffshore-windrenewable-energywind-turbinesclean-energyDominion-EnergySiemens-Gamesa400 MW Solar Power Farm Has Huge Battery System Too (Video) - CleanTechnica
The article highlights a large-scale solar power and energy storage facility in New South Wales, Australia, featuring nearly one million solar panels and a 200MW/400MWh battery system. This installation generates enough renewable electricity to power approximately 300,000 homes. A key takeaway is that solar power, supported by battery storage, can be cheaper and faster to install than new coal or natural gas plants. The significant cost reductions in solar panels (about 90% over the past decade) and batteries have made such projects economically viable, while also addressing the intermittency of solar energy by storing excess power for use during non-sunny periods. Additional benefits of the solar farm include its dual use of land, where sheep graze safely alongside the panels, providing farmers with lease income that helps mitigate financial risks from adverse weather and natural challenges. The project also created jobs during construction and for ongoing operations. The article emphasizes the environmental and health advantages of solar power compared to fossil fuels, noting the absence of toxic emissions
energysolar-powerbattery-storagerenewable-energyclean-energyenergy-storage-systemssolar-panelsAbandoning AI Safety Might Screw Our Cars Up - CleanTechnica
The article from CleanTechnica highlights the critical implications of the recent shift in the artificial intelligence (AI) industry’s approach to safety, particularly for modern electric vehicles (EVs). As EVs increasingly rely on AI-driven infotainment and driver assistance systems powered by Large Language Models, the abandonment of AI safety guardrails by Silicon Valley could create a stark divide in the automotive sector. Traditional automakers, wary of liability and regulatory risks, are expected to heavily restrict AI functionalities to avoid lawsuits, resulting in limited, frustratingly basic voice assistants that prioritize legal safety over user experience. This cautious approach may stifle innovation and reduce the practical benefits of AI in vehicles. Conversely, the article warns that tech-centric automakers and startups—referred to as “Tech Car Bros”—are likely to embrace a riskier, “move fast and break things” mentality. They may accelerate the deployment of beta self-driving software on public roads, prioritizing data collection and shareholder interests over proven safety and reliability. This
energyelectric-vehiclesAI-safetyautomotive-technologydriver-assist-systemslarge-language-modelsinfotainment-systemsVinFast Deepens UAE Charging Network as Middle East EV Strategy Gains Traction - CleanTechnica
VinFast has strengthened its electric vehicle (EV) presence in the Middle East by signing a memorandum of understanding with PlusX Electric, a DEWA-certified provider of charging and mobility solutions in the UAE. This partnership aims to expand charging infrastructure and customer support through portable chargers, mobile emergency services, and integrated digital tools, addressing key barriers to EV adoption such as range anxiety and service reliability. PlusX Electric will manage installation and maintenance of home, office, and DC fast chargers, ensuring compliance with UAE standards, while co-branded equipment and a unified digital platform will enhance the overall ownership experience for VinFast customers. Since entering the UAE market in October 2024 with a flagship showroom and partnerships for public charging, VinFast has expanded its regional footprint to Qatar and Oman, supported by exclusive dealerships and 24/7 roadside assistance across six Gulf countries. The company’s vehicle lineup, including the VF6, VF7, VF8, and VF9 models, targets a range of buyers with features suited
energyelectric-vehiclesEV-charging-infrastructuresustainable-mobilityclean-energy-transitionMiddle-East-energyportable-EV-chargersGermany's 100% hydrogen engine passes test with increased power density
Germany-based Everllence has successfully commissioned and tested a single-cylinder 35/44DF engine running on 100% hydrogen at its Augsburg site, marking a significant advancement in hydrogen combustion technology. This development, part of the HydroPoLEn project funded by the German Federal Ministry for Economic Affairs and Energy, involved re-engineering engine architectures and designing combustion processes and mechanical components optimized specifically for hydrogen use. The new process notably increases power density during hydrogen operation, and the Augsburg site now features dedicated hydrogen supply infrastructure, positioning it as a hub for alternative fuel research. The HydroPoLEn consortium includes technical and industrial partners such as WTZ, the Technical University of Munich, Tenneco, and Carnival Maritime, reflecting a collaborative effort to address the challenges of hydrogen engine safety and component adaptation. Project leaders emphasize that while the technology is still in early market readiness stages, hydrogen is emerging as a viable option for decarbonizing passenger ships, complementing other fuels like ammonia and methanol in future
energyhydrogen-enginepower-densitymaritime-propulsiondecarbonizationalternative-fuelscombustion-technologyIs Donut Labs Battery Lithium Ion? - CleanTechnica
The article from CleanTechnica examines claims made in a YouTube video by Ziroth regarding whether Donut Labs' battery is lithium-ion. It begins by explaining the charging behavior of lithium-ion batteries, which involves a current-limited voltage source. Initially, when the battery is at low state of charge (SOC), it charges quickly with a relatively constant current, and as it approaches full charge, the current gradually decreases while the voltage remains constant. The article critiques Ziroth’s comparison of voltage versus SOC and voltage versus time curves, noting that comparing curves with different parameters is scientifically unsound and can lead to false conclusions. The analysis then focuses on the Donut Labs battery charging curve. Lithium-ion batteries have strict voltage limits to avoid damage or safety risks, such as bricking from over-discharge or fire hazards from overcharge. The charger enforces these limits. The Donut Labs curve shows a steep voltage rise at the start of charging, indicating near 0% SOC, and a
energylithium-ion-batterybattery-chargingNMC-batterysodium-ion-batterybattery-voltagebattery-managementNew US software models nuclear reactors for Earth and space missions
The Idaho National Laboratory (INL) and Argonne National Laboratory (ANL) have jointly developed Griffin, an advanced reactor physics modeling and simulation software designed to accelerate the development of nuclear reactors for both terrestrial and space applications. Griffin serves as a powerful digital test bed that accurately simulates core reactor processes—including neutron transport, heat flow, fuel behavior, and material stresses—under realistic operating conditions such as high temperatures and pressures. By integrating multiple physics domains like neutronics, thermal hydraulics, structural mechanics, and fuel performance into a single platform, Griffin enables detailed virtual experiments that reduce the need for costly physical prototypes and lengthy testing cycles. Built on the MOOSE (Multiphysics Object Oriented Simulation Environment) framework, Griffin offers flexibility by coupling with other physics codes and supports a range of reactor designs, including pebble bed, molten salt, sodium- and lead-cooled reactors, as well as microreactors. Its capabilities extend to modeling isotope changes, material aging, and dimensional shifts, making
energynuclear-reactorssimulation-softwaredigital-twinreactor-modelingmicroreactorsadvanced-materials'Pre-seeding' unlocks large-area solar cells with 23.15% efficiency
Researchers at the Qingdao Institute of Bioenergy and Bioprocess Technology (QIBEBT) in China have developed a novel "crystal-solvate" (CSV) pre-seeding method to enhance the performance and stability of inverted perovskite solar cells (PSCs). These cells, known for their scalability and power potential, have traditionally suffered from defects and poor structural alignment at the buried interface—the microscopic layer where the perovskite meets the hole-transport layer—leading to efficiency losses and premature degradation. The new approach uses specialized halide nanocrystals deposited on substrates treated with a self-assembled monolayer (SAM) to serve as templates for uniform, bottom-up crystal growth. This method improves wettability, accelerates crystal nucleation, and employs a "lattice-confined solvent annealing" effect that gradually heals defects and reorganizes crystal grains at the interface, resulting in nearly flawless energy-harvesting films. The innovation enables precise control over the buried interface,
energysolar-cellsperovskitematerials-sciencenanocrystalscrystal-growthphotovoltaicsGerman battery recharges using sunlight, releases hydrogen on demand
Researchers at Ulm and Jena universities in Germany have developed a novel copolymer-based solar battery that efficiently stores sunlight energy and releases it as green hydrogen on demand. The system achieves a high charging efficiency of 80% and maintains a discharge efficiency of 72%, making it a promising technology for sustainable energy storage. The battery operates through reversible redox reactions and uses a pH switch to control the charge and discharge cycle: changing the pH triggers hydrogen release via a catalyst, while exposure to sunlight recharges the system. The battery’s state of charge is visually indicated by a color change from yellow (discharged) to violet (charged). This innovation addresses the need for carbon-free hydrogen production, which is crucial for replacing fossil fuels in high energy-density applications such as electric vehicles, steel manufacturing, and clean electricity generation. Unlike conventional hydrogen production methods that rely on methane reforming and emit carbon, this system produces green hydrogen directly from solar energy. The combination of macromolecular polymer chemistry and
energygreen-hydrogensolar-batterycopolymerrenewable-energyhydrogen-storagephotocatalysisSpace computers for orbital data centers to be built by US firm
Sophia Space, a Pasadena-based startup, has secured $10 million in Seed funding to develop AI-optimized computing infrastructure designed specifically for operation in the harsh environment of Earth's orbit. The company is addressing the significant challenge of heat dissipation in space, where traditional cooling methods like fans and liquid cooling are ineffective due to the vacuum and lack of air. Their proprietary passive radiative cooling technology, combined with a modular "TILE" platform, aims to enable supercomputers to operate efficiently in orbit without overheating. This approach contrasts with current industry solutions, such as those used by SpaceX and Google, which rely on bulky radiators. Sophia Space's TILE modules integrate passive heat spreaders and solar panels to maximize energy use for processing, targeting 92% power efficiency. The startup plans to develop a software layer to manage workload distribution across these modules and intends to flight-test the system on an Apex Space satellite bus by late 2027. Looking ahead, Sophia Space envisions constructing large-scale orbital data
energyspace-computingAI-cooling-technologyorbital-data-centerspassive-radiative-coolingmodular-server-architecturespace-native-hardware5 world record-breaking megastructures set to reshape global skylines
The article highlights five groundbreaking megastructures currently under construction worldwide, each poised to set new records in height, volume, or sustainability, reflecting a transformative era in urban architecture. The Jeddah Tower in Saudi Arabia aims to become the world’s tallest building by 2028, surpassing the Burj Khalifa by over 170 meters and breaking the 1-kilometer height barrier. Designed as a vertical city with offices, luxury residences, and a hotel, it presents unprecedented engineering challenges related to wind, materials, and elevators. Meanwhile, Saudi Arabia’s Mukaab in Riyadh will be the largest building by volume, enclosing 1.4 million square meters to create a self-contained urban district, pushing the limits of logistics and climate control, with completion targeted by 2030. Dubai’s Burj Binghatti is set to become the tallest residential-only tower at approximately 557 meters, emphasizing luxury living and structural innovations to manage sway and comfort. In Australia, Atlass
materialsenergysustainabilitymegastructuresconstruction-innovationengineeringsmart-citiesChina's kesterite solar cell sets world record with 15.45% efficiency
Researchers at the Chinese Academy of Sciences (CAS) have set a new world record for kesterite solar cell efficiency, achieving 15.45% power conversion efficiency in tests, with an internationally certified third-party efficiency of 15.04%. This surpasses the previous record of 14.2% held by the same team earlier in 2024. Kesterite, a mineral composed of copper, zinc, tin, and sulfur (CZTS), is a promising material for next-generation thin-film solar cells due to its abundance, non-toxicity, and low production costs, offering advantages over CIGS compounds which face supply bottlenecks. The breakthrough was made by addressing the core challenge of uncontrollable metal ion migration within the solar cell lattice, which causes defects that reduce efficiency and stability. The CAS team developed a novel interphase using a lithium tin sulfide compound (Li₂SnS₃ or LTS) that modifies cation migration paths and balances copper and tin migration
energysolar-cellskesteritethin-film-solarpower-conversion-efficiencymaterials-sciencerenewable-energyWhat Happens to an EV in a Car Crash! - CleanTechnica
The article recounts a four-car pileup involving Ron Male’s BYD Seal electric vehicle (EV) and three petrol cars. Despite common fears, the BYD Seal did not catch fire, and the fire brigade successfully isolated the battery after some discussion and intervention by Ron, who turned off the vehicle and opened the bonnet to isolate the 84 kW battery. However, the fire brigade’s handling of the EV battery access was imperfect, as they damaged the rear seat lining instead of lifting the seat to reach the battery, highlighting a need for improved EV-specific training for emergency responders, especially focusing on common models like BYD and Tesla in Australia. The BYD Seal was the only car not written off, with the insurance company conducting thorough checks before repairs, and Ron praised the insurer’s communication and coverage. The article also addresses broader safety concerns related to EVs in crashes, noting that all EVs tested by ANCAP in recent years have received 5-star safety ratings, often outperforming internal
energyelectric-vehiclesbattery-safetyEV-crashautomotive-technologyelectric-batteryvehicle-safetyThe true cost and future of AI
The article "The true cost and future of AI" highlights that while artificial intelligence marks a transformative technological shift comparable to the internet, its broader economic, social, and environmental costs are substantial and multifaceted. Drawing on data from leading institutions, the report reveals that despite projected global AI spending surpassing $2 trillion by 2026, AI’s direct contribution to U.S. GDP growth is negligible once imports are considered. Major tech companies plan massive investments in AI infrastructure, yet many executives report minimal operational impact. Labor markets face significant disruption, with an estimated 92 million jobs at risk by 2030 and notable employment declines among young workers in AI-exposed roles. Additionally, AI’s expansion drives up electricity prices, inflates e-commerce costs, and intensifies competition for critical resources like phosphates, affecting food affordability. The semiconductor supply chain is under severe strain, experiencing the largest supply-demand imbalance in decades, leading to soaring DRAM prices and a shrinking smartphone market, particularly in lower-cost segments
energyartificial-intelligencesemiconductor-supply-chaindata-centersenvironmental-impacttechnology-policyAI-infrastructureUK's first geothermal site to power 10,000 homes, mine lithium for EVs
The UK’s first geothermal power plant, developed by Geothermal Engineering Ltd (GEL) at United Downs in Cornwall, has officially begun operation after two decades of development. This plant harnesses heat from granite rocks nearly three miles underground, where temperatures reach around 200°C, to generate electricity for approximately 10,000 homes. Unlike weather-dependent renewables, geothermal energy provides a constant, carbon-neutral power source by circulating water through natural fractures in the hot granite to drive turbines. Octopus Energy has secured rights to distribute this geothermal electricity via the national grid, marking a significant milestone in the UK’s clean energy landscape. Beyond electricity generation, the geothermal site also offers a strategic resource advantage by extracting lithium carbonate from the geothermal brine, a critical mineral for electric vehicle batteries and other green technologies. The brine contains one of the world’s highest lithium concentrations at over 340 parts per million, with initial production expected to yield 100 tonnes of lithium—enough for 1,400 electric cars
energygeothermal-energylithium-extractionrenewable-energyelectric-vehiclesgreen-technologysustainable-powerSolar Industry Statement on Massachusetts House Advancing Affordable, Clean Energy Legislation - CleanTechnica
The Massachusetts House of Representatives recently passed House Bill 5151, titled An Act Relative to Energy Affordability, Clean Power, and Economic Competitiveness. This legislation aims to address rising utility costs in Massachusetts while advancing the state's leadership in clean energy. Key provisions include removing barriers to solar and storage development, creating a surplus interconnection service to utilize unused grid capacity, and establishing a statewide solar permitting platform expected to reduce average residential installation costs by approximately $7,000. Ruthie DeWit, Northeast State Affairs Director of the Solar Energy Industries Association (SEIA), praised the bill for accelerating solar and storage deployment, which are seen as the fastest and most affordable ways to add new grid capacity and lower energy prices for families. The reforms are designed to provide immediate relief to ratepayers and generate billions in long-term savings, reinforcing Massachusetts’ commitment to a clean energy economy. SEIA, a national trade association for the solar and solar+storage industries, supports policies that promote job creation
energyclean-energysolar-powerenergy-affordabilityenergy-legislationsolar-storagerenewable-energyBYD Launches ATTO 2 DM-i in Argentina - CleanTechnica
BYD has expanded its presence in South America by launching the BYD Atto 2 DM-i plug-in hybrid SUV in Argentina. The vehicle offers about 110 km (70 miles) of electric range on a full charge (WLTP), reflecting BYD’s strategy to introduce mixed powertrain models in markets like Argentina where battery electric vehicle (BEV) adoption remains low. BYD emphasizes the Atto 2 DM-i’s combination of electric performance and high-efficiency hybrid technology as a new benchmark for efficiency, versatility, and sustainable mobility in the country. The launch event in Buenos Aires attracted over 130 special guests, including nearly 100 journalists and influencers, highlighting BYD’s commitment to advancing electrified mobility in Argentina. The company also noted its recognition as the top-selling brand for pure electric and plug-in hybrid vehicles in Argentina in 2025, positioning the Atto 2 DM-i as a key model to expand access to new energy vehicles. Given Argentina’s early stage in EV
energyelectric-vehicleshybrid-technologysustainable-mobilityBYDplug-in-hybridnew-energy-vehiclesVolvo Scales Up Electric Heavy Trucks As Profits Fund Zero-Emission Shift - CleanTechnica
Volvo Group is leveraging its strong profitability and leading 19% share of the European heavy-truck market to accelerate the expansion of its zero-emission heavy truck portfolio, focusing on battery-electric and hydrogen fuel-cell technologies. The company’s robust financial position, including a net cash balance of SEK 63 billion and a 25.5% return on capital employed, enables significant investment in electrification under a multi-pathway strategy. Central to this shift is the FH Aero Electric truck, designed for regional and intercity logistics, featuring a new e-axle that increases battery capacity to 780 kWh and offers up to 600 km range with fast megawatt charging compatible with driver rest periods. Volvo’s extensive installed base of over 5,700 battery-electric trucks across 50 countries provides valuable real-world data to optimize vehicle design, charging infrastructure, and digital fleet services, supporting a growing service business with recurring revenue streams. Beyond highway transport, Volvo is deploying electric trucks in mining and
energyelectric-vehiclesbattery-electric-truckszero-emissionheavy-trucksdecarbonizationcharging-infrastructureWhy Is Hong Kong Ending EV Tax Breaks? Does It Make Sense? - CleanTechnica
Hong Kong is ending its substantial electric vehicle (EV) tax breaks by March 31, 2026, a policy shift justified by the government’s view that the local EV market has matured sufficiently. The current incentives offer up to HK$172,500 (about US$22,047) for EV purchases with trade-ins, but with EVs now accounting for 70% of new vehicle sales and 16% of all registered vehicles, Financial Secretary Paul Chan Mo-po argues that the market no longer requires such subsidies. This decision has sparked a surge in EV purchases as buyers rush to take advantage of the expiring tax breaks, with some dealers reporting a 17-fold increase in sales. Despite Hong Kong’s leadership in EV adoption—boasting one of the highest EV market shares globally, second only to Norway—critics worry that ending the tax breaks could slow the transition away from fossil-fueled vehicles. Some, including taxi drivers, have expressed dissatisfaction, fearing reduced incentives to switch to
energyelectric-vehiclesEV-tax-breaksclean-technologyHong-Kongfossil-fuel-phaseoutsustainable-transportationGeely & Xiaomi Shine In China — January EV Sales Report - CleanTechnica
The January 2024 electric vehicle (EV) sales report for China reveals a typical post-incentive sales slump following December’s record-breaking figures, with overall EV sales down 20% year-over-year (YoY) to 1.5 million units. Battery electric vehicles (BEVs) dropped 17% to 348,000 units, and plug-in hybrid electric vehicles (PHEVs) fell 24% to 248,000 units. However, extended-range electric vehicles (EREVs) bucked the trend with a 1% YoY increase, driven by their popularity in large SUVs less affected by the end of purchase tax exemptions. Despite the slowdown, plug-in electric vehicle (PEV) market share remained strong at 39% (23% BEV), close to January 2025 projections, with expectations to reach 54% PEV share by mid-year and potentially exceed 65% by year-end, underscoring China’s rapid EV adoption. A
energyelectric-vehiclesEV-salesChina-automotive-marketbattery-electric-vehiclesplugin-hybrid-electric-vehiclesclean-transportationEnergy Department Loans Money For Georgia Power’s Gas Fleet - CleanTechnica
The U.S. Department of Energy has approved a loan to Southern Company to support its subsidiary Georgia Power in constructing what will become the largest and most expensive gas-fired power fleet in the nation. This project involves building new combined cycle gas turbines at three plants in Georgia: Plant Bowen, Plant Wansley, and Plant McIntosh. The financial burden of these new turbines is expected to fall on Georgia Power’s ratepayers for the next 45 years. Environmental groups, notably the Sierra Club, have strongly criticized the decision. Sierra Club Campaign Organizing Strategist Michael Hawthorne argued that the investment primarily benefits data centers rather than everyday Georgians and labeled it a poor use of taxpayer money that props up a declining fossil fuel industry. He emphasized that the project will lead to higher electricity costs, increased air pollution, and long-term harm to communities and public health. The Sierra Club advocates instead for investment in cleaner, more affordable energy alternatives that serve the broader population.
energyDepartment-of-Energygas-fleetGeorgia-Powercombined-cycle-turbinesclean-energyinfrastructure-investmentFrom Mine to Recovery: The Case for Nickel Recycling in Europe - CleanTechnica
The article from CleanTechnica highlights the critical importance of scaling nickel recycling in Europe to support a resilient and low-carbon supply chain for clean technologies, particularly electric vehicle batteries. A recent study shows that recycling nickel from batteries generally results in a significantly lower carbon footprint compared to mining and refining primary nickel. For example, using recycled nickel in a typical VW ID4 battery can reduce CO2 emissions by approximately 1200 kg compared to conventional nickel sources. Hydrometallurgical recycling processes in Europe can cut carbon intensity by up to 70% relative to primary production, with emissions further reduced by Europe's cleaner electricity grid compared to countries like China. Despite this potential, Europe's current battery recycling capacity is far below what is needed to meet demand by 2030, and nearly half of planned recycling projects are at risk. To address this gap and foster a truly circular economy, Transport & Environment (T&E) recommends mainstreaming recycling in policy and funding, banning or restricting the export of waste materials outside the EU
energymaterialsbattery-recyclingnickel-recyclingclean-technologycarbon-footprintEuropeLargest Solar Farm In US Coming To Central Valley In California - CleanTechnica
The article discusses the development of what could become one of the largest solar farms in the United States, planned for California’s Central Valley. Due to ongoing water shortages and drought conditions, farmers in the region have been forced to leave significant portions of their land fallow, unable to cultivate crops like almonds, pistachios, and tomatoes. The Valley Clean Infrastructure Plan, approved by the Westlands Water District, proposes utilizing this uncultivated land for a massive solar installation spanning about 200 square miles—roughly four times the size of San Francisco. This project aims to generate up to 20 gigawatts (GW) of clean electricity, enough to meet about one-sixth of California’s energy needs by 2035, while also including energy storage and transmission infrastructure to distribute power beyond the Central Valley. Local farmers view the project as a beneficial solution to their water scarcity challenges, providing an alternative revenue stream that helps sustain their livelihoods amid agricultural difficulties. The solar farm will allow farmers to monetize
energysolar-powerrenewable-energyenergy-storageelectric-transmissionsolar-farmCalifornia-energy-projectsChina's new lithium battery chemistry offers higher energy density
Chinese researchers from Nankai University and the Shanghai Institute of Space Power Sources have developed a novel lithium battery chemistry featuring a fluorinated hydrocarbon electrolyte that significantly enhances energy density. By redesigning the electrolyte to use fluorinated solvents instead of conventional carbonate-based ones, they altered lithium salt dissolution and ion interactions at the molecular level. This innovation reduced lithium–fluorine interaction strength, improving ion mobility and enabling the battery to achieve an ultra-high specific energy of about 700 watt-hours per kilogram at room temperature, and maintain approximately 400 Wh/kg even at extremely low temperatures around −50°C. This performance notably surpasses current commercial lithium batteries, which typically offer around 250–255 Wh/kg at the pack level. The research, published in Nature, involved synthesizing alkanes with monofluorinated structures, such as 1,3-difluoro-propane (DFP), which provided low viscosity, high oxidation stability, and effective salt dissolution. While this breakthrough represents a
energylithium-batteryfluorinated-electrolyteelectric-vehicleshigh-energy-densitybattery-technologyenergy-storageNew dry battery process eliminates primer, cuts capacity loss 75%
Researchers in South Korea, led by Professor Won-Jin Kwak at UNIST and collaborators from Gachon and Chung-Ang Universities, have developed a novel dry-process battery electrode that significantly reduces initial capacity loss by about 75%. This innovation involves inserting a thin lithium-metal film between the anode active material and the copper current collector, replacing the conventional primer used for adhesion. The lithium film serves a triple function: it acts as an adhesion layer, eliminates the need for a separate primer, and supplies lithium to compensate for irreversible lithium loss during the first charge-discharge cycle. This approach promotes more uniform solid-electrolyte interphase formation, improving initial coulombic efficiency and cycle stability, which could increase electric vehicle (EV) driving range by approximately 20%. The new method also simplifies manufacturing by removing the wet-chemical primer coating and drying steps, enabling a more efficient, scalable dry manufacturing process compatible with existing roll-to-roll production lines. The technology is compatible with various cathode materials
energybattery-technologydry-process-electrodeselectric-vehicleslithium-metal-filmcapacity-loss-reductionmanufacturing-innovationLockheed Martin, Xanadu launch quantum AI push for defense edge
Lockheed Martin and quantum computing firm Xanadu have launched a collaborative research initiative aimed at advancing Quantum Machine Learning (QML), particularly focusing on quantum-powered generative models. These models, which learn data patterns to generate realistic outputs, currently rely on classical AI techniques that demand large datasets and significant computational resources, limiting their effectiveness in data-scarce or sensitive environments. The partnership seeks to explore whether quantum-native operations—such as Fourier-based methods unavailable to classical systems—can enable more efficient learning, reduce data requirements, and uncover new patterns beyond classical AI capabilities. This research sits at the intersection of quantum theory and advanced machine learning, with potential applications spanning defense, finance, and pharmaceutical sectors. The collaboration emphasizes foundational theory, aiming to rethink how quantum computers can represent and process information in higher-dimensional spaces. Lockheed Martin highlights the national security implications, as quantum-enhanced models could improve sensing, data fusion, and decision-support technologies critical to defense. Beyond defense, these advances may benefit industries reliant on complex
energyquantum-computingmachine-learningdefense-technologyadvanced-materialsdata-processingnational-securityGoogle paid startup Form Energy $1B for its massive 100-hour battery
Google has invested approximately $1 billion in Form Energy, a startup developing a groundbreaking iron-air battery capable of delivering 300 megawatts of continuous power for 100 hours. This battery technology operates by rusting iron through oxygen intake, releasing electrons to provide long-duration energy storage. The system is designed to complement renewable energy sources, smoothing the output from 1.4 gigawatts of wind power and 200 megawatts of solar power. Form Energy has been developing this technology for several years and recently established a production facility in West Virginia. The deal with Google marks the startup’s first major customer commitment, which has catalyzed further fundraising efforts, including a $500 million round currently underway. To date, Form Energy has raised $1.4 billion and plans to go public next year, positioning itself as a key player in large-scale, long-duration energy storage solutions.
energybattery-technologyrenewable-energyiron-air-batteryenergy-storageGoogle-investmentclean-energySophia Space raises $10M seed to demo novel space computers
Sophia Space has secured $10 million in seed funding from investors including Alpha Funds, KDDI Green Partners Fund, and Unlock Venture Partners to develop and demonstrate a novel approach to cooling high-powered space-based processors. Unlike traditional satellite designs that rely on large radiators for thermal management, Sophia Space’s technology leverages a thin, flexible, sail-like structure originally developed for orbital solar power plants at Caltech. This design enables passive heat dissipation through conduction by placing processors against a passive heat spreader, eliminating the need for active cooling and allowing about 92% of generated power to be used for processing. The company plans to validate this technology on the ground before deploying it in orbit via a satellite bus from Apex Space by late 2027 or early 2028. Sophia Space’s modular server racks, called TILES, measure one meter square and a few centimeters deep, integrating solar panels with computing hardware. The firm envisions scaling up to large space data centers by the 2030
energyspace-computingsatellite-technologypassive-coolingsolar-powerdata-centersmodular-server-racksSolar Power Project Completed On Capped Landfill In Rhode Island - CleanTechnica
The Coventry Landfill Solar project in Rhode Island has successfully completed the installation of a 5.740 MW DC solar array on a capped landfill site. This approach utilizes land that was previously unsuitable for other uses, avoiding the need to repurpose active land. The project, finalized by the end of 2025, benefits from a remediation plan approved by the Rhode Island Department of Environmental Management and the landfill’s capping in 2020 with WatershedGeo® ClosureTurf®, which facilitated efficient solar deployment. The system is expected to generate approximately 7.7 million kWh annually, enough to power around 600 homes. The project also delivered significant economic and environmental benefits to the local community. During construction, about 77 electrical and civil workers and 15 part-time support staff were employed, contributing to an estimated $4.4 million economic benefit through lease rental payments and property taxes. Environmentally, the solar installation is projected to avoid 3,759 tons of CO2 emissions in its
energysolar-powerrenewable-energyclean-energylandfill-solar-projectsolar-arrayenvironmental-benefitsEV Sales In Europe Grow As New Car Market Shrinks - CleanTechnica
In January 2026, new car registrations in Europe declined by nearly 4 percent compared to the same month in 2025, with 799,625 new cars registered versus nearly 832,000 previously. Despite this overall market shrinkage, battery electric vehicle (BEV) sales grew significantly, accounting for 19.3 percent of new car sales, up from 14.9 percent a year earlier. Sales of fully gasoline-powered cars dropped sharply by 28.2 percent, with major markets like France, Germany, Italy, and Spain experiencing steep declines. Diesel car registrations also continued to fall, down 22.3 percent, capturing just 8.1 percent of the market. BEV sales showed varied performance across European countries. France and Germany, the two largest markets, saw increases of 52.1 percent and 23.8 percent respectively, while Belgium and the Netherlands experienced declines. Other countries such as Denmark, Italy, Ireland, Poland, Croatia, Lithuania,
energyelectric-vehiclesbattery-electric-carshybrid-electric-vehiclesautomotive-marketEuropeclean-energyUS grants clean air permit for world's largest 11-GW private power grid
The US has granted a six-gigawatt Clean Air Permit to Fermi America for its Project Matador campus near Amarillo, Texas, enabling the development of what will become the world’s largest 11-gigawatt private power grid. This 18-million-square-foot facility, expected to be operational between the late 2020s and mid-2030s, will function as a private hypergrid powered by a combination of four nuclear reactors, natural gas, and solar energy. The permit, issued by the Texas Commission on Environmental Quality (TCEQ), confirms that the project meets stringent state and federal emissions standards, allowing construction to proceed to the next phase. Project Matador represents one of the most ambitious energy initiatives in the US, aiming to support the growing electricity demand driven by AI, advanced manufacturing, electrification, and other emerging sectors. Fermi America plans to deploy Siemens Energy SGT-800 gas turbines at the site and anticipates the project will add thousands of jobs
energyclean-energypower-gridnuclear-reactorsnatural-gassolar-energyenergy-infrastructureEnergy Dispensed On Rubicon’s Charging Network In South Africa Up 142% In 2025 To 625MWh - CleanTechnica
Rubicon’s 2025 annual report highlights significant growth in South Africa’s electric vehicle (EV) charging infrastructure and usage. By mid-2025, over 500 public charging stations operated nationwide, maintaining an EV-to-charger ratio of 1:7, which surpasses the global benchmark of 1:10. Rubicon’s network alone included 103 public stations and 20 dealership chargers, with a total installed capacity of 6,648 kW. The network dispensed 625 MWh of energy in 2025—a 142% increase from 2024—equivalent to 3.125 million kilometers of electric travel. The company processed 21,606 charging transactions, up 159% year-over-year, and plans to add 77 more stations by FY2027. Key developments included the introduction of credit card payments, fleet charge cards, and partnerships with major OEMs like Geely, Stellantis, and Jaguar/Land Rover. Customer charging behavior revealed a
energyelectric-vehiclescharging-infrastructureEV-charging-stationsrenewable-energySouth-Africaelectric-mobilityBiden's Green New Deal Supercharged Manufacturing Construction in USA, Trump Killing It - CleanTechnica
The article highlights the significant positive impact of the Green New Deal, specifically the Inflation Reduction Act of 2022, on U.S. manufacturing construction and blue-collar jobs. It credits this legislation with sparking the largest reshoring effort in U.S. history, leading to a near tripling of manufacturing construction from 2021 to 2024. Key sectors benefiting included electric vehicle (EV) battery factories, solar manufacturing, battery mineral mining and refining, and other clean technology industries. The Bipartisan Infrastructure Law, although not truly bipartisan in Congress, also played a role in stimulating growth in core 21st-century energy and tech manufacturing. However, the article argues that this progress is now being reversed under the Trump administration, which it describes as actively undermining cleantech projects by halting funding, raiding factories, and detaining workers. This shift has already led to a decline in manufacturing construction spending, signaling an end to the boom initiated under Biden’s policies. The author expresses frustration
energyclean-technologymanufacturingEV-batteriessolar-energyInflation-Reduction-ActGreen-New-Deal'World-first' ammonia-fueled marine engine passes key validation test
Swiss marine power company WinGD has achieved a world-first milestone by successfully completing Type Approval Testing (TAT) and Factory Acceptance Testing (FAT) for its ammonia-fueled two-stroke marine engine, the X-DF-A 1.0. These tests were conducted at HD Hyundai Heavy Industries’ facility in South Korea on a 52-bore engine intended for installation on a 46,000m³ LPG/ammonia carrier operated by Belgian shipping firm EXMAR. The vessel is set to be among the first ammonia-fueled gas carriers to enter commercial service. The testing, witnessed by Lloyd’s Register and other classification societies, demonstrated the engine’s excellent performance, reliability, and safety, leading to 30 orders from customers across various vessel segments including gas carriers, bulk carriers, tankers, and container ships. Ammonia is highlighted as a promising marine fuel because it contains no carbon molecules, enabling up to a 90% reduction in greenhouse gas emissions if produced with renewable
energyammonia-fuelmarine-enginedecarbonizationrenewable-energyshipping-industrygreen-technologyTesla Situation in China Doesn't Look Rosy - CleanTechnica
The article from CleanTechnica highlights a concerning decline in Tesla’s vehicle deliveries in China, the world’s largest electric vehicle (EV) market. Tesla delivered only 18,485 vehicles in January 2026, a steep drop of about 45% compared to 33,703 vehicles in January 2025. This decline is notable because it cannot be attributed to typical seasonal slowdowns, and there is little indication Tesla will recover in the current quarter. Customer wait times for Tesla vehicles in China have shortened significantly to one to three weeks, signaling excess inventory and weak demand. To stimulate sales, Tesla has extended aggressive financing incentives through March 31, including ultra-low interest rates and interest-free financing, despite regulatory restrictions in China against selling vehicles below production cost. The article suggests that Tesla’s struggles stem from a lack of new product offerings and innovation in a highly competitive and rapidly evolving Chinese EV market. Tesla has largely focused on advancing its Full Self Driving (FSD) technology, banking on its
energyelectric-vehiclesTeslaautonomous-drivingEV-marketChinaclean-energyUS lab advances nuclear reactor safety with extreme 1,340°F testing
Researchers at the US Department of Energy’s Argonne National Laboratory have developed an advanced testing method capable of measuring the thermal conductivity of nuclear materials at temperatures up to 1,000 Kelvin (approximately 1,340°F). This breakthrough, based on the “suspended bridge method,” allows scientists to analyze microscopic samples of nuclear fuel—hundreds of times thinner than a human hair—in a vacuum environment. By isolating individual phases of fuel materials, the technique provides highly precise data on how heat moves through fuel under extreme conditions, which is critical for ensuring reactor safety and efficiency. The method currently operates across a wide temperature range (-450°F to 260°F) with imminent upgrades extending to 1,340°F, and initial tests on stainless steel and uranium-molybdenum alloys have validated its accuracy. This innovation addresses a significant gap in existing testing methods that struggle to capture how nuclear fuel degrades during actual reactor operations. By enabling precise measurement of thermal conductivity at extreme temperatures, the technique helps
energynuclear-energymaterials-sciencethermal-conductivityreactor-safetyadvanced-testing-methodsnuclear-fuelNIO Inc.’s Subsidiary Enters into Definitive Agreements for RMB2.257 Billion Investment - CleanTechnica
NIO Inc., a leading global smart electric vehicle company, announced that its subsidiary GeniTech Co., Ltd. (“Shenji”), which focuses on intelligent-driving chip technology, has entered into definitive agreements with investors in China for a RMB 2.257 billion cash investment. Following the transaction, NIO will maintain a controlling 62.7% equity stake in Shenji, while the new investors will hold 27.3%, and entities managing Shenji’s share incentive plan will retain 10%. The investment is subject to customary closing conditions and will allow NIO to continue consolidating Shenji’s financial results. NIO, founded in 2014, is committed to innovation in smart electric vehicles and next-generation core technologies, offering premium vehicles under its NIO brand, family-oriented models via ONVO, and small high-end electric cars through FIREFLY. The company emphasizes technological breakthroughs, quality products, and community growth. The announcement also includes a safe harbor statement highlighting that forward-looking
energyelectric-vehiclessmart-electric-vehiclesintelligent-drivingautomotive-technologyinvestmentNIOUS firm's mile-deep underground nuclear reactors advance with fuel deal
Deep Fission, a California startup, is advancing its innovative approach to nuclear energy by developing small modular reactors (SMRs) installed a mile underground. The company recently secured a key fuel supply agreement with Urenco USA to purchase low-enriched uranium (LEU) from its New Mexico enrichment facility. This fuel will power testing and demonstration phases of Deep Fission’s initial “Gravity” reactor, supporting participation in the US Department of Energy’s Reactor Pilot Program and early commercial operations. The company also raised $80 million in new financing aimed at scaling production for AI-driven data centers and US electricity grids. The “Gravity” reactor design leverages natural geology by placing a 15 MWe reactor deep underground, where the Earth’s pressure and surrounding rock provide passive containment and shielding. This eliminates the need for expensive surface pressure vessels and containment structures, potentially reducing construction costs by up to 80% compared to traditional nuclear plants. The modular system is highly scalable, with the potential for 100 reactors on one
energynuclear-energysmall-modular-reactorsunderground-reactorsclean-energyenergy-innovationenergy-infrastructureRecycled human waste could help grow crops on moon and Mars colonies
Researchers from multiple universities have developed a method to transform barren lunar and Martian regolith into fertile soil by combining recycled human and plant waste with simulated extraterrestrial soil. This process extracts essential nutrients such as sulfur, calcium, and magnesium from the otherwise inert minerals, making the soil suitable for plant growth. The study, led by Harrison Coker, highlights that organic waste will be crucial in generating productive soils for future moon and Mars colonies, enabling sustainable agriculture without reliance on Earth resupply missions. The team tested this concept using NASA’s Bioregenerative Life Support Systems (BLiSS), which converts synthetic wastewater into a nutrient-rich solution. When mixed with simulated lunar and Martian soil, this effluent chemically and physically altered the regolith, smoothing its abrasive particles and releasing vital nutrients. While the results are promising, further research is needed using actual lunar and Martian soil samples to confirm the approach’s viability. This work lays important groundwork for creating a closed-loop waste-to-fertilizer cycle essential
energymaterialsspace-agriculturelunar-soilMartian-soilbioregenerative-life-supportsustainable-farmingJapan turns to manganese oxide for better lithium-ion batteries
Scientists at Tohoku University’s Advanced Institute for Materials Research (WPI-AIMR) in Japan have developed a manganese-rich oxide cathode for lithium-ion batteries that demonstrates nearly perfect cycling stability, marking a significant advancement in battery technology. Lithium-ion batteries, critical for renewable energy storage and electric vehicles, traditionally rely on cobalt in their cathodes, which is costly and associated with unethical mining practices. By switching to manganese, an abundant and inexpensive element, the researchers aim to reduce costs and environmental impact. However, manganese-based cathodes have historically suffered from Jahn-Teller (JT) distortions, which cause structural instability and degrade battery performance. To overcome this, the team employed a novel approach called “interfacial orbital engineering,” targeting the atomic-level electronic structure to neutralize JT distortions. Unlike previous methods that used doping or coatings, this technique manipulates the electronic orbital topology at non-collinear interfaces, creating “orbital geometric frustration” that prevents energy-lowering distortions. This
energylithium-ion-batteriesmanganese-oxidebattery-materialscathode-technologyenergy-storagematerials-scienceLockheed plans nuclear fission demonstrator for future moon base
Lockheed Martin is developing a Fission Surface Power (FSP) system to provide reliable, continuous nuclear energy for sustained human presence and industrial activity on the Moon. The company advocates a flexible, scalable architecture starting with smaller 5–10 kW reactors for initial operations, progressing to 25–50 kW and eventually 100 kW systems to support larger commercial and industrial infrastructure. This approach addresses the challenges of the lunar environment, such as long nights and permanently shadowed regions where solar power is insufficient. Lockheed Martin is collaborating with NASA and the Department of Energy, aiming for a 2030 launch target under a recent White House Executive Order that prioritizes space nuclear power to maintain U.S. leadership. The modular design of the FSP system is intended to reduce costs and strengthen supply chains for future Mars missions by establishing a common power architecture scalable from orbital platforms to lunar bases. The technology focuses on advanced Brayton engine cycles for improved efficiency and autonomous operation, requiring further development in high
energynuclear-fissionlunar-basespace-powerLockheed-Martinrenewable-energyspace-explorationFrance trials nuclear-powered attack submarine to modernize fleet
France has advanced its naval modernization with the De Grasse, the fourth Suffren-class nuclear-powered attack submarine, beginning sea trials on February 24, 2026. This milestone follows the activation of its nuclear reactor in December 2025 and extensive dockside testing since its launch in May 2025. The De Grasse is part of the Barracuda program, a long-term initiative to replace the aging Rubis-class submarines from the 1980s with six modern, stealthier, and more capable vessels. Managed by the French defense procurement agency (DGA) and developed in partnership with the French Atomic Energy and Alternative Energy Commission (CEA), Naval Group, and TechnicAtome, the program aims to sustain France’s undersea warfare capabilities through at least 2060. The Barracuda-class submarines are designed for over 30 years of service, featuring enhanced stealth, longer endurance, and expanded combat capabilities compared to their predecessors. Each submarine displaces around 4
energynuclear-propulsionsubmarine-technologydefense-technologymarine-engineeringrenewable-energy-alternativesnaval-innovationDespite Political Rhetoric, Conservative Support for Solar Is Solidifying. Here’s Why. - CleanTechnica
Despite prevailing political rhetoric opposing clean energy within parts of the current administration, conservative voters in the United States are increasingly supportive of expanding solar power. Polls conducted by Fabrizio, Lee & Associates and Kellyanne Conway’s KA Consulting reveal that a significant majority of Republican voters back solar energy because it lowers electricity costs, bolsters American manufacturing, and enhances energy security. Notably, 68% of GOP voters favor building all forms of electricity generation, including solar, to reduce costs, and 70% support utility-scale solar projects using American-made materials. This support is evident even in traditionally conservative states, where practical benefits of solar power outweigh partisan rhetoric. Red states are leading the nation in new solar installations, with 73% of new U.S. solar capacity in 2025 located in states that voted for President Trump. States like Texas, Florida, Indiana, Ohio, and Arkansas are setting deployment records, driven by competitive markets favoring the lowest-cost and fastest-to-build energy sources. This solar
energysolar-powerrenewable-energyenergy-policyAmerican-manufacturingenergy-securitysolar-deploymentAI Search is Rewriting the Cleantech Buyer’s Journey — and Many Brands Aren’t Ready - CleanTechnica
The article from CleanTechnica highlights a significant shift in the cleantech buyer’s journey driven by the rapid adoption of AI-powered search tools like ChatGPT, Gemini, and Claude. Traditionally, cleantech marketing focused on Google rankings, website traffic, and event presence, but now up to 95% of B2B buyer interactions occur within AI tools before any direct website visit. This shift means that cleantech companies must adapt their marketing strategies to ensure accurate and favorable representation within AI models, which rely on both pre-trained memory and live web searches to provide information. A study conducted with SEO agency Rampiq analyzed AI visibility across 100 leading cleantech firms, revealing critical gaps and opportunities. The research found that AI’s pre-trained memory often provides vague or inaccurate company descriptions, while live search yields more precise and current information. However, many cleantech companies lack sufficient third-party citations, especially from high-authority media, which AI heavily favors over company-owned content. Additionally,
energycleantechAI-searchlarge-language-modelsB2B-marketingclean-technologyAI-visibilityBrazil EV Sales Report: As Local Production Ramps Up, The Latin American Giant Has Started 2026 At 9.8% EV Market Share - CleanTechnica
The article reports a significant acceleration in Brazil’s electric vehicle (EV) market as 2026 begins, with EV market share reaching 9.8%. After a period of slow growth and plateaus throughout 2023 and 2024, EV sales surged notably in late 2025, peaking at over 26,000 units in December—a 77% increase from the previous year’s record December sales. Although January 2026 saw a typical seasonal dip to 16,671 units, this still represented a strong 48% year-over-year increase. The EV market in Brazil is currently split between plug-in hybrid electric vehicles (PHEVs), which make up 56% of sales, and battery electric vehicles (BEVs), which accounted for 44% in 2025 and nearly 50% in the most recent month. The growth in EV sales is occurring alongside a decline in combustion engine vehicle sales, indicating a shift in consumer preference and a gradual reduction in traditional internal
energyelectric-vehiclesEV-marketBrazilclean-energymarket-shareelectrificationSierra Club Statement on Confirmation Hearing on Nomination of Steve Pearce to Lead BLM - CleanTechnica
The article reports on the Senate Committee on Energy and Natural Resources' confirmation hearing for Steve Pearce, President Donald Trump’s nominee to lead the Bureau of Land Management (BLM). Pearce, a former U.S. Representative known for supporting the sale of federal public lands to private interests and opposing national monuments, faced tough questions regarding his record. The BLM oversees approximately 245 million acres of public surface land and 700 million acres of subsurface mineral rights. Pearce’s nomination follows the withdrawal of Trump’s first nominee, Kathleen Sgamma, amid controversy over her emails criticizing Trump’s actions during the January 6 Capitol Riot. The Sierra Club, through Athan Manuel, director of its Lands Protection Program, strongly opposed Pearce’s nomination, highlighting his history of advocating for the mass sell-off of public lands—a move that the Congressional GOP unsuccessfully attempted recently. Manuel emphasized that such policies threaten the preservation of public lands for future generations and urged the Senate to reject Pearce’s nomination in line
energypublic-landsoil-and-gas-drillingenvironmental-policyclean-energyland-managementSierra-ClubRelaunch of Net Zero Asset Managers Initiative - CleanTechnica
The Net Zero Asset Managers initiative (NZAM) has relaunched with the support of over 250 asset managers, providing a platform for these firms to disclose their individual net-zero commitments and implementation plans. This relaunch signals a continued commitment by many asset managers to address climate change through their investment strategies. However, the initiative’s effectiveness depends on whether these commitments translate into tangible actions, such as shifting capital toward climate solutions and ending support for fossil fuel expansion. Ben Cushing, campaign director of the Sierra Club’s Sustainable Finance campaign, emphasized that membership in NZAM alone does not guarantee meaningful climate action. He highlighted that asset managers must align their strategies with clear client mandates to manage systemic climate risks and leverage their influence to ensure credible transition plans from portfolio companies. The Sierra Club views NZAM participation as a minimum standard rather than a final goal, urging asset owners to hold managers accountable for delivering measurable results beyond symbolic commitments. The Sierra Club, a leading grassroots environmental organization, continues to advocate for clean energy and
energynet-zeroasset-managementclimate-commitmentsclean-energysustainable-financeenvironmental-activismHouse Passes Bills That Would Worsen Energy Affordability & Reliability - CleanTechnica
The U.S. House of Representatives recently passed two bills, H.R. 4626 (the Home Appliance Protection and Affordability Act) and another unnamed bill, that critics argue would negatively impact energy affordability and reliability. H.R. 4626 would make it easier to weaken or revoke federal appliance efficiency standards and more difficult to update them, potentially locking families into higher energy and water costs over time while increasing strain on the energy grid. Appliance efficiency standards have historically saved households approximately $6,000 in utility bills over the past decade. The second bill would repeal important consumer savings and workforce programs, including the High-Efficiency Electric Home Rebate Program, which supports cost-saving home energy upgrades. Environmental advocates, including the Sierra Club, strongly oppose these measures. Sierra Club Deputy Legislative Director Xavier Boatright stated that these bills would exacerbate the energy affordability crisis by increasing costs for families already struggling with rising energy bills. Furthermore, the bills could undermine U.S. manufacturing competitiveness by stifling
energyenergy-affordabilityenergy-efficiencyappliance-standardsenergy-policyenergy-reliabilityclean-energyTrump EPA: Value of Human Life is $0 - CleanTechnica
The article from CleanTechnica criticizes the Trump administration’s Environmental Protection Agency (EPA) for assigning a value of zero to human life in its cost-benefit analyses. This approach effectively ignores the health and life-saving benefits of environmental regulations, undermining the justification for policies that protect public health. The author argues that while valuing human life in economic terms is complex and debated, setting it to zero is harmful and reflects a callous disregard for human well-being, consistent with broader criticisms of the administration’s priorities. The piece highlights that such valuation is crucial for assessing the true costs and benefits of regulations, especially those affecting pollution from coal plants and vehicles. By ignoring the monetary value of lives saved, the EPA under Trump diminishes the perceived benefits of environmental protections, potentially leading to weaker regulations. The article frames this policy choice as emblematic of the administration’s focus on financial gain for insiders at the expense of public health and lives, reinforcing a pattern of neglect toward vulnerable populations both domestically and internationally
energyenvironmental-protectionEPApolicy-analysiscoal-powergas-vehicleshuman-life-valuationPhotos: Samsung debuts Galaxy S26 series with faster charging, new privacy display
Samsung has unveiled its Galaxy S26 series, consisting of the Galaxy S26, S26+, and S26 Ultra, which builds upon the design and features of its predecessor with a focus on refinement rather than radical changes. The new lineup emphasizes smarter AI integration, including context-aware suggestions, multi-object recognition in images, AI-powered call screening, and enhanced on-device privacy controls. A standout feature is the Galaxy S26 Ultra’s hardware-level Privacy Display, which limits side-angle screen visibility to protect sensitive information in public settings. Performance improvements come from the Snapdragon 8 Elite Gen 5 for Galaxy chipset (with an Exynos 2600 variant in select markets), alongside better thermal management to sustain performance during intensive tasks. Display enhancements include adaptive refresh rates up to 120Hz and Vision Booster technology across all models, with the Ultra featuring a 6.9-inch QHD+ Dynamic AMOLED 2X screen. Camera upgrades focus on computational photography and video stabilization, retaining the Ultra’s 200MP primary
energysmartphone-technologyAI-integrationprivacy-displaySnapdragon-8-Elitethermal-managementdisplay-technologyThe White House wants AI companies to cover rate hikes. Most have already said they would.
The article discusses the impact of expanding AI data centers on the national electrical grid, which has contributed to a more than 6% rise in average electricity prices over the past year. This increase poses political challenges ahead of upcoming elections, prompting President Donald Trump to call on major tech companies to assume responsibility for their power needs by building their own power plants. Several leading tech firms, including Microsoft and Google, have already publicly committed to covering the electricity cost increases linked to their data centers, either by paying higher rates or investing in their own energy sources. However, the specifics of how these commitments will be implemented and how responsibility for price hikes will be allocated remain unclear. The White House has not provided detailed responses to inquiries about the policy, and some lawmakers, such as Senator Mark Kelly, argue that informal agreements with tech companies are insufficient. Additionally, experts caution that on-site power plants may not fully resolve the issue, as they could strain supply chains for natural gas, turbines, photovoltaics, and batteries,
energydata-centerselectricity-pricespower-plantstech-companiesenergy-policyrenewable-energyIEEE Life Fellow Tom Coughlin on why memory and storage capacity will shape AI data center growth
Tom Coughlin, an IEEE Life Fellow and president of Coughlin Associates, emphasizes that memory and storage capacity are critical factors shaping the future growth of AI data centers. With over four decades in digital storage, Coughlin highlights that storage is not just a passive repository but the foundational infrastructure enabling computation, AI, and digital society. He views the current AI boom as a potential inflection point in computing history, particularly if the focus shifts toward augmented human intelligence, which he believes can empower people to achieve more and improve quality of life. Coughlin warns that despite the excitement around AI compute power, there is a growing risk of memory and storage shortages that could constrain data center expansion and other applications from late 2025 through 2026. The surge in demand stems from the need to store vast amounts of raw sensor data, AI training models, logs, and domain-specific data to improve inference results. Emerging technologies like Inference Context Aware Storage are expected to further increase storage requirements.
energydata-storageAImemory-technologydata-centersdigital-infrastructurecomputingCO2-bound waste ash could replace sand and gravel in roads, buildings
German researchers from Cologne University of Applied Sciences (TH Köln) and RWTH Aachen University, led by the Bergischer Waste Management Association (BAV), are developing a method to convert municipal solid waste incineration (MSWI) ash into a sustainable construction material by permanently binding CO2 through carbonation. MSWI ash, which contains hazardous substances like heavy metals and dioxins, is produced in large quantities in Germany and currently requires careful processing to remove contaminants. The project explores natural carbonation reactions where minerals in the ash chemically bind CO2, potentially transforming the ash into a substitute for sand, gravel, or concrete components. The team is testing two carbonation techniques—wet carbonation, which allows higher CO2 uptake but needs energy-intensive drying, and moist carbonation, which forms a dense carbonated surface layer but stores less CO2. A pilot plant at the Leppe Waste Management Center in Lindlar, Germany, will trial these methods under real-world conditions. The ultimate goal is to produce carbonated ash that
energymaterialsCO2-capturesustainable-constructionwaste-recyclingcarbon-sequestrationconcrete-innovationThe public opposition to AI infrastructure is heating up
The article discusses growing public opposition across the United States to the rapid expansion of data centers driven by the AI boom. This backlash has prompted several states and localities to consider or enact temporary bans on new data center construction to assess their environmental and economic impacts. Notably, New York proposed a three-year moratorium on new data center permits statewide, while cities like New Orleans and Madison, Wisconsin, have already paused new developments following public protests. This resistance spans the political spectrum, with figures such as Florida Governor Ron DeSantis, Vermont Senator Bernie Sanders, and Arizona Governor Katie Hobbs supporting measures to limit data center growth, reflecting widespread populist concerns about the tech industry's footprint. Despite the pushback, major tech companies including Amazon, Google, Meta, and Microsoft plan to significantly increase capital expenditures on data center infrastructure to meet growing AI compute demands. Polling indicates that nearly half of respondents oppose new data centers in their communities, though many remain undecided, suggesting public opinion could still shift. In
energydata-centersAI-infrastructurecloud-computingenvironmental-impacttech-industrylegislative-policyHow pilot projects are testing high power dynamic EV charging roads
The article discusses the development and testing of high-power dynamic wireless charging systems for electric vehicles (EVs), which aim to reduce dependence on stationary charging by embedding power transfer infrastructure directly into roads. These systems use resonant inductive coupling, where buried transmitter coils in the road generate high-frequency magnetic fields (around 85 kHz) that transfer energy to receiver coils under moving vehicles. While static wireless charging pads can achieve efficiencies above 95%, dynamic charging efficiencies are lower (approximately 70-80%) due to factors like coil misalignment and air gaps. Despite these challenges, pilot projects have demonstrated in-motion power transfer rates exceeding 200 kW, sufficient to support entire EV fleets and enable extended driving ranges limited only by road coverage. The article also highlights the technical and environmental challenges of dynamic charging. High currents in the coils produce stray electromagnetic fields that can interfere with communications and cause heating issues, such as road surface temperatures exceeding 100°C observed in French tests. However, some manufacturers, like Stell
energyelectric-vehicleswireless-chargingdynamic-charginginductive-power-transferEV-infrastructureresonant-inductive-couplingUK firm's 100-year nuclear can wins deal for special materials mission
UK-based manufacturer LTi Metaltech has secured a contract worth over £45 million to produce specialized “100-year” storage vessels for Sellafield’s Product and Residue Store Retreatment Plant (SRP). These high-integrity containers will house special nuclear materials, including plutonium, transferred from aging storage sites at Sellafield. The SRP facility aims to safely store these sensitive materials for at least a century, supporting Sellafield’s long-term environmental remediation goals. The contract involves a two-phase approach: a three-to-four-year technical development phase followed by a 10-year volume production phase, with demand expected between 4,500 and 9,500 units depending on the product category. LTi Metaltech won the contract through a competitive tender process, leveraging its “New Product Introduction” capabilities and resilient supply chain. The company will establish a dedicated facility in Cumbria for warehousing, assembly, and logistics, alongside offering welding school placements and apprenticeships to local residents, emphasizing social
energynuclear-materialsstorage-vesselsenvironmental-remediationmanufacturingspecial-nuclear-materialslong-term-storageCompetition Is Heating Up In The US Energy Storage Space
The US energy storage sector is becoming increasingly competitive, highlighted by Tesla’s plans to produce its Megapack 3 utility-scale batteries in Texas and Massachusetts-based startup Form Energy’s recent advancements. Form Energy has launched a new iron-air battery factory in West Virginia and secured a landmark 300-megawatt, 100-hour energy storage contract with Xcel Energy and Google. Unlike traditional lithium-ion batteries, which typically provide 2-8 hours of energy storage and face cost, supply chain, and safety limitations, Form’s iron-air technology aims to deliver long-duration storage at significantly lower costs and enhanced safety, enabling reliable renewable energy supply over multiple days. Form Energy, founded in 2017, has attracted substantial private investment and government support, including up to $150 million from the US Department of Energy to establish its “Form Factory 1” and create around 600 jobs. The company’s technology has been recognized globally, becoming a finalist for the Earthshot Prize in 2025. However
energyenergy-storagebatteriesTesla-MegapackForm-Energyiron-air-batteryrenewable-energyTesla Planning 64 New Megacharging Sites Across 15 States? - CleanTechnica
Tesla has updated its “Find Us” map to show 64 new Megacharger sites planned across 15 states, indicating a significant expansion of its high-power charging infrastructure for electric semi trucks. This network aims to create connected corridors rather than isolated charging points, with Chicago emerging as a key hub and the Southeast region filling in. The expansion aligns with freight transportation routes, offering greater flexibility for regional and long-haul electric trucking operations. Pilot Travel Centers recently announced plans to install Tesla Megachargers at several locations, each capable of delivering up to 1.2 MW of power, primarily targeting Tesla Semis but potentially accommodating other electric big rigs in the future. Electrification of freight transport is seen as a critical step toward reducing air pollution and lowering operational costs, due to the efficiency of electric motors and the lower cost of electricity compared to diesel fuel. Electric trucks also provide health benefits by eliminating diesel exhaust exposure for drivers and reducing pollution caused by idling engines. While the expansion of Tesla
energyelectric-vehiclesTeslamegachargerselectric-truckscharging-infrastructuresustainabilityUS' powerful jet F-22 Raptor could get stealthy external fuel tanks
Lockheed Martin has unveiled a concept model for an upgraded version of the F-22 Raptor, informally called “Raptor 2.0,” which aims to keep the iconic stealth fighter relevant amid evolving threats and strategic demands. A key feature of this update is the introduction of redesigned external fuel tanks with stealthy, radar-reducing contours. Unlike traditional external tanks that compromise stealth and are often jettisoned before entering contested airspace, these new tanks are shaped to maintain low observability while extending the jet’s range. This enhancement addresses the need for greater endurance in expansive operational theaters like the Indo-Pacific, where long distances between bases require tactical aircraft to have increased fuel capacity without sacrificing survivability. Additionally, the concept includes the integration of underwing pods believed to house an infrared search and track (IRST) systems. IRST provides passive detection of heat signatures, offering a stealthier alternative to radar and improving the F-22’s ability to detect low-observable targets such as stealth
energystealth-technologyaerospace-materialsfuel-tanksmilitary-aviationLockheed-Martinaircraft-designChina's solar-powered 'biohybrids' remove 94% uranium from wastewater
Chinese scientists at Southwest University of Science and Technology have developed an innovative “self-regenerating bacteria-mineral biohybrid system” that significantly improves the cleanup of uranium-contaminated wastewater. This system harnesses light-harvesting nanoparticles grown in situ on the surface of Shewanella putrefaciens bacteria, creating a tightly integrated biohybrid that functions like a solar cell. When exposed to light, the ferrous sulfide nanoparticles generate photoelectrons that accelerate electron transfer, enabling the bacteria to convert soluble uranium into a stable, immobile precipitate. This process achieves a remarkable 94% uranium removal rate in actual mine wastewater, compared to the 48% removal rate by conventional bacteria. The biohybrid system operates as a closed-loop, self-renewing cycle where photoelectrons enhance bacterial metabolism, which in turn regenerates the mineral active sites, maintaining continuous treatment efficiency. Beyond uranium removal, the treated water exhibited reduced toxicity to crops, indicating ecological benefits. This technology addresses
energysolar-powerbiohybrid-systemsuranium-remediationbioremediationnanomaterialsenvironmental-cleanupNew US liquid metal nuclear fuel could boost energy output of reactors
Oak Ridge National Laboratory (ORNL) has partnered with Australian investment firm Out The Back Ventures to advance a novel nuclear fuel technology called Uranium Dioxide Liquid Metal Suspension (ULIMES). This innovative approach replaces the traditional solid uranium dioxide (UO2) fuel pellets used in most U.S. light water reactors (LWRs) with unsintered UO2 particles suspended in a liquid metal carrier. The circulating liquid fuel system enables continuous movement through different neutron flux zones, promoting uniform fuel burnup and eliminating inefficiencies caused by the “self-shielding” effect in conventional solid fuels. The ULIMES technology offers significant safety and efficiency improvements. The liquid metal carrier enhances thermal conductivity, allowing better reactor cooling, lower peak fuel temperatures, and reduced material damage from fission gases and radiation. Additionally, ULIMES is chemically compatible with existing reactor materials, facilitating integration without the need for extensive new material qualification programs. This compatibility could reduce costs and accelerate deployment by bridging current reactor designs
energynuclear-fuelliquid-metallight-water-reactorsreactor-efficiencythermal-conductivitynuclear-safetyQuantum study could enable battery-free energy harvesting devices
An international team of scientists, led by Professors Dongchen Qi and Xiao Renshaw Wang, has demonstrated that tiny imperfections and lattice vibrations in a quantum material can be harnessed to control the nonlinear Hall effect (NLHE), a quantum phenomenon that generates a voltage perpendicular to an alternating current without the need for a magnetic field. Unlike the classical Hall effect, which requires a magnetic field and is widely used in sensors, the NLHE enables the direct conversion of alternating signals into usable direct current without traditional diodes or bulky components. This breakthrough suggests the potential for developing smaller, more efficient energy-harvesting devices that could operate battery-free by drawing energy directly from their environment. The researchers studied a high-quality topological material exhibiting stable NLHE behavior up to room temperature. They found that the direction and strength of the voltage generated by the NLHE could be controlled by temperature: at lower temperatures, tiny material imperfections dominated the effect, while at higher temperatures, natural crystal lattice vibrations influenced the electrical signal’s
energyquantum-materialsnonlinear-Hall-effectenergy-harvestingbattery-free-devicessensorswearable-technologyNew safer lithium-metal EV battery supports 12-minute fast charging
South Korean researchers from KAIST and Korea University have developed a novel lithium-metal battery technology that addresses key challenges in fast-charging electric vehicle (EV) batteries. Their innovation centers on introducing thiophene into the electrolyte, which forms an “intelligent protective” layer on the lithium surface. This dynamic layer reorganizes its electronic structure in response to lithium ion movement, creating stable pathways that prevent uneven lithium deposition and dendrite growth—needle-like structures that cause short circuits and safety risks. This approach overcomes the longstanding issue of interfacial instability at the electrode-electrolyte boundary, enabling safer and more durable lithium-metal batteries. The team demonstrated that their battery can achieve ultra-fast charging in just 12 minutes at current densities exceeding 8 mA/cm², closely matching real-world EV fast-charging demands. Using in situ atomic force microscopy, they confirmed uniform lithium deposition and removal at the nanoscale, indicating mechanical and structural stability under aggressive charging. Additionally, the technology is compatible with common
energylithium-metal-batteryfast-chargingelectric-vehiclesbattery-safetydendrite-suppressionelectrolyte-additiveUrsa Major unveils hypersonic missile for air, sea and land launch
U.S. hypersonic propulsion company Ursa Major unveiled the HAVOC Missile System on February 24, a new hypersonic missile designed for rapid, large-scale production to provide faster and more affordable high-speed weapons. Announced at the Air and Space Forces Association Air Warfare Symposium, HAVOC serves a dual role as both a combat weapon and a hypersonic target for testing and training, supporting urgent operational needs while bolstering the U.S. industrial base. Central to the system is Ursa Major’s Draper liquid rocket engine, which uses storable propellants and additive manufacturing to reduce costs significantly compared to traditional air-breathing hypersonic engines. The missile is engineered for mass production and rapid delivery, emphasizing affordability and scalability alongside high performance. A key innovation of HAVOC is its throttleable and restartable engine across all flight phases—boost, cruise, and terminal—enabling advanced maneuverability and mission flexibility beyond conventional hypersonic boost-glide or cruise missiles
materialsenergyadditive-manufacturinghypersonic-propulsionrocket-enginemissile-technologyaerospace-materials‘World’s largest battery’ to help run Google’s new clean energy data center
Google announced plans to build a new data center in Pine Island, Minnesota, powered by 1.9 gigawatts of clean energy from wind and solar sources. Central to this initiative is a 300-megawatt iron-air battery system developed by Form Energy, claimed to be the "world’s largest" with a 30-gigawatt-hour capacity and 100-hour duration. This long-duration battery technology differs from conventional lithium-ion batteries by storing energy through reversible iron rusting, enabling the data center to operate on clean energy for extended periods, including nights or low-generation times. Although less efficient than lithium-ion batteries (50-70% vs. over 90% energy return), Form’s batteries are significantly cheaper, costing about $20 per kilowatt-hour, roughly a third of lithium-ion costs. The project also introduces an innovative utility fee system in Minnesota called the Clean Energy Accelerator Charge (CEAC), designed to help utilities invest in clean energy without conflicting with regulatory preferences for low
energyclean-energybattery-storageiron-air-batteryrenewable-energydata-centerGoogle-energy-projectFord Now Charging $495 for Frunk - CleanTechnica
The article from CleanTechnica highlights Ford's recent decision to charge an additional $495 for the front trunk, or "frunk," on its Mustang Mach-E electric vehicle. Traditionally, frunks have been a popular and standard feature in most EVs, offering extra storage space due to the absence of a conventional engine. Ford has previously promoted the frunk as a key benefit of its EVs, especially the F-150 Lightning, which boasts one of the largest frunks in the market. However, the new pricing move marks a departure from the norm, as EV owners have generally expected the frunk to be included as a standard feature without extra cost. The article criticizes Ford’s approach, arguing that charging nearly $500 for what is essentially an empty storage compartment covered by a plastic tub is excessive and alienates customers. It points out that while automakers often add fees for optional features, the frunk is a fundamental advantage of EV design and should not be monetized separately. The author
energyelectric-vehiclesFord-Mustang-Mach-EEV-featuresautomotive-industryfrunkelectric-trucksSierra Club Response to Donald Trump’s State of the Union Address - CleanTechnica
In response to Donald Trump’s State of the Union address during his second term, Sierra Club Executive Director Loren Blackford sharply criticized the administration’s environmental and economic policies. Blackford argued that Trump’s policies have harmed American families by supporting costly, failing coal plants while defunding affordable clean energy initiatives that could reduce bills and create jobs. The statement highlighted the administration’s rollback of environmental protections, including weakened drinking water standards, withdrawal from climate agreements, and controversial EPA directives that devalue human life in regulatory analyses. Blackford emphasized that Trump’s policies favor corporate polluters and fossil fuel executives at the expense of the broader public. The Sierra Club reaffirmed its commitment to opposing the administration’s approach through activism, legal challenges, and public education. As America’s largest grassroots environmental organization, the Sierra Club focuses on promoting clean energy, protecting community health, preserving wildlife, and ensuring access to nature. The organization pledged to continue advocating for environmental justice and sustainability in communities across the country, standing against policies that undermine these
energyclean-energyenvironmental-policyclimate-changerenewable-energyEPAfossil-fuelsTesla's NHTSA Deadline for Reporting Accidents, Iced Superchargers in Sweden, & New Model Y L in Australia - CleanTechnica
The article from CleanTechnica covers three recent Tesla-related developments. First, Tesla has repeatedly delayed submitting detailed accident data related to its Full Self-Driving (FSD) system to the National Highway Traffic Safety Administration (NHTSA). Originally due by January 19, the deadline was extended twice—first to February 23, then to March 6—due to Tesla’s challenges in compiling the extensive data requested, including CAN bus files, video footage, and event data recorder information. The delays appear to stem from logistical difficulties rather than any intentional obstruction. Second, in Sweden, Tesla Superchargers were physically iced over by individuals opposed to Elon Musk, blocking electric vehicle charging during freezing weather. This act of sabotage coincides with ongoing labor disputes between Tesla and the Swedish union IF Metall, which opposes Tesla’s refusal to sign a collective bargaining agreement. While IF Metall has distanced itself from the vandalism, it continues to criticize Tesla’s stance, and other unions have taken actions such as
energyTeslaelectric-vehiclessuperchargersNHTSAself-driving-technologycharging-infrastructureNew Tesla Cybertruck - CleanTechnica
Tesla has introduced a new version of its Cybertruck, offering an all-wheel-drive (AWD) model priced at $59,990. This version features a range of 325 miles and a towing capacity of 7,500 pounds, although it cannot tow at maximum range simultaneously. When the Cybertruck was first unveiled in 2019, Tesla projected an AWD model price of $49,990 and a rear-wheel-drive (RWD) model at $39,990, but these price points were never realized. Recently, Tesla briefly offered a RWD Cybertruck for around $60,000 but has now shifted focus solely to the AWD version at a similar price. Higher-end trims include a Premium AWD at $79,990 and the "Cyberbeast" at $99,990 following a recent price cut. Despite the price adjustments, it remains uncertain whether the Cybertruck will see a significant increase in popularity, given its unconventional design and niche appeal mostly among Tesla superfans rather than the
energyelectric-vehiclesTesla-Cybertruckelectric-trucksbattery-rangeautomotive-technologysustainable-transportationNew Electric Heat Pumps Chase Fossil Fuels Out Of Boilers
The article discusses the emergence of industrial-scale electric heat pumps as a transformative alternative to traditional fossil fuel-powered steam boilers, which have been widely used since the 19th century in industries such as papermaking and food processing. US startup AtmosZero is at the forefront of this innovation, aiming to replace coal, oil, and gas boilers with more energy-efficient electric heat pump systems. Despite shifts in federal energy policy, AtmosZero has made significant progress, including pilot projects with partners like New Belgium Brewing and collaborations with engineering firms such as Danfoss. In 2024, the company secured a $3.1 million Department of Energy grant to develop commercial and industrial-scale electric heat pumps. In early 2025, AtmosZero opened a new manufacturing campus in Loveland, Colorado, initially planning to produce 100 units of its “Boiler 2.0” heat pump boilers. The startup recently announced a strategic partnership with R.F. MacDonald, a 70-year-old boiler supplier,
energyelectric-heat-pumpsindustrial-heatingdecarbonizationclean-energysustainable-technologyAtmosZeroHow To Use Up Nuclear Waste Generating Electricity - CleanTechnica
The article discusses a nuclear technology concept developed around 1989-1990 under Carlo Rubbia at CERN, aimed at generating electricity from radioactive materials while minimizing nuclear waste and eliminating proliferation risks. This approach, initially called the "Energy Amplifier" and later renamed the "Accelerator Driven System" (ADS), involves a reactor design that uses a particle accelerator to drive protons into a heavy liquid metal (such as lead or mercury) containing dissolved radioactive substances like thorium, unenriched uranium, or nuclear waste. The proton collisions induce spallation, releasing neutrons that trigger nuclear reactions in the radioactive atoms, producing energy and transmuting hazardous isotopes into stable or less harmful elements. A key advantage of the ADS is that it operates without reaching critical mass, enhancing safety, and it significantly reduces the longevity and radioactivity of nuclear waste. For example, radioactive isotopes like strontium-90 are converted through decay chains into stable elements such as zirconium-90, and most
energynuclear-energynuclear-wasteaccelerator-driven-systemenergy-amplifierradioactive-materialsclean-energyWe Shouldn’t Mourn The Bargain-Basement LEAF S - CleanTechnica
The article discusses Nissan’s decision to indefinitely delay the entry-level “S” trim of the 2026 LEAF electric vehicle, a move that initially sparked concern about the loss of affordable EV options. While affordable EVs remain important, the author argues that the market and consumer expectations have evolved significantly since earlier days of EV adoption. In 2026, simply offering a lower price is not enough; EVs must meet higher standards for range and charging speed to be practical for most drivers beyond dense urban areas. Specifically, the LEAF S’s 52 kWh battery and estimated 210-mile range fall short for many real-world scenarios, especially at highway speeds, in adverse weather, or with battery degradation, reducing effective range to around 140-160 miles. Additionally, its charging speed would be capped at about 100 kW, slower than other affordable EVs and the higher LEAF trims, resulting in longer charging stops that could frustrate drivers. The article highlights that the LEAF
energyelectric-vehiclesEV-chargingbattery-technologysustainable-transportationNissan-LEAFclean-energyCERN chills LHC magnets to -456°F in major step toward 10× more data
CERN has initiated the cryogenic cooldown of a 312-foot-long test stand known as the Inner Triplet String (IT String) as part of the High-Luminosity Large Hadron Collider (HiLumi LHC) upgrade. This full-scale replica of the upgraded magnet system will be chilled to 1.9 Kelvin (-456°F), colder than outer space, to validate the performance of the superconducting niobium-tin inner triplet magnets and associated infrastructure. These magnets are critical for tightly focusing proton beams in the collider and represent a significant advancement over the current niobium-titanium magnets. The cooldown process, which will take several weeks, tests the integration of magnets, cryogenics, protection, and power systems ahead of their installation during the upcoming Long Shutdown 3 (LS3), a four-year overhaul scheduled to begin soon. The HiLumi LHC upgrade aims to increase the collider’s luminosity by a factor of 10, enabling researchers to observe
energysuperconducting-magnetscryogenicsparticle-acceleratorhigh-luminosity-LHCniobium-tin-magnetsCERNA Better Use For Warehouses: Rooftop Solar Power
The article highlights the effective use of warehouse rooftops for solar power generation, focusing on Florida-based William C. Huff Companies, which operates what is described as the largest rooftop solar array in Collier County. Since installing a 137-kilowatt solar system on its 20,000-square-foot Naples warehouse in 2015, the company has prevented approximately 1,000 tons of CO2 emissions, generated over 170,000 kWh of clean energy, and saved more than 145,000 gallons of fuel. This initiative demonstrates how warehouses, traditionally used for storage, can contribute significantly to sustainability efforts through solar energy. The article also emphasizes the potential for broader adoption of rooftop solar in the logistics sector, noting that modern 400-watt solar panels are more efficient than the 300-watt panels used by Huff a decade ago. This improvement could enable similar-sized warehouses to save around 150 tons of CO2 annually, surpassing Huff’s current savings of about 100 tons per year
energysolar-powerrooftop-solarrenewable-energywarehouse-energy-efficiencyCO2-reductionclean-energyALEC Pushes Idiotic Anti-Renewable Legislation In Ohio - CleanTechnica
The article from CleanTechnica criticizes the American Legislative Exchange Council (ALEC) for promoting legislation in Ohio that would severely restrict the growth of renewable energy. ALEC, a nonprofit organization that drafts model conservative legislation for state governments, is behind Ohio Senate Bill 294, which seeks to define "reliable energy sources" as power plants capable of operating continuously with a minimum capacity factor of 50%. This definition effectively excludes most renewable energy sources like wind and solar, which have lower capacity factors due to their intermittent nature. The bill is part of a broader push by fossil fuel interest groups to favor natural gas and hinder competing clean energy technologies, with similar legislation being considered in other states such as Utah, Louisiana, and New Hampshire. Capacity factor measures how much energy a power plant actually produces relative to its maximum potential output. While nuclear and combined-cycle natural gas plants exceed the 50% threshold, most renewables fall well below it—wind averages about 34.3%, solar 23.
energyrenewable-energylegislationfossil-fuelspower-gridcapacity-factorOhio-energy-policyWith yet another global EV-focused agreement, Canada is rapidly realizing its new auto strategy - Clean Energy Canada
The article highlights Canada’s accelerating efforts to transform its auto industry through a new strategy focused on electric vehicles (EVs) and critical minerals. A recent bilateral agreement with Germany aims to deepen cooperation in electric and hydrogen-powered vehicle sectors, including supply chains for batteries and critical minerals. This agreement builds on earlier memoranda of understanding and aligns with Prime Minister Mark Carney’s vision of forging partnerships with countries fully committed to the EV transition. Canada’s existing auto manufacturing base, combined with its rich critical mineral resources, positions it uniquely to capture a significant share of the evolving global EV supply chain. Central to Canada’s strategy is fostering a robust domestic market for EVs by reinstating consumer incentives, investing in public charging infrastructure, and implementing stricter tailpipe emission standards akin to those in Europe. The article suggests further integration with European standards, such as adopting European car safety regulations, to facilitate the entry of affordable European EVs into the Canadian market—a move supported by industry stakeholders and referenced in the federal auto strategy
energyelectric-vehiclesclean-energycritical-mineralsauto-industryhydrogen-powered-vehiclesEV-incentivesThe Last Mystery of Antarctica’s ‘Blood Falls’ Has Finally Been Solved
Antarctica’s Blood Falls, a striking crimson outflow in the McMurdo dry valleys discovered in 1911, have long puzzled scientists regarding their unusual color, liquid state at subzero temperatures, and the mechanism behind their periodic eruptions. Recent research has clarified that the red hue results from iron particles oxidizing upon exposure to air, originating from ancient bacteria trapped underground. The liquid is a hypersaline brine formed around two million years ago when the Antarctic Ocean receded, with its high salinity preventing freezing even at nearly –20°C. The latest breakthrough, based on 2018 data combining GPS, thermal sensors, and imagery, revealed that the eruptions are driven by pressure changes beneath the glacier. As Taylor Glacier moves, it compresses subglacial channels, building pressure until the ice fractures, releasing bursts of pressurized brine through crevices. This release also temporarily slows the glacier’s movement, acting as a hydraulic brake. While these findings solve the longstanding mysteries of
materialsenergyAntarcticairon-oxidationhypersaline-brineglacier-pressureenvironmental-scienceToyota Launches New EV Charging Partnership To Juice US Sales
Toyota, historically slow to embrace electric vehicle (EV) adoption in the US, has recently launched a new home EV charging partnership with the American company Treehouse to boost its EV sales. This collaboration focuses on the critical home charging market, where most EV owners prefer to recharge their vehicles. Treehouse differentiates itself by offering a data-driven approach that helps prospective EV buyers estimate the cost and feasibility of home charger installation tailored to their specific homes. The company also partners with financing firms to bundle charger costs into auto loans, making upfront expenses more manageable and potentially lowering monthly charging costs compared to exclusive use of public chargers. Toyota’s partnership with Treehouse complements its strategy of encouraging overnight, managed charging during off-peak utility hours, which aligns with typical customer charging habits and lower electricity rates. All 2026 and newer Toyota and Lexus battery electric vehicles (BEVs) and plug-in hybrid electric vehicles (PHEVs) come standard with a dual-voltage 120V/240V AC home charger cable
energyelectric-vehiclesEV-chargingToyotahome-chargingclean-energysustainable-transportationSpiro Raises $50 Million As Demand For Its Battery Swapping Infrastructure & EVs Surges Across Africa - CleanTechnica
The article highlights the rapid growth of electric motorcycles (e-motorcycles) in Africa, particularly in Kenya, where motorcycles are a vital mode of transport and a major part of the taxi industry. Despite nearly 99% of the continent’s nearly 30 million motorcycles still being internal combustion engine (ICE) models, the shift toward electrification is accelerating, driven mainly by private startups requiring significant capital investment. Kenya exemplifies this trend, with electric motorcycle registrations rising sharply from just 44 in 2017 to 25,277 in 2025, representing 15.3% of new motorcycle registrations that year. This marks a significant jump from 3.6% in 2023 and 7.1% in 2024, indicating that Kenya has surpassed the critical 5% market share tipping point for mass adoption. Spiro, a key player in this market, captured 60% of Kenya’s electric motorcycle sales in 2025 and operates over 400 battery swap stations
energyelectric-vehiclesbattery-swappingelectric-motorcyclesAfricaclean-energytransportation-innovationElectric Buses Were 56% Of EU City Bus Market In 2025 - CleanTechnica
The article from CleanTechnica highlights the rapid growth of electric buses in the European Union's city bus market, noting that in 2025, zero-emission (ZE) buses—comprising battery-electric and fuel cell models—accounted for 60% of new city bus sales, with battery-electric buses making up 56% and fuel cell buses 4%. This marks a significant increase from 2019, when electric buses represented only 12% of the market, demonstrating a swift transition toward electrification in heavy urban transport. The article emphasizes the environmental and health benefits of electric buses, such as reduced carbon emissions, elimination of toxic diesel fumes, quieter operation, and improved comfort and health for drivers and passengers. Transport & Environment projects that if the current growth rate continues, the EU could achieve 100% zero-emission city buses by 2028, well ahead of the 2035 target. Several EU member states have already reached or surpassed 90% zero-emission bus shares
energyelectric-buseszero-emission-vehiclesrenewable-energysustainable-transportationbattery-electricclean-energyUkraine’s startups keep building
Despite the ongoing war following Russia’s full-scale invasion of Ukraine, Ukrainian startups have not only survived but continue to build and grow. Companies like edtech firm Preply maintain significant operations in Kyiv, with a substantial portion of their engineering teams based in Ukraine. Startups across various sectors, including defense technology and mental health, leverage local engineering talent to support both the country’s resilience and its population’s needs. For example, a startup originally founded in the U.S. pivoted to develop Luminify, a tool aiding Ukrainians in coping with wartime trauma, collaborating with military units and clinics to provide mental health support. Kyiv remains the primary startup hub despite frequent missile strikes and power outages, with offices and coworking spaces adapting to harsh conditions by using generators and serving as warm refuges for employees. Western cities like Lviv have also become important centers for displaced tech workers, benefiting from proximity to the Polish border and hosting international tech events such as IT Arena 2025. Venture capital firms
energystartupsUkrainepower-gridgeneratorstechnologyinnovationMeta strikes up to $100B AMD chip deal as it chases ‘personal superintelligence’
Meta has entered a multiyear agreement with AMD to potentially purchase up to $100 billion worth of AMD chips, including the MI540 GPU series and the latest generation of CPUs. This deal is significant enough to drive around six gigawatts of data center power demand. As part of the agreement, AMD issued Meta a performance-based warrant for up to 160 million shares—about 10% of AMD—at $0.01 each, with vesting tied to milestones and AMD’s stock price reaching $600 (currently around $196.60). The partnership reflects Meta’s strategic move to diversify its AI compute infrastructure beyond Nvidia, which has long dominated the AI chip market. Meta CEO Mark Zuckerberg described the collaboration as a key step toward achieving “personal superintelligence,” an AI vision aimed at creating systems that deeply understand and empower individuals in daily life. Meta plans to invest heavily in AI infrastructure over the coming years, including a $10 billion data center project in Indiana designed to support 1
energydata-centersAMD-chipsAI-infrastructureGPUsCPUsMetaChinese Group Chery Accelerates Rollout of New Models In South Africa - CleanTechnica
Chinese automaker Chery Group is significantly expanding its footprint in South Africa’s new vehicle market, where Chinese brands are gaining popularity. Including its sub-brands Jetour, Jaecoo, and Omoda, Chery has risen into the top five for new vehicle sales in the country. The group is preparing to launch its new energy vehicle (NEV) brand, iCAUR, in May 2026 with models V23 and 03T. To ensure a smooth market entry, iCAUR is establishing comprehensive parts supply and aftersales support, including centralized technical assistance and training programs for its national dealer network, addressing common challenges faced by new brands in the region. The iCAUR lineup includes the V27 Range Extender Electric SUV, featuring a 34 kWh battery with 150 km electric range, supplemented by a 1.5L turbo petrol engine for a total range of about 900 km, and dual motors producing 339 kW. The 03T
energyelectric-vehiclesnew-energy-vehiclesbattery-technologyrange-extenderautomotive-industrySouth-AfricaIt’s time to pull the plug on plug-in hybrids
The article critiques plug-in hybrid electric vehicles (PHEVs), arguing that they fail to deliver on their promise of significantly reducing emissions because most drivers do not regularly charge them. Data from the Fraunhofer Institute, analyzing nearly one million PHEVs in Germany, found that less than a third were plugged in occasionally or not at all. Similar trends are evident in the U.S., where automakers promote PHEVs as efficient alternatives by blending gasoline and electricity to improve fleet-wide emissions without fully transitioning to battery-electric vehicles (BEVs). However, real-world usage shows that many PHEV drivers rarely charge their vehicles, with some brands like Porsche averaging less than one full battery charge over two years, undermining the environmental benefits. The article highlights inherent limitations of PHEVs, including their small battery capacities that only allow for short electric-only ranges (typically 20 to 30 miles) and their reliance on fossil fuel platforms that require the gas engine to assist during high power demands or cold weather
energyplug-in-hybridselectric-vehiclesbattery-chargingemissions-reductionautomotive-technologysustainable-transportationNew hybrid engine using 100% renewable fuel boosts mileage by 40%
Horse Powertrain has developed a new hybrid engine concept, the H12, which runs on 100% renewable fuel and can boost vehicle mileage by up to 40%. The renewable fuel, called Nexa-95 and produced by Spanish energy supplier Repsol, is made from organic waste and cooking oils rather than fossil fuels. The H12 engine, evolved from Horse Powertrain’s HR12 three-cylinder engine, features enhancements such as a turbocharger, a new exhaust gas recirculation system, a tweaked gearbox, and a high-energy ignition system, achieving a 44.2% peak brake thermal efficiency and delivering 71 miles per gallon (3.3 km/L). This represents a significant fuel consumption reduction compared to average internal combustion engines. In addition to improved fuel efficiency, the use of Nexa-95 renewable fuel with the H12 engine can reduce emissions by approximately 1.77 tons per vehicle annually compared to fossil fuel-powered cars. Horse Powertrain emphasizes a technology-neutral approach
energyrenewable-fuelhybrid-enginefuel-efficiencyemissions-reductionsustainable-transportationautomotive-technologyRivian Gives EV Drivers Another Good Reason To Love Their Cars
The article highlights a new partnership between electric vehicle (EV) startup Rivian and clean energy software firm EnergyHub, aimed at simplifying EV drivers’ access to money-saving programs offered by local utilities. This collaboration leverages EnergyHub’s expertise in managing distributed energy resources (DERs) through virtual power plants (VPPs), which coordinate devices like EV batteries to optimize electricity use and reduce grid demand peaks. By integrating managed charging programs into Rivian’s software ecosystem, the partnership enables drivers to benefit from lower off-peak electricity rates while supporting a more reliable and affordable power grid. This initiative comes amid a broader trend of increasing EV adoption, supported by improvements in battery technology, vehicle performance, and public charging infrastructure. A recent JD Power survey found that 96% of EV owners would consider purchasing another EV, underscoring strong consumer satisfaction despite the loss of federal tax credits. Rivian’s collaboration with EnergyHub not only enhances the total cost of ownership for EV drivers by lowering charging costs but also
energyelectric-vehiclesEV-chargingvirtual-power-plantsdistributed-energy-resourcesclean-energy-softwareRivianCeiling-mounted charging robot in China rolls on rails to power EVs
China is pioneering an innovative overhead robotic charging system for electric vehicles (EVs) that moves along ceiling-mounted rails in parking garages. This technology enables on-demand charging without the need for drivers to find and occupy dedicated charging spots. Users can request charging via a WeChat mini-program or QR code, prompting the robotic charger to navigate to the vehicle, identify the charging port using cameras and sensors, and automatically connect. By using a single rail to power multiple vehicles, this system significantly reduces infrastructure costs compared to installing individual chargers at every parking space. While it delivers slower Level 2 AC charging rather than fast DC charging, it is well-suited for locations where cars remain parked for extended periods, such as offices and residential complexes. Several Chinese companies, including LiAuto, CGXi, and Wave Charging, are actively developing and commercializing these rail-based robotic chargers, with systems capable of serving multiple parking spaces from a single unit. Ground-based robotic chargers are also gaining traction, with firms like CharGo projecting
robotenergyelectric-vehiclescharging-infrastructureautomationChinaelectric-vehicle-chargingChina installs nuclear reactor vessel at unit 6 of Lufeng plant
China has begun installing the reactor pressure vessel for unit 6 at the Lufeng nuclear power plant in Guangdong province, marking a key milestone in the plant's expansion. Units 5 and 6 will feature the domestically developed Hualong One reactors, a widely deployed third-generation nuclear technology co-developed by China General Nuclear Power Group (CGN) and China National Nuclear Corporation (CNNC). The Lufeng plant initially planned for four CAP1000 reactors—China’s version of the Westinghouse AP1000—but was later expanded to six units, with construction on units 5 and 6 starting in 2022 and expected to complete by 2028-29. The reactor pressure vessel, a critical component housing the reactor core and facilitating coolant flow and control rod movement, is essential for the plant’s safe and stable operation. Each Hualong One reactor has a gross capacity of 1,200 MW, while the CAP1000 units generate 1,160 MW each
energynuclear-powernuclear-reactorHualong-Onereactor-pressure-vesselChina-energyrenewable-energyAustralia buys first nuclear reactor parts for AUKUS submarine program
Australia has made a significant advancement in its nuclear submarine program under the AUKUS security pact by committing AUD 310 million (approximately USD 220 million) to purchase the first British-built nuclear reactor components for its future SSN-AUKUS attack submarines. These initial payments cover long-lead items essential for early work on the propulsion systems of the first two submarines, which will be constructed at the Osborne Naval Shipyard in South Australia later this decade. This move supports supply-chain resilience, job creation in Australian industry, and reflects a broader strategy of deepening industrial cooperation with the United Kingdom, including expanded production capacity at Rolls-Royce’s submarine propulsion facilities. The payment marks a tangible milestone in transitioning from planning to manufacturing and integration of nuclear propulsion systems, complementing Australia’s AUD 3.9 billion investment in the new submarine construction yard at Osborne. The yard is central to fabricating and assembling the SSN-AUKUS vessels, expected to enter service in the early 2040
energynuclear-energysubmarine-propulsionAUKUSdefense-technologynuclear-reactorsAustralia-defenseMechanical Reality Is Catching Up To ICE Pickups - CleanTechnica
The article from CleanTechnica discusses the declining mechanical reliability of modern light-duty internal combustion engine (ICE) pickup trucks, particularly half-ton models, in contrast to older trucks and heavier-duty variants. The author, drawing from personal experience towing travel trailers and involvement in the RV community, highlights a troubling trend: newer half-ton pickups are becoming less durable and more prone to failure despite rising costs. Data shows that trucks likely to reach 250,000 miles are mostly heavy-duty models or hybrids, with popular half-ton trucks like the Ford F-150 and Ram 1500 less likely to endure long-term use compared to older models such as the 2001 Suburban. The Toyota Tundra is an exception, but overall, modern light-duty trucks struggle under daily work and towing demands. This reliability decline is attributed to stringent fuel economy regulations targeting half-ton trucks, which have driven manufacturers to implement complex and fragile engineering solutions on aging engine platforms. Examples include displacement on demand systems that shut down cylinders to
energyelectric-vehiclesclean-energyEV-trucksvehicle-reliabilityautomotive-engineeringsustainable-transportationControlled blast topples 175-foot Cold War nuclear stack at Hanford
A 175-foot concrete exhaust stack at the Hanford nuclear reservation’s K West Reactor in Washington was demolished last week in a controlled blast, marking a significant milestone in the cleanup of this former Cold War plutonium production site. Originally 300 feet tall, the stack had been reduced in height in the 1980s and was used to vent airborne radioactive releases during the reactor’s operation from 1955 to 1970. The demolition was carefully planned and executed by contractors for the U.S. Department of Energy, with monitoring in place to detect any radioactive contamination. The blast was conducted on a Friday to minimize on-site personnel and ensure safety. This demolition is part of the broader effort to decommission the K West Reactor and reduce long-term environmental risks, especially given its proximity—about 900 feet—to the Columbia River. K West is the eighth of nine plutonium production reactors along the river undergoing “cocooning,” a process of sealing reactors for up to 75 years to allow
energynuclear-energyHanford-sitereactor-decommissioningradioactive-cleanupenvironmental-protectioncontrolled-demolitionEU Fleets Law Could Provide Over Half the EV Sales Carmakers Need in 2030 — New Research - CleanTechnica
A new study by Transport & Environment (T&E) highlights that the proposed EU law mandating large companies to electrify their vehicle fleets could supply 57% of the electric vehicle (EV) sales needed by carmakers to meet 2030 EU CO2 targets—if fleet electrification targets are significantly increased. Currently, the European Commission’s proposal sets a 45% EV target for large company fleets, which T&E argues is insufficient and would only secure 37% of the needed EV sales. T&E’s analysis suggests raising this target to 69% and excluding plug-in hybrids (PHEVs) would drive demand for about 2 million new EV sales, benefiting major manufacturers like BMW, Volkswagen, and Volvo. The report criticizes the Commission’s proposal for allowing large companies to lag behind the overall EV market in most member states, undermining the law’s potential as a demand driver. It cites Belgium’s successful tax reforms on company cars, which boosted corporate EV registrations to 54
energyelectric-vehiclesEU-fleets-lawEV-sales-targetscorporate-fleet-electrificationclean-transportationautomotive-industryNew EV List Prices Drop $1,500 in 4 Months in USA - CleanTechnica
A recent analysis by iSeeCars, highlighted by CleanTechnica, reveals that new electric vehicle (EV) list prices in the U.S. have declined by 2.3% over the past four months, dropping from an average of $63,327 in September 2025 to $61,860 in January 2026. In contrast, new gas-powered car prices increased by 2.5% during the same period, rising from $46,290 to $47,427. Notably, Tesla vehicles were excluded from this data. The price drop in EVs is largely attributed to the expiration of the $7,500 U.S. EV tax credit, prompting market adjustments. Lower-cost EVs experienced the most significant price reductions, while several premium models saw price increases, reflecting their targeting of less price-sensitive customers. The analysis also breaks down price changes by model, identifying several mainstream EVs with price cuts exceeding 5%, ranging from $2,000 to $7,
energyelectric-vehiclesEV-pricesautomotive-industryclean-energyelectric-car-marketEV-tax-creditNon-Tesla Used EVs Drop In Price By About $1,000 - CleanTechnica
The article from CleanTechnica reports on the impact of the elimination of the $4,000 federal tax credit for used electric vehicles (EVs) on their prices and market share. According to an analysis by iSeeCars covering 1.7 million used vehicles aged 1 to 5 years from September 2025 to January 2026, non-Tesla used EV prices dropped by about 3.6%, from $24,629 to $23,738. This decline is modest and somewhat mirrors a 2% drop in used gasoline car prices during the same period. In contrast, Tesla used EV prices increased by 4.3%, rising from $30,040 to $31,329, with significant price hikes for the Model S and Model X, which are soon to be discontinued. The Model S rose 8.5% and the Model X 10.3%, while Model 3 and Model Y prices saw smaller increases. The data also show that among
energyelectric-vehiclesused-EV-marketTeslaEV-subsidiesclean-energyautomotive-industryHybrid Electric Ships and the Alcohol Fuel Convergence - CleanTechnica
The article from CleanTechnica examines the evolving role of alcohol fuels—specifically ethanol and biomethanol—in hybrid electric shipping, challenging the conventional framing of a direct ethanol versus methanol competition. Instead, it argues that the future of maritime propulsion lies in hybrid systems combining dual-fuel alcohol generators with batteries. For short sea and inland routes, battery-electric vessels are already proving viable due to manageable distances and the ability to schedule charging or swap containerized batteries. Large ferries and container ships in regions like China are adopting battery-electric propulsion, supported by advances in battery technology and shore power infrastructure. For larger ocean-going vessels, the article envisions a shift to electric propulsion powered by medium-speed four-stroke generator sets running on liquid alcohol fuels, which charge batteries and power electric motors. This setup contrasts with traditional two-stroke engines mechanically linked to propellers, allowing fuel combustion to occur at steady, optimized loads. This reduces the need for alcohol fuels to match heavy fuel oil’s characteristics exactly, focusing
energyhybrid-electric-shipsbiomethanolethanol-fuelbattery-electric-vesselsmarine-propulsionclean-energyA coast-to-coast EV charging network is a ‘project of national interest’ Canadians want to see - Clean Energy Canada
The Canadian federal government recently announced an $84 million investment to install over 8,000 new electric vehicle (EV) chargers nationwide and pledged a National Charging Infrastructure Strategy, reinforcing its commitment to an EV future. However, Clean Energy Canada argues that Canada should adopt a more ambitious, coordinated approach by designating the creation of a coast-to-coast EV charging network as a “project of national interest.” With projections estimating 16 to 25 million EVs on Canadian roads by 2040, tens of thousands of fast chargers will be necessary to support this growth. A national network would not only facilitate EV adoption by addressing range anxiety but also anchor domestic manufacturing investments, create thousands of local jobs in installation and operation, and strengthen the market for Canadian-produced batteries, components, and critical minerals. The article emphasizes that EV adoption and charging infrastructure expansion are interdependent; neither can succeed without the other. To realize this vision, a strategic combination of public funding and private capital mobilization is essential. The federal
energyelectric-vehiclesEV-charging-networkclean-energynational-infrastructuresustainable-transportationbattery-materialsIron catalyst turns plastic waste into vinegar using sunlight
Researchers at the University of Waterloo have developed an innovative solar-powered method to convert plastic waste, including common polymers like PVC, PP, PE, and PET, into acetic acid—the main component of vinegar. This process uses a bio-inspired cascade photocatalysis system featuring isolated iron single atoms embedded in a carbon nitride framework. When exposed to sunlight, the catalyst triggers a sequence of chemical reactions that selectively break down plastics at the molecular level into acetic acid, operating efficiently in water without relying on heat or fossil fuels. This approach is particularly promising for addressing microplastic pollution in aquatic environments and can handle mixed plastic waste streams, a critical factor for practical applications. The catalyst design draws inspiration from natural enzymatic processes, enabling controlled and efficient degradation of plastics into a valuable chemical with broad industrial uses, from food production to chemical manufacturing. The research team, led by PhD student Wei Wei under Professor Yimin Wu, also conducted a techno-economic analysis indicating promising financial and societal benefits. Importantly, the
energysolar-powercatalystplastic-waste-recyclingmaterials-sciencephotocatalysissustainabilityCHARGE Calls On South African Finance Minister To Address EV Duties & Fund Renewable Charging Infrastructure In 2026 Budget - CleanTechnica
Ahead of South Africa’s 2026 Budget Speech, the advocacy group Zero Carbon Charge (CHARGE) urged Finance Minister Enoch Godongwana to reduce import duties on electric vehicles (EVs) to align with those on internal combustion engine (ICE) vehicles and eliminate the ad valorem tax on EVs. Currently, EVs face a 25% customs duty compared to 18% for petrol and diesel vehicles, contributing to high prices and limited affordability. CHARGE highlighted that several African countries, including Ethiopia, Rwanda, and Zambia, have lowered or removed import duties on battery electric vehicles (BEVs) to encourage adoption. Despite some new, more affordable EV models entering the South African market, BEV sales declined 17% year-over-year in 2025, making up only 0.17% of total vehicle sales, underscoring the urgent need for policy reform to boost EV uptake. CHARGE also called for dedicated government funding to develop off-grid, solar-powered EV charging
energyelectric-vehiclesrenewable-energyEV-charging-infrastructureSouth-Africaclean-mobilityimport-dutiesDonut Lab battery hits 80% in 4.5 minutes amid ‘scam’ claims
Finland-based startup Donut Lab has addressed widespread skepticism and industry criticism regarding its claims of a production-ready solid-state battery capable of ultra-fast charging. After accusations of the technology being a “scam,” Donut Lab commissioned independent testing by the VTT Technical Research Centre of Finland. The tests, conducted under extreme conditions without active temperature controls, demonstrated that the battery could reach 80% charge in as little as 4.5 minutes at an 11C charging rate and achieve full capacity in just over seven minutes, retaining nearly all stored energy after discharge. These results support Donut Lab’s earlier claims of rapid charging speeds without the need for active cooling or unusual pressure on the cells. Donut Lab’s battery design emphasizes simplicity and passive cooling, potentially reducing the complexity, weight, and cost of electric vehicle (EV) battery packs compared to traditional lithium-ion cells that require elaborate cooling and structural support. Although the tests focused on single cells and did not assess performance within a complete battery pack,
energybattery-technologysolid-state-batteryrapid-chargingelectric-vehiclesenergy-storagebattery-innovationUS report links higher cancer death rates to communities near nuclear plants
A recent nationwide study led by Harvard T.H. Chan School of Public Health has found that US counties located closer to operational nuclear power plants (NPPs) experienced higher cancer mortality rates between 2000 and 2018. By analyzing data from all US counties and operational NPPs during this period, and adjusting for confounding factors such as income, race, education, lifestyle, and healthcare access, the researchers estimated that approximately 115,000 cancer deaths—about 6,400 annually—may be linked to proximity to these facilities. The increased risk was most pronounced among older adults, and the study employed a “continuous proximity” model to account for cumulative exposure from multiple plants. Despite these findings, the study does not establish a direct causal link, as it relied on geographic distance rather than direct radiation measurements and treated all plants equally regardless of their characteristics. The authors emphasize the need for further research to clarify nuclear power’s health impacts, especially as nuclear energy is increasingly promoted as a clean
energynuclear-powercancer-riskpublic-healthenvironmental-impactradiationclimate-changeChina's neighbor to roll out 7,000-ton nuclear ballistic missile sub
The Indian Navy is set to commission its third nuclear-powered ballistic missile submarine, INS Aridhaman (S4), by mid-2026. This 7,000-ton vessel is the largest in the Arihant-class program and features significant upgrades over its predecessors, INS Arihant and INS Arighaat. Built under the Advanced Technology Vessel program with about 75% indigenous content, INS Aridhaman has a lengthened hull (426 feet) to accommodate a heavier missile payload, including up to 24 short-range K-15 missiles, eight intermediate-range K-4 missiles, and is designed to carry longer-range K-5 missiles capable of striking targets up to 6,000 kilometers away. It also doubles the vertical launch system tubes from earlier models, enhancing its strike capabilities. The submarine is powered by an advanced, quieter 83-megawatt compact light water reactor (CLWR-B1) designed specifically for the Arihant-class, improving stealth through reduced
energynuclear-powersubmarine-technologyballistic-missilesdefense-technologystealth-technologynaval-engineeringThe US Had a Big Battery Boom Last Year
The United States experienced a record-breaking surge in battery storage capacity in 2025, adding 57 gigawatt hours (GWh) to the grid—a nearly 30% increase from the previous year—according to a report by the Solar Energy Industries Association (SEIA). This growth is notable given the political challenges faced by renewable energy under the second Trump administration, which cut tax credits for wind and solar but largely spared battery incentives. The expansion of battery storage is significant enough to power over five million homes annually, and the market is expected to grow another 21% in 2026, adding an additional 70 GWh. This boom contrasts sharply with less than a gigawatt of total storage capacity less than a decade ago. Texas stands out as a key driver of this growth, with its deregulated and independent power grid fostering a competitive market environment that has allowed solar and battery storage to flourish despite federal resistance. Texas solar energy met over 15% of demand during the summer of
energybattery-storagerenewable-energysolar-powerUS-energy-marketclean-energyenergy-storage-growthDonut Lab Meant What They Said About That New EV Battery
Finnish startup Donut Lab unveiled what it claims to be the world’s first solid-state EV battery ready for OEM vehicle manufacturing at CES in January. The battery boasts a rapid five-minute full charge and an energy density of 400 Wh/kg. To address skepticism, Donut Lab is releasing a video series and independent test results from the VTT Technical Research Centre of Finland, demonstrating the battery’s performance and longevity. The battery reportedly endures up to 100,000 charge cycles with minimal capacity loss, operates safely across extreme temperatures (retaining over 99% capacity from –30°C to over 100°C), and avoids fire risks linked to dendrite formation in liquid electrolyte batteries. Additionally, it is made from abundant, affordable, and geopolitically secure materials, promising lower costs than conventional lithium-ion batteries. Donut Lab has partnered with European electric motorcycle maker Verge to showcase the battery in Verge’s TS Pro and Ultra models, which are expected to begin customer deliveries soon. Verge highlights that
energysolid-state-batteryelectric-vehiclesEV-battery-technologybattery-innovationfast-chargingsustainable-materials121 Electric Buses Are Now Running On Clean Renewable Electricity In Senegal - CleanTechnica
Senegal has introduced 121 fully electric buses powered entirely by clean, renewable solar electricity, marking a significant step toward sustainable transportation in the country. These buses replace diesel vehicles, reducing air pollution and cutting approximately 59 million tons of CO2 emissions annually. The shift encourages people to move away from fossil-fuel personal vehicles, addressing climate change, toxic air pollution, and traffic congestion. Additionally, the electric buses improve health conditions for drivers by eliminating toxic diesel fumes and contribute to job creation within Senegal. The use of domestically generated solar power for these buses also strengthens Senegal’s energy independence, reducing reliance on imported refined fuels, particularly from Russia, and supporting the national economy. Beyond transportation, the electric buses’ large batteries offer potential for grid support during outages and can be repurposed for stationary energy storage after their operational life. This initiative demonstrates a scalable model for electrifying public transit in Dakar and potentially across Senegal, aligning with a broader vision of clean renewables, energy storage, and electrified
energyrenewable-energyelectric-busesclean-transportationsolar-powerenergy-storageelectrificationNissan aims to boost EV performance, safety with 'moving battery pack'
Nissan has patented an innovative "active mount" system for electric vehicle (EV) battery packs designed to enhance performance and safety by dynamically shifting the battery's position within the vehicle. Unlike traditional rigid mounting, Nissan’s system uses actuators controlled by a central computer that processes data from various sensors (measuring pitch, yaw, acceleration, weight distribution, and more) to move the battery pack laterally and longitudinally. This real-time adjustment aims to optimize traction, handling, and stability—for example, improving acceleration by shifting weight rearward, reducing understeer during turns, enhancing braking control, and even repositioning the battery to mitigate damage during impacts or rollovers. The technology could initially appear in high-end models, such as a future GT-R, and would provide adaptive responses to driving conditions like towing uphill or high-speed maneuvers. However, challenges remain, including increased system complexity, potential compromises in cabin or battery space, and additional energy consumption due to moving a heavy battery pack. Nissan
energyelectric-vehiclesbattery-technologytraction-controlautomotive-innovationactuatorsvehicle-safetyWaste bread could replace fossil fuels with carbon-negative chemistry
Researchers at the University of Edinburgh have developed a novel, carbon-negative method to power hydrogenation—a key chemical process used in manufacturing pharmaceuticals, plastics, and fuels—by utilizing waste bread as a feedstock. Traditionally, hydrogenation depends on hydrogen gas derived from fossil fuels, requiring metal catalysts and extreme conditions, which results in significant carbon emissions. The new approach employs a common strain of E. coli bacteria that consume sugars extracted from discarded bread to biologically generate hydrogen gas in an oxygen-free environment. This microbially produced hydrogen, combined with a small amount of palladium catalyst, enables hydrogenation reactions at near-room temperature without fossil fuel inputs. This innovative single-flask process not only reduces reliance on carbon-intensive fossil fuels but also addresses waste management issues by diverting bread from methane-emitting landfills. The technique has broad implications for sustainable manufacturing across various industries, including pharmaceuticals and fine chemicals, offering a scalable, greener alternative. The research team aims to further refine the method by eliminating metal catalysts altogether
energysustainable-chemistryhydrogenationcarbon-negativebiohydrogenwaste-to-energygreen-manufacturingThe Important Role That Black Communities Play In Addressing Climate Change - CleanTechnica
The article highlights the critical role Black communities and organizations play in addressing climate change, serving as hubs for climate innovation that provide clean energy, water, affordable green housing, and healthy food. Originating alongside movements like Black Lives Matter, these communities are increasingly recognized for their leadership in climate justice, emphasizing that climate change is both an environmental and human rights issue disproportionately impacting people of color. Black Climate Week, in partnership with the NAACP, showcases thousands of stories of justice-led climate action, underscoring how Black communities create solutions that protect the planet, generate jobs, and improve quality of life. Historically, Black communities have been disproportionately affected by environmental hazards such as toxic waste, polluted air and water, and health impacts linked to climate change, while having fewer resources to respond. The article stresses that climate change exacerbates existing inequalities, as those most responsible for carbon emissions hold the greatest power to address the crisis. Black climate activists employ tactics like protests and boycotts, continuing a legacy of successful
energyclean-energyclimate-changeenvironmental-justiceBlack-communitiesclimate-activismsustainabilityMaritime Decarbonization Without Inflation - CleanTechnica
The article from CleanTechnica addresses concerns about whether increasing carbon prices in Europe, aimed at decarbonizing maritime shipping, will lead to inflation by raising shipping costs significantly. The analysis shows that while carbon pricing does increase fuel costs for shipping operators, the impact on the cost per ton of cargo transported is minimal. For example, even at a high carbon price of €300 per ton of CO2, the added cost for shipping a ton of goods from Shanghai to Rotterdam is around €16.9, which is negligible compared to the value of typical containerized goods. For many manufactured goods, ocean freight constitutes only 1% to 3% of retail prices, so even a substantial increase in freight costs would translate to only a fraction of a percent increase in consumer prices, thus not driving structural inflation. The article further explains that the European Union’s Emissions Trading System (ETS) already covers maritime emissions, with full coverage expected by 2026 for intra-EU voyages and partial coverage for
energymaritime-decarbonizationcarbon-pricingemissions-trading-systemshipping-emissionsfuel-costsclimate-policyChina’s ‘super power bank’ reaches key construction milestone
China’s Lianghekou Dam project has reached a significant construction milestone in developing the world’s largest hybrid pumped hydro storage facility. Excavation of the underground powerhouse, dubbed the “power heart,” located nearly 500 meters beneath the mountain, has been completed, and construction of the downstream reservoir has begun. This facility, situated at an elevation of 3,000 meters on the Western Sichuan plateau, includes two reservoirs and four 300 MW units, combining conventional hydropower with pumped storage to achieve a total capacity of 4.2 GW. Pumped hydro storage works by using excess renewable energy to pump water from a lower to an upper reservoir, storing energy as potential energy. When demand rises, water flows back downhill through turbines to generate electricity, enabling grid balancing and mitigating the intermittency of wind and solar power. Unlike conventional hydropower, pumped storage allows for reusable water cycling, supporting year-round operation. The Lianghekou facility is designed to integrate with 7 GW of renewable energy
energypumped-hydro-storagerenewable-energyenergy-storagelithium-ion-batterieshydropowerChina-energy-projectsJapan: Hitachi reveals 13-ton battery-electric excavator for 24/7 use
Hitachi Construction Machinery NV (HCME) has introduced the ZX135-7EB, a 13-ton battery-electric excavator designed for zero-emission construction work, particularly suited for urban and residential environments where noise and emissions are restricted. This dual-mode excavator operates either on a 198 kWh lithium-ion battery or via a wired grid-assist mode connected to a 400V AC power supply, enabling 24/7 operation with performance comparable to its diesel counterpart, the ZX135-7. The machine also features remote monitoring capabilities and advanced safety systems, including a 270-degree bird’s-eye view camera. This launch reflects Hitachi’s broader commitment to sustainability, expanding its portfolio of eco-friendly construction equipment that includes smaller battery-electric models and hydrogen-powered excavators developed in partnership with Kiesel Technology GmbH. The ZX135-7EB aims to meet growing market demand for zero-emission machinery while reducing maintenance costs and life-cycle expenses. The announcement precedes its showcase at CONEX
energybattery-electric-excavatorzero-emission-construction-equipmentlithium-ion-batterieselectric-drive-systemsustainable-constructionHitachiDonut Lab to release test results after battery claims spark debate
Finnish startup Donut Lab plans to release independent test data supporting its all-solid-state battery technology following widespread skepticism at the 2026 Consumer Electronics Show (CES). The company will publish initial results starting February 23 through a video series on a dedicated website, idonutbelieve.com, aiming to shift the conversation from speculation to verifiable evidence. Donut Lab claims its battery, independently tested by Finland’s VTT Technical Research Centre, offers groundbreaking performance metrics, including an energy density of 400 watt-hours per kilogram—significantly higher than current lithium-ion batteries—and rapid charging under 10 minutes with a lifespan of 100,000 cycles. Despite these bold claims, Donut Lab faced criticism from established battery manufacturers and industry analysts who questioned the lack of live demonstrations, patent disclosures, or peer-reviewed research at CES. The company’s CEO, Marko Lehtimaki, acknowledged the challenges posed by skepticism, especially in securing funding for scaling production. Donut Lab also intends to install
energysolid-state-batterybattery-technologyenergy-storagelithium-ion-alternativeelectric-vehiclesbattery-innovationWorld’s first diesel plug-in hybrid pickup with 7,700-pound towing capacity unveiled
Chinese automaker Chery has unveiled the KP31 dual-cab ute concept, positioning it as the world’s first diesel plug-in hybrid pickup, with a planned production launch in Australia in late 2026. The KP31 features a 2.5-liter turbocharged four-cylinder diesel engine combined with an electric motor, delivering a plug-in hybrid system with 47 percent thermal efficiency. This setup promises 10 percent better fuel economy, 10 percent lighter weight than comparable systems, and a 30 percent reduction in vibration and noise compared to standard diesel engines, addressing common drawbacks of diesel trucks. The Australian market played a significant role in the development, with Chery’s local division advocating strongly for the diesel PHEV configuration to meet the dual demands for diesel power and hybrid efficiency. Designed to compete with established pickups like the Toyota HiLux and Ford Ranger, the KP31 targets a payload of 2,205 pounds and a towing capacity of 7,716 pounds. The ute’s dimensions and
energyhybrid-vehiclesdiesel-plug-in-hybridautomotive-technologyfuel-efficiencypowertrain-innovationelectric-assistanceAll the important news from the ongoing India AI Impact Summit
The ongoing India AI Impact Summit, a four-day event attracting 250,000 visitors, aims to boost AI investment and innovation in India. It features participation from major AI and tech leaders including OpenAI, Anthropic, Nvidia, Microsoft, Google, and prominent Indian figures like Reliance Chairman Mukesh Ambani. Key announcements include India earmarking a significant fund to invest in AI and advanced manufacturing startups nationwide. OpenAI CEO Sam Altman highlighted India as the second-largest user of ChatGPT globally, with a large student base. Several Indian AI startups secured major investments: Blackstone acquired a majority stake in Neysa, which plans to raise $600 million in debt and expand GPU deployment, while Bengaluru-based C2i raised funds for data center power solutions. Anthropic announced its first Indian office in Bengaluru and plans to deploy AI tools in telecommunications, reflecting India’s growing role in the AI ecosystem. Industry perspectives at the summit revealed concerns and opportunities: HCL’s CEO Vineet Nayyar emphasized profitability
energyAI-infrastructuredata-centersadvanced-manufacturingsmart-glassestelecommunicationsIndian-startupsElectric Vehicle Models Top 5 Vehicle Classes in California - CleanTechnica
The article from CleanTechnica highlights the dominance of electric vehicles (EVs) across multiple vehicle classes in California, showcasing their strong sales performance in 2023. Tesla continues to lead, with the Model Y standing out as the top-selling luxury compact SUV and the Model 3 securing second place among all cars, particularly dominating the near-luxury car segment. Beyond Tesla, other EVs have also excelled: the Honda Prologue and Ford Mustang Mach-E topped the 2-row midsize SUV category, while the Rivian R1S led the large luxury SUV class. In the subcompact luxury SUV segment, the Mercedes EQB and Audi Q4 e-tron ranked first and fifth respectively. In more mainstream categories, the Hyundai IONIQ 5 was the best-selling EV in its class, outperforming the electric Chevrolet Equinox, which itself sold more electric units than gas-powered ones. The midsize luxury SUV segment saw the Audi Q6 e-tron and Tesla Model X
energyelectric-vehiclesTeslaEV-salessustainable-transportationautomotive-industryclean-energyTesla Still Dominates California EV Sales — And Tesla Still Massively Supported By California - CleanTechnica
The article highlights Tesla's overwhelming dominance in California's electric vehicle (EV) market in 2025. Tesla sold nearly 180,000 vehicles in the state, far surpassing the second-place Hyundai with just over 25,000 sales. Tesla’s Model Y was the best-selling vehicle overall in California, with more than 110,000 units sold, while the Model 3 ranked fourth with nearly 54,000 sales. Other EVs, like the Hyundai IONIQ 5, barely made the top 10 list, which was otherwise dominated by Tesla and several popular hybrid or non-electric models. Despite a significant decline in Tesla sales compared to previous years, the brand remains the clear leader in California’s EV market. The article also discusses the symbiotic relationship between Tesla and California, emphasizing that Tesla’s success is deeply rooted in California’s supportive policies, economy, and environmentally conscious population. A reader’s commentary is cited, noting that without California’s backing, Tesla might never have succeeded
energyelectric-vehiclesTeslaCaliforniaEV-salessustainable-transportationclean-energyTrump Promises More Coal Jobs, Delivers Trade War Instead
The article examines the contradiction between former President Trump's promises to revive coal jobs and the negative impact of his trade policies, particularly tariffs, on the coal industry. While Trump aimed to boost domestic coal consumption by supporting aging coal power plants, mechanization and productivity improvements have continued to reduce coal employment. More critically, the tariff war initiated under Trump, especially with China, has harmed the export market for metallurgical (met) coal, which is essential for the global steel industry. Since U.S. met coal consumption has been declining for decades, exports—especially to China, the second-largest market after India—are vital. However, retaliatory Chinese tariffs of up to 25% on U.S. met coal caused exports to China to drop nearly 19% in early 2025, undermining U.S. producers and creating market uncertainty. This trade conflict has had particularly severe consequences for coal-dependent regions like West Virginia, the top U.S. met coal producer, accounting for nearly half of national production
energycoal-industrytariffsUS-coal-jobsmetallurgical-coalenergy-policytrade-warFraunhofer Study Finds Some PHEVs Use 3 Times More Fuel Than Claimed - CleanTechnica
A recent study by Fraunhofer ISI and the Öko Institute has revealed that many plug-in hybrid electric vehicles (PHEVs) sold in Europe consume about three times more gasoline in real-world driving than manufacturers claim. Analyzing data from around one million PHEVs, the study found these vehicles average about six liters of fuel per 100 km, significantly higher than official type-approval values. The main reason is that PHEVs frequently switch between electric and combustion engine modes, with the combustion engine activating more often than manufacturers suggest, undermining the expected fuel savings and climate benefits. The study highlights that German-made PHEVs, including high-end models like Porsche, exhibit the highest fuel consumption, with Porsche models consuming up to 7 liters per 100 km. In contrast, more affordable PHEVs from brands like Kia, Toyota, Ford, and Renault showed much lower fuel use, often under one liter per 100 km. The findings raise concerns about regulatory compliance and the
energyplug-in-hybrid-vehiclesfuel-consumptionCO2-emissionsautomotive-industryFraunhofer-Instituteenvironmental-impactSalt deposit older than dinosaurs may shape Australia’s energy future
The article discusses the potential of the Adavale Basin, an ancient and largely unexplored geological formation beneath outback Queensland, Australia, as a massive clean energy storage site. This basin contains the Boree Salt deposit, a thick layer of rock salt suitable for creating underground caverns by dissolving the salt with water. These caverns could store hydrogen gas produced from renewable electricity, addressing a key challenge in Australia’s energy transition: the intermittent nature of solar and wind power. Unlike lithium-ion batteries, which are costly and limited in scale, salt caverns could store energy at a geological scale, enabling storage for days and at volumes sufficient to support millions of homes. Geoscience Australia recently completed a $31 million drilling campaign to explore the basin’s potential, including setting a depth record by drilling three kilometers underground and extracting extensive rock and groundwater samples. The concept of storing hydrogen in salt caverns is well established internationally, with existing large-scale facilities in countries like the United States. A single cavern in the
energyrenewable-energyenergy-storagehydrogen-storagesalt-cavernsclean-energyAustralia-energy-futureRethinking Nature As Economic Climate Capital - And A Really Valuable Investment - CleanTechnica
The article discusses a paradigm shift proposed by Tom Chi in his book *Climate Capital: Investing in the Tools for a Regenerative Future*, advocating for rethinking nature as a form of economic climate capital. Chi argues that aligning economic systems with the natural processes that sustain the biosphere can lead to a resilient, adaptable economy that supports both natural and economic wealth over the long term. He emphasizes the importance of investing in nature-based solutions, such as maintaining dunes and native vegetation to protect coastal areas, and upgrading damaging industries to be compatible with a healthy planet. This approach reframes climate action not as an expensive burden but as a necessary investment to avoid the far greater costs of climate destabilization. Chi highlights that the core climate threat stems from increasing temperature variability, which disrupts ecosystems and organisms. He advocates for becoming net positive across air, water, soil, and biodiversity to enhance the planet’s carrying capacity. Additionally, Chi critiques the role of social media algorithms in undermining climate action by prioritizing engagement over
energyclimate-changesustainabilityregenerative-economyenvironmental-investmentnature-based-solutionsclimate-capitalEngineers give tiny Renault Twizy more torque than Lamborghini Aventador
UK-based DM Performance has significantly upgraded a discontinued Renault Twizy, a small urban electric quadricycle originally producing just 17 horsepower and designed for low-speed city driving. The team replaced the Twizy’s factory motor with the powertrain from the Stark Varg, considered the world’s most powerful electric motocross bike, delivering around 80 horsepower and an extraordinary 692 lb-ft (938 Nm) of torque. This retrofit involved extensive modifications, including removing the original motor cradle, engineering a custom chain-drive system, reinforcing the differential, and swapping the original heavy battery for a lighter, higher-capacity Stark Varg battery pack. The result is a dramatically enhanced Twizy boasting nearly four times its original power and torque exceeding that of a Lamborghini Aventador (which has 509 lb-ft or 690 Nm). Performance tests showed the modified Twizy could beat an Audi S1 Quattro in a 100 mph drag race and perform high-speed donuts around an Aventador, though it cannot match supercars
energyelectric-vehicleselectric-motorbattery-technologytorqueRenault-Twizyelectric-powertrainThe 9,000-pound monster I don’t want to give back
The article recounts the author's experience test-driving General Motors’ new electric Escalade IQ, a massive luxury SUV weighing 9,000 pounds and starting at $130,405. Initially overwhelmed by the vehicle’s enormous size—228.5 inches long and 94.1 inches wide—the author found it difficult to maneuver in everyday settings, such as driving up a driveway or navigating city streets. Despite early reservations about its bulk and impracticality, the author gradually grew fond of the Escalade IQ, especially after experiencing its impressive performance during a severe snowstorm. The vehicle’s commanding presence and capability ultimately won the author over, transforming initial skepticism into admiration. Inside, the Escalade IQ showcases a high-tech, luxurious cabin designed for comfort and digital immersion. It features a massive 55-inch curved 8K LED dashboard screen, individual screens for front and second-row passengers, and amenities such as massage seats, wireless chargers, and stowable tray tables. The interior space is generous, with
energyelectric-vehicleGMEscaladeIQLbattery-technologyautomotive-technologyHelium system fault forces NASA to delay Artemis crewed moon mission
NASA's Artemis II mission, which aims to send humans into lunar orbit as a step toward returning crews to the Moon, has been delayed from its original March 2026 launch date due to a fault in the rocket's helium flow system. This system is critical for maintaining proper fuel tank pressurization and safely purging rocket engines of flammable gases. The issue was detected in the Interim Cryogenic Propulsion Stage (ICPS), the upper stage responsible for propelling the Orion crew module toward the Moon. Without a stable helium flow, the mission risks fuel feed instability and potential rocket failure, posing significant safety concerns for the crew. As a result, NASA plans to roll the rocket back to the Vehicle Assembly Building (VAB) at Kennedy Space Center for detailed inspection and repairs, which will likely push the launch to April 2026 at the earliest. The repair process involves partially disassembling components such as filters, valves, and connection plates to identify and resolve the problem. This delay adds
energyNASAArtemis-IIhelium-systemrocket-launchspace-missionpropulsion-systemTesla Sales Declined 11.4% in California in 2025 - CleanTechnica
Tesla experienced an 11.4% decline in sales in California in 2025, dropping from 202,865 units in 2024 to 179,656 units. This decline was notable as most automakers did not see sales decreases that year, with only Volvo and Dodge having worse declines. Despite the drop, Tesla maintained a strong market presence in California, capturing a 9.9% share of the state's auto market, significantly higher than its 3.7% share nationally. In the fourth quarter of 2025, Tesla's sales in California showed a slight increase of 2.1% compared to the same period in 2024, which could indicate a potential rebound or merely a short-term fluctuation. Overall, California's total vehicle registrations rose by 3.3% from 2024 to 2025, but electric vehicle (EV) sales slightly decreased from 385,513 to 378,216, reducing EV market share from 22.0
energyelectric-vehiclesTeslaautomotive-marketclean-energyEV-salesCalifornia-energy-policyTrump Fails To Stop Coal Job Bloodbath
The article "Trump Fails To Stop Coal Job Bloodbath" examines the decline of the US coal industry and coal mining jobs during Donald Trump’s presidency. Despite Trump’s repeated promises since 2015 to revive coal jobs and end what he called a "war on American Energy," coal employment and capacity continued to shrink throughout his terms. While Trump touted the rise of oil and natural gas production, coal was largely sidelined, with significant coal plant retirements occurring under his watch. Data from Carbon Brief highlights that coal capacity declined by about 57 gigawatts during Trump’s presidency, a larger annual proportional loss than under recent predecessors, despite a temporary 13% increase in coal power output in 2025 due to higher electricity demand. The article also notes that increases in coal power generation do not necessarily translate into more coal mining jobs, as mechanization and market conditions have long reduced employment in the sector. Between 2011 and 2021, coal mining jobs in the US fell by
energycoal-industrycoal-jobspower-generationfossil-fuelsUS-energy-policycoal-power-plantsGrey, Blue, or Green: The Real Ammonia Math - CleanTechnica
The article discusses the cancellation of Equinor’s H2M blue hydrogen project in the Netherlands, emphasizing that the primary reason was the lack of committed industrial customers rather than technical or public support issues. Despite securing EU Innovation Fund backing, having a clear technical plan, and access to CO2 storage infrastructure via the Northern Lights project, the initiative failed to attract long-term offtake agreements for blue hydrogen. The proposed facility aimed to produce about 210,000 to 220,000 tons of hydrogen annually by the early 2030s, which would have accounted for roughly 18% to 27% of the Netherlands’ current hydrogen demand and a small fraction of EU and global demand. The project’s design involved producing natural gas offshore Norway, transporting it to the Netherlands for hydrogen production via autothermal or steam methane reforming, capturing the resulting CO2, and shipping it back to Norway for underground storage. This complex supply chain required multiple transport and compression steps and depended heavily on industrial customers willing
energyhydrogendecarbonizationEU-Innovation-FundCO2-storageindustrial-hydrogen-demandgreen-hydrogenHegseth’s Blacklists Target Academia & Cleantech, Not National Security Threats - CleanTechnica
The article discusses controversial blacklists reportedly issued by the US Military, which target elite academic institutions and Chinese clean technology companies rather than genuine national security threats. These blacklists, which were posted, retracted, and leaked multiple times, appear to be less about protecting national security and more about undermining top US universities and the emerging private sector in China. The universities targeted include many Ivy League and top engineering schools, which are critical for educating future military and economic leaders. Revoking tuition assistance for service members attending these schools could exacerbate existing education and engineering talent gaps, posing a risk to US economic and military competitiveness. On the corporate side, the expanded list of "Chinese Military Companies" includes major private-sector clean technology firms like BYD, NIO, and leading battery producers such as CATL and CALB, none of which are state-run or primarily military-focused. Notably absent from the list are large state-owned automakers and companies with clearer military ties, suggesting the blacklist targets China’s private
energycleantechclean-technologyUS-militaryacademiaengineering-schoolsnational-securitySam Altman would like remind you that humans use a lot of energy, too
OpenAI CEO Sam Altman addressed widespread concerns about AI’s environmental impact, particularly focusing on energy and water usage. He dismissed claims about AI’s water consumption—such as the notion that a single ChatGPT query uses 17 gallons of water—as “totally fake” and based on outdated data from when data centers used evaporative cooling. Altman acknowledged that while total energy consumption by AI systems is a valid concern due to the growing scale of AI use, per-query energy use is often misrepresented. He emphasized the need for a global shift toward sustainable energy sources like nuclear, wind, and solar to support AI’s energy demands. Altman also criticized comparisons that highlight the energy required to train AI models relative to the cost of a single AI query, calling such discussions “unfair.” He argued that training humans also consumes significant energy and time—about 20 years of life and resources—before they become knowledgeable. From his perspective, a more appropriate comparison is the energy used by AI to answer
energyAI-energy-consumptiondata-centersrenewable-energynuclear-energywind-powersolar-energyPeak Fuel Cell Bus Deliveries in the EU Occurred in 2025 - CleanTechnica
The article from CleanTechnica analyzes the latest European city bus market report by Transport & Environment (T&E), highlighting that battery-electric buses have rapidly become the dominant choice for new city bus registrations across the EU, far ahead of initial expectations. Despite this clear trend, hydrogen fuel cell buses still appear in the data, notably with Germany maintaining around a 9% share in 2024 and 2025, and the EU overall at about 4%. This persistence of hydrogen buses is explained by factors such as procurement delays, backlog clearance, and the impact of large markets like Germany, rather than a renewed shift toward hydrogen technology. The article emphasizes the importance of understanding the data context, particularly the difference between percentages and absolute numbers. For example, small countries like Slovenia can show high hydrogen bus percentages due to low total bus volumes, which can distort perceptions of market trends. The Netherlands serves as a clearer case study: it initially had a significant hydrogen bus share (up to 20%) but shifted decis
energyfuel-cellshydrogen-buseszero-emission-vehiclesEU-transportationclean-energysustainable-transportHybrid powertrain concept for renewable gasoline targets 40% less fuel use
Horse Powertrain, a joint venture formed in 2024 by Geely, Renault Group, and Aramco, has unveiled a hybrid powertrain concept designed to run on 100% renewable gasoline, aiming to extend the viability of combustion engines in a lower-carbon future. The company plans to present its first demonstrator vehicle by early 2026, signaling a rapid progression from concept to on-road testing. This hybrid system builds on the H12 engine concept developed with Repsol, achieving a peak brake thermal efficiency of 44.2%, which is among the highest for production-oriented hybrid combustion engines. Under WLTP testing, the system delivers about 71 miles per gallon, representing a 40% fuel efficiency improvement over the 2023 European average for new passenger vehicles. The H12 concept incorporates advanced features such as a 17:1 compression ratio, optimized exhaust gas recirculation, turbocharging, and transmission calibration specifically tailored for hybrid operation. These enhancements improve combustion efficiency and energy
energyhybrid-powertrainrenewable-gasolinecombustion-technologyfuel-efficiencyautomotive-innovationcarbon-emissions-reduction1854 Motors Picks Up The Electric Pickup Torch Dropped By Tesla
The article discusses 1854 Motors, a Massachusetts-based EV startup aiming to fill the electric pickup truck market gap left by Tesla’s Cybertruck, which failed to meet expectations for ethics-oriented consumers. Unlike Tesla, 1854 Motors focuses on ethical consumerism and environmental justice by utilizing sodium-ion (Na-ion) battery technology instead of the conventional lithium-ion batteries. Sodium-ion batteries offer several advantages, including enhanced safety, elimination of cobalt and lithium extraction (thereby avoiding associated human rights abuses), better cold-weather performance, longer battery lifespan (over 10,000 cycles), and lower production costs, potentially increasing vehicle gross profit by around $10,800 compared to lithium-ion competitors. 1854 Motors targets a niche of “Cultural Architects” who prioritize authenticity and ethical supply chains over corporate marketing hype, appealing to consumers disillusioned with Tesla’s ethical concerns. Their upcoming electric pickup, the “Pierce,” is intended as a proof-of-concept vehicle to validate sodium-ion battery technology at scale,
energyelectric-vehiclessodium-ion-batteriesEV-startupssustainable-transportationbattery-technologyelectric-pickup-trucksPhotos: Senna’s legendary race-winning Lotus F1 car with 12,500-rpm engine up for grabs
The Lotus 98T, driven by Ayrton Senna during the 1986 Formula One season, is widely regarded as one of the most iconic and technically advanced cars of its era. Constructed with a one-piece integral unified moulding chassis designed by Gérard Ducarouge, it combined carbon fiber and aluminum composites to create a smaller, lighter, and lower tub than its predecessor. Powered by the Renault EF15bis V-6 engine featuring a pioneering pneumatic valvetrain system, the car could reach 12,500 rpm and produce 900 brake-horsepower in race trim. This engine technology, along with an electronic engine management system and onboard computer, allowed precise fuel consumption monitoring under the strict 195-liter fuel limit imposed in 1986. The 98T’s qualifying setup pushed the car to extreme performance levels, using a special engine variant with water injection and no waste gates to maximize turbo boost, generating power outputs beyond the measurement capabilities of the time. This intense boost
materialsenergyautomotive-engineeringcomposite-materialsengine-technologyfuel-managementturbochargingChina's organic lithium EV battery aces -94°F to 176°F temperature test
Researchers from Tianjin University and South China University of Technology have developed a practical organic lithium battery prototype using a newly designed n-type conducting polymer, poly(benzodifurandione) (PBFDO), as the cathode. This organic cathode material offers advantages over traditional cobalt- and nickel-based lithium-ion batteries due to its abundance, structural flexibility, and tunable electrochemical properties. The prototype cells demonstrated robust mechanical integrity under bending, stretching, and compression, passed rigorous safety tests including needle puncture without failure or uncontrolled energy release, and showed potential for flexible electronics and wearable applications. The 2.5 amp-hour pouch cells built with PBFDO achieved an energy density exceeding 250 watt-hours per kilogram and operated effectively across a wide temperature range from approximately -94°F to 176°F. They also exhibited a high areal capacity (~42 mAh/cm²) and mass loading (up to 206 mg/cm²), placing their performance close to that of conventional lithium-ion batteries
energylithium-ion-batteriesorganic-materialsbattery-technologyconductive-polymersflexible-electronicssustainable-energyFrom Courtroom to Capital Markets: Why US Tariff Instability Matters - CleanTechnica
The article discusses the implications of the U.S. Supreme Court’s recent decision limiting presidential authority to impose broad tariffs under a specific emergency statute. While this ruling might seem to reduce tariff-related uncertainty, it has instead introduced new layers of risk and volatility in capital markets. The administration’s immediate response to continue tariffs under alternative legal authorities, combined with a refusal to refund previously collected tariffs, creates substitution and retroactivity risks. These risks complicate market pricing, affecting procurement contracts, lender conditions, and investor expectations, particularly in capital-intensive sectors like clean technology. Clean energy infrastructure—comprising steel, copper, lithium, transformers, and other long-lead components—is highly sensitive to tariff volatility because of its reliance on large upfront investments and long asset lifetimes. Increased uncertainty in trade policy raises the weighted average cost of capital (WACC), which in turn increases the levelized cost of energy (LCOE). Even small increases in WACC can make marginal clean energy projects economically unviable, slowing deployment
energyclean-energytariffscapital-marketssupply-chainclean-technologyinfrastructureHow Can IAA Bring Local Cleantech Manufacturing? - CleanTechnica
The article from CleanTechnica discusses the critical role of local content criteria within the EU’s Industrial Accelerator Act (IAA) as the primary mechanism to foster a resilient and locally based cleantech manufacturing industry, particularly in battery production. Given the strategic importance of batteries for Europe’s economic and military security, and the lack of significant EU Commission action on battery production support or trade defense, the article argues that conditioning public funding (such as EV subsidies) on meeting "Made in EU" requirements is essential. This approach is intended to create a viable business case for European battery manufacturers like ACC, Powerco, and Verkor, encouraging private investment and ensuring the survival of homegrown industry players. The article emphasizes that these local content rules do not restrict market access but serve as incentives for public support, with a gradual tightening of criteria from broader "friendshoring" to an EU-EEA focused framework. The article also addresses concerns about cost impacts, noting that while EU-made batteries might increase EV prices modest
energycleantechbattery-manufacturinglocal-content-criteriaEuropean-Unionindustrial-strategyelectric-vehiclesPast the Inflection Point: Electric Now Clearly Dominates the City Bus Market - CleanTechnica
The article from CleanTechnica highlights a significant milestone in the electrification of city buses across the European Union. In 2025, zero-emission (ZE) buses accounted for 60% of new city bus sales in the EU, with battery-electric buses making up 56% and fuel cell buses 4%. This marks a dramatic increase from just 12% in 2019, demonstrating that heavy vehicles can transition to electric powertrains rapidly. If the current growth rate continues, the EU could achieve 100% ZE city buses by 2028, well ahead of the 2035 target. This progress has been driven initially by frontrunner cities and countries, but future growth will depend on lagging markets catching up, supported by upcoming CO2 standards targeting manufacturers. The article also details the leading countries in ZE bus adoption. Five EU member states—Bulgaria, Denmark, Estonia, Latvia, and Slovenia—achieved 100% ZE city bus sales in 202
energyelectric-buseszero-emission-vehiclesbattery-electricfuel-cellEU-transportationclean-energySpace Solar Power Will Inevitably Trump Trump's Energy Policy
The article critiques former President Donald Trump’s fossil-fuel–friendly energy policy, highlighting its reliance on a narrow definition of “reliable” power as steady, base-load electricity primarily provided by fossil fuels. While Trump’s policy excludes intermittent renewables like wind and solar, it does include other renewable sources such as biomass, geothermal, hydropower, marine energy, and nuclear power, which are gradually reducing fossil fuels’ share in the US energy mix. However, the article argues that an emerging technology—space-based solar power (SBSP)—is poised to disrupt this framework by providing continuous, 24/7 solar energy harvested in space and beamed wirelessly to Earth, fully meeting the reliability standard Trump emphasized. Space solar power, once a futuristic concept first proposed by Isaac Asimov in 1941, has gained momentum due to technological advances such as cheaper rocket launches and lightweight solar cells. Since 2011, research programs like CalTech’s and private startups including Overview Energy and Hel
energysolar-powerspace-solar-powerrenewable-energyclean-energyenergy-policyspace-based-solar-powerTaxing Fossil Fuel Profits - CleanTechnica
The article from CleanTechnica discusses the significant profits fossil fuel companies have made in the EU amid ongoing high energy prices and heavy dependence on fossil fuel imports, which accounted for about 70% of the EU’s energy consumption. In 2022, fossil fuel company profits exceeded €104 billion, a 45% increase from the previous year, and remained substantial at over €82 billion in 2023 despite a decline. The article highlights a new study commissioned by cE and CAN Europe, which argues that taxing these profits can be a fair and effective tool to finance Europe’s energy transition, protect consumers and workers, and reduce reliance on fossil fuels. The study emphasizes that fossil fuel companies benefit from declining corporate income tax (CIT) rates and generous exemptions, allowing high profitability with relatively low tax burdens. Unlike carbon pricing mechanisms, company profits have largely escaped targeted environmental taxation, with the 2022 EU solidarity contribution on windfall profits being a rare exception. Taxing fossil fuel profits is considered
energyfossil-fuelsenergy-transitiontaxationEU-energy-policyclean-energycarbon-pricingLocked Out of Green Finance: What’s Holding Truckmakers Back? - CleanTechnica
The article "Locked Out of Green Finance: What’s Holding Truckmakers Back?" from CleanTechnica examines why European truck manufacturers, despite pledging a zero-emission future, have yet to secure significant green finance to support their transition to electric vehicles (EVs). While Chinese competitors rapidly scale up electric truck production, European makers lag behind, partly because they rely heavily on conventional financing methods like bank loans and standard bonds that lack climate-related conditions. Green bonds, which could theoretically support sustainable investments, remain unattractive due to strict earmarking, additional reporting requirements, and no guaranteed financial benefits such as a "greenium"—a consistent lower borrowing cost for green debt. Regulatory uncertainty around EU truck CO₂ standards and alignment with EU Taxonomy criteria further dampens investor confidence, limiting demand for green financial instruments in the sector. The article recommends several measures to overcome these barriers. Truck manufacturers should initiate pilot green finance projects to increase EV-related capital expenditure and improve transparency, especially regarding Scope 3 emissions and
energyelectric-vehiclesgreen-financebattery-electric-truckssustainable-transportationEU-regulationsclean-technologyElectricity generated from compression using flexible nylon-film device
Researchers at RMIT University have developed a flexible nylon-film device capable of generating electricity from mechanical compression, marking a significant advancement in energy-harvesting materials. Unlike traditional piezoelectric materials such as quartz and ceramics, this innovation uses nylon-11, a durable industrial plastic whose molecular structure is aligned through a process involving high-frequency sound vibrations and an applied electric field during solidification. This alignment enables the nylon device to produce electricity each time it is bent, squeezed, or tapped, and it remains highly resilient, even after being run over by a car multiple times. This breakthrough addresses a major limitation of previous energy-harvesting plastics, which were often too fragile for practical use, and offers a scalable, energy-efficient method to create durable, flexible power sources. The technology holds promise for powering next-generation wearable electronics, sensors, smart surfaces, and traffic-management systems, potentially reducing carbon emissions by harnessing ambient mechanical energy. The research team envisions broad industrial applications, including flexible electronics and sports equipment,
energymaterialspiezoelectricityflexible-electronicsenergy-harvestingnylonself-powered-sensorsSierra Club Statement on Trump Administration Opening Millions of Acres of Protected Public Lands to Mining - CleanTechnica
The Trump Administration, through Interior Secretary Doug Burgum, announced the rescission of two longstanding land withdrawals in Alaska, opening over two million acres of protected public lands north of the Yukon River to mining and drilling. These protections, established in the 1970s, were removed to transfer more control to the Alaska state government, which supports expanded industrial energy development. This move aligns with the administration’s broader agenda to promote resource extraction in Alaska, including projects like Alaska LNG and the Ambler road. In response, the Sierra Club strongly condemned the decision, emphasizing that it prioritizes corporate interests over the environment, local communities, Tribes, and wildlife dependent on these lands. Dan Ritzman, the Sierra Club’s Director of Conservation, warned that such actions threaten Alaska’s remaining wild places and could cause irreversible environmental damage. The Sierra Club, as a leading grassroots environmental organization, continues to advocate for the protection of public lands, clean energy, and wildlife through activism, education, and legal efforts.
energyminingpublic-landsdrillingenvironmental-policyAlaskaindustrial-developmentAdvocates Call on California Attorney General, LA District Attorney to Investigate AI Astroturf Campaign - CleanTechnica
Environmental and public health advocates in California are urging Attorney General Rob Bonta and Los Angeles District Attorney Nathan Hochman to investigate an AI-driven astroturf campaign that submitted fraudulent public comments opposing Southern California clean air standards. The campaign, reportedly orchestrated using CiviClick, an AI-powered advocacy platform, generated opposition comments falsely attributed to residents without their consent. This manipulation was uncovered when South Coast Air Quality Management District (SCAQMD) staff verified comments and found several individuals denied submitting them. The incident is part of a broader national trend where AI is used to undermine public participation, particularly in fights over gas infrastructure. The campaign was linked to Matt Klink, a public affairs consultant at California Strategies, a prominent lobbying firm whose clients include Sempra, the parent company of Southern California Gas Company, a key opponent of the clean air standards. Advocates highlight that the defeated standards would have significantly reduced pollution, preventing thousands of premature deaths and asthma cases annually. They emphasize the urgent need for a
energyartificial-intelligenceclean-air-standardsenvironmental-advocacypublic-healthAI-powered-campaignsfossil-fuel-industryDonald Trump Tears Down Another Key Public Health Safeguard - CleanTechnica
The article reports that the Environmental Protection Agency (EPA) under Donald Trump has rolled back key mercury emission standards for coal-fired power plants, reversing improvements made in 2024 and reinstating the less stringent 2012 regulations. This rollback would allow the nation’s dirtiest coal plants to release up to three times more mercury, a toxic pollutant linked to serious health issues such as heart attacks, asthma, premature deaths, and neurological damage in infants. The change is scheduled to take effect in May 2025. The Sierra Club strongly condemns this decision, describing it as a direct attack on public health that prioritizes the coal industry’s profits over community safety. Laurie Williams, Director of the Sierra Club’s Beyond Coal Campaign, emphasized that these protections have historically saved millions of Americans from preventable illnesses and that weakening them will harm families nationwide. The Sierra Club vows to vigorously oppose the rollback through activism, education, lobbying, and legal action. The organization is a major environmental advocacy group focused on
energycoal-industrymercury-emissionsenvironmental-policyrenewable-energypublic-healthpollution-controlNew superconductor could cut energy use in quantum computers
Scientists at the Norwegian University of Science and Technology (NTNU), led by Professor Jacob Linder, have reported evidence that the niobium–rhenium alloy NbRe may exhibit triplet superconductivity—a rare and highly sought-after form of superconductivity. Unlike conventional singlet superconductors, which carry electrical current without resistance but do not transport spin, triplet superconductors enable lossless transport of spin currents. This property is crucial for advancing spintronics and quantum computing, as spin can be used to encode and transmit information more efficiently, potentially improving the stability and energy efficiency of quantum computers. The research team collaborated with experimental physicists in Italy to test NbRe and found that its behavior differs from that of conventional superconductors, consistent with triplet superconductivity. However, Linder emphasized that further verification by independent groups and additional testing are necessary before confirming these findings. Triplet superconductors are also linked to Majorana particles, which hold promise for creating more stable quantum bits less susceptible to environmental
energymaterialsquantum-computingsuperconductorsspintronicsNbRe-alloyquantum-technology'World's most powerful' subsea trencher undergoing final preparations
The NKT T3600, described as the world’s most powerful subsea trencher, has arrived at the UK’s Port of Blyth for final fit-out and commissioning. Designed and built by UK-based Osbit, this massive machine is capable of burying high-voltage power cables up to 5.5 meters (18 feet) below the seabed, utilizing both jetting and cutting functions to operate effectively in various soil conditions. The trencher delivers 3,600 horsepower and is intended to support the growing demand for renewable energy infrastructure by protecting critical offshore power cable networks. NKT announced the investment in the T3600 in June 2025 and shortly thereafter entered a four-year agreement with Helix Robotics Solutions Group for the trencher’s installation, offshore operations, maintenance, and project engineering. Helix will also deploy the trencher using its own support vessel. Scheduled to be commercially operational by 2027, the T3600 aims to enhance cable protection amid increasing risks such
energysubsea-trencherpower-cablesrenewable-energyoffshore-energycable-protectionhigh-voltage-cables'World's most powerful' subsea trencher undergoing final preparations
The NKT T3600, described as the world’s most powerful subsea trencher, is undergoing final preparations at the UK’s Port of Blyth before becoming operational in 2027. Designed and built by UK-based Osbit, this massive machine delivers 3,600 horsepower and can bury high-voltage power cables up to 5.5 meters (18 feet) below the seabed. It uses both jetting and cutting functions to operate effectively in various soil conditions, addressing the growing demand for robust cable protection in renewable energy infrastructure. NKT, the Danish power cable manufacturer and installer, invested in the T3600 to enhance the offshore power cable ecosystem and improve energy supply security amid increased risks such as sabotage and high maritime activity. The trencher’s deployment and maintenance will be managed by Helix Robotics Solutions Group under a four-year agreement, utilizing Helix’s support vessel. Beyond its technical capabilities, the project supports the local UK economy by involving domestic firms in the trencher’s
energysubsea-trencherpower-cablesrenewable-energyoffshore-technologycable-protectionhigh-voltage-cablesThe Supreme Court Strikes Down Trump’s Tariffs - CleanTechnica
The U.S. Supreme Court has ruled that former President Trump’s imposition of tariffs under the International Emergency Economic Powers Act (IEEPA) was unlawful, significantly limiting presidential authority to unilaterally impose tariffs without congressional approval. This decision potentially opens the door for thousands of lawsuits seeking refunds and compensation for the estimated $175 billion in tariffs imposed during Trump’s administration. The ruling emphasizes that the power to tax and impose tariffs constitutionally rests with Congress, not the president, reinforcing the separation of powers and providing greater predictability for American businesses and consumers. The ruling was widely praised by industry leaders such as the Consumer Technology Association (CTA), which highlighted the importance of this decision for innovation and economic stability. However, the ruling does not completely end the possibility of tariffs, as the Trump administration has indicated intentions to explore other emergency authorities, though these have limitations and require congressional approval. The conservative Cato Institute welcomed the decision as a victory for constitutional governance but cautioned that the president still retains other statutory
energyclean-technologytariffstrade-policySupreme-Courteconomic-impactinnovationIn Search Of America - CleanTechnica
The article "In Search Of America" from CleanTechnica reflects on the current state of the United States, contrasting it with its historical ideals and critiquing its contemporary political and economic actions. It highlights the US government's aggressive stance on oil, exemplified by its punitive blockade on Cuba, which has contributed to the island nation's prolonged economic hardship despite its natural beauty and potential as a tourist destination. The author questions the motivations behind such policies, suggesting they stem from historical grievances tied to lost wealth and influence rather than genuine national interest or humanitarian concern. The piece also touches on a cultural moment, referencing a Simon and Garfunkel tribute concert where the song "America" evokes a sense of loss and searching for the country's true identity amid political turmoil and perceived authoritarianism. Historian Heather Cox Richardson is cited to remind readers of the foundational American ideals expressed in the Declaration of Independence—life, liberty, and the pursuit of happiness—which were not fully realized in the Constitution due to compromises with slavery and property rights
energyrenewable-energyoilenergy-policyenergy-blockadeenergy-importsenergy-crisisOnePlanet CEO André Pujadas on building solar recycling infrastructure in the US
André Pujadas, CEO and co-founder of OnePlanet Solar Recycling, highlights a critical gap in the US solar industry: while solar panel deployment has rapidly expanded, the infrastructure for recycling end-of-life solar panels has lagged behind. Drawing on his extensive engineering and industrial experience in steelmaking—particularly the electric arc furnace (EAF) process that revolutionized domestic steel production through scrap metal recycling—Pujadas views solar waste not as mere disposal but as valuable feedstock. He argues that establishing solar recycling infrastructure is not just an environmental necessity but a significant industrial arbitrage opportunity that can drive a new manufacturing ecosystem in the US. Pujadas emphasizes that recycling at industrial scale should be treated as manufacturing rather than waste management. He notes two common misconceptions: first, that recycling is simply cleaner waste handling, and second, that it is inherently profitable due to environmental benefits. Successful recycling requires a consistent supply of feedstock, efficient processing technology, and a market willing to pay for recovered materials.
energysolar-energyrecycling-infrastructurematerials-recoverysustainable-manufacturingclean-energysolar-panel-recycling$100 Million In Funding Announced For New Public EV Chargers In Pennsylvania - CleanTechnica
Pennsylvania has announced $100 million in new funding to expand public electric vehicle (EV) charging infrastructure, aiming to reduce "range anxiety" and support EV drivers across the state. While previous efforts focused primarily on urban areas with higher EV ownership, this initiative emphasizes installing chargers in smaller communities and rural regions to better serve local residents and travelers passing through. The initial phase will allocate approximately $34 million to the southeastern region, including Bucks, Chester, Delaware, Montgomery, and Philadelphia counties, with local transportation agencies determining specific project locations. PennDOT Secretary Mike Carroll highlighted the program as a significant step toward making EV charging accessible statewide, reflecting the Shapiro Administration’s commitment to clean transportation infrastructure. Despite some federal political opposition to EV incentives and renewable energy, thousands of public EV chargers have been or are planned to be installed nationwide. Although federal EV purchase incentives are currently unavailable, some states continue to offer them, and future federal support for EVs and clean energy may increase depending on political changes.
energyelectric-vehiclesEV-charging-infrastructurepublic-charging-stationsrenewable-energyclean-technologyPennsylvania-energy-fundingUS deploys 'world's first' irradiated molten salt reactor research tool
The National Reactor Innovation Center (NRIC) has launched the Molten Salt Thermophysical Examination Capability (MSTEC), a pioneering research facility designed to support the development and commercialization of next-generation molten salt reactors (MSRs). Scheduled to begin full operations in March 2026, MSTEC addresses a critical need for precise data on fuel salt performance—an essential factor for designing, licensing, and operating advanced reactors. The facility features a shielded argon glovebox capable of handling both irradiated and nonirradiated actinide materials, focusing on high-temperature fluoride and chloride salts used as fuel and coolant in MSRs. MSTEC is equipped with a suite of precision instruments adapted for remote operation to safely analyze hazardous samples. These include devices for measuring viscosity, density, thermal properties, and corrosion behavior at temperatures up to 1,650°C. Located at Idaho National Laboratory, MSTEC benefits from proximity to complementary infrastructure such as the Advanced Test Reactor and Analytical Research Laboratories, enhancing its capabilities
energymolten-salt-reactornuclear-energyadvanced-materialsreactor-technologyhigh-temperature-fluidsenergy-researchThe growing war over Seedance 2.0’s 'digital heist'
The recent launch of ByteDance’s Seedance 2.0, an AI model capable of generating synchronized cinematic sequences with native audio, has sparked significant controversy across legal, regulatory, and environmental domains. Major Hollywood studios, led by Disney and Paramount, have issued cease-and-desist orders accusing ByteDance of using pirated copyrighted material to train the model, particularly highlighting its replication of iconic characters from franchises like Marvel and Star Wars. In response, ByteDance temporarily disabled features that clone real human voices. This dispute emerges amid accelerating global regulatory efforts, including the European Union’s upcoming strict enforcement of the AI Act and the U.S. “NO FAKES” Act, which aims to protect individuals’ digital likeness rights for decades after death. India has also introduced stringent rules mandating the rapid removal of unlawful synthetic media within three hours, reflecting a growing international consensus on the need for swift AI content moderation. Beyond intellectual property and regulatory challenges, Seedance 2.0’s operation raises serious environmental concerns
energyartificial-intelligencedata-centersenvironmental-impactwater-consumptiondigital-infrastructuresustainabilityTesla Cybercab Skepticism, Ford & GM EV Disappointment — YouTube - CleanTechnica
The article summarizes a recent CleanTechnica video discussion featuring Steve Hanley, Larry Evans, and Zachary Shahan, where they examined several key topics in the electric vehicle (EV) industry. Central to the conversation was skepticism about Tesla’s upcoming Cybercab, with doubts expressed about whether it will achieve the high impact Tesla anticipates. They also analyzed the slow start of EV sales in China, exploring potential reasons behind the market’s sluggishness. Additionally, the discussion highlighted the historical hesitancy and inconsistent efforts of legacy automakers Ford and General Motors in leading the EV transition, pointing to their failure to establish a strong foothold in the EV market. The article also notes that while some viewers have requested transcripts of these video discussions, YouTube’s built-in transcript feature is available for those interested. The CleanTechnica team emphasizes that their video chats provide a different, more conversational medium to complement their written articles, offering varied perspectives on the topics they cover. Readers and viewers are encouraged to engage with
energyelectric-vehiclesEV-salesTesla-CybercabFordGMrenewable-energyLucid Motors slashes 12% of its workforce as it seeks profitability
Lucid Motors is cutting 12% of its workforce, likely numbering in the hundreds, as part of efforts to improve operational efficiency and move toward profitability. The layoffs exclude hourly manufacturing, logistics, and quality team workers. Interim CEO Marc Winterhoff emphasized that the company remains committed to its core strategic priorities, including ramping up production of its Gravity SUV, launching a more affordable mid-size electric vehicle priced around $50,000, and expanding into the robotaxi market through partnerships with Uber and Nuro. Severance and transition support are being provided to affected employees. The workforce reduction comes amid ongoing challenges for Lucid, including production and quality issues with the Gravity SUV earlier in the year, though output has since doubled compared to 2024. The company is also preparing to release its 2025 financial results soon. Leadership instability has marked the past year, with former CEO Peter Rawlinson’s abrupt resignation in February 2025 and subsequent executive turnover, including a high-profile wrongful termination lawsuit from
energyelectric-vehiclesautomotive-industryworkforce-reductionrobotaxiautonomous-vehiclesADASBattery Storage System Replaces Wastewater Facility Diesel Generator - CleanTechnica
The article discusses a New York municipal project where a Viridi Battery Energy Storage System (BESS) replaced a diesel generator at a wastewater lift station, highlighting significant cost savings and environmental benefits. The installed cost of the lithium-ion Nickel Manganese Cobalt (NMC) battery system was $130,000, but federal incentives under the Clean Energy Investment Tax Credit (IRC Section 48E) reduced the effective capital cost by 40%, bringing the net cost to $78,000. Additional state incentives through New York’s NYSERDA program could further lower upfront costs, potentially to zero in qualifying areas. The battery system incorporates Viridi’s Fail-Safe Anti-Propagation™ technology to prevent thermal runaway and fire risks. The Viridi battery packs are rated for 4,000 full charge-discharge cycles before degrading to 80% of original capacity, with an expected operational life exceeding 20 years in this application due to infrequent cycling. Financially, the BESS reduces recurring operating
energybattery-storagelithium-ion-batteriesclean-energy-incentivesenergy-storage-systemdiesel-generator-replacementrenewable-energyWhy investors are going gaga over solid-state transformers
The article discusses the growing interest and investment in solid-state transformers (SSTs), which represent a significant modernization of traditional electrical transformers that have remained largely unchanged since Thomas Edison’s era. Unlike conventional transformers made of copper and iron that passively transfer electricity and perform a single function, SSTs use advanced power electronics and semiconductor materials such as silicon carbide or gallium nitride. This allows them to actively manage and control electricity flow, convert between alternating current (AC) and direct current (DC), and handle multiple voltages and bidirectional power flow. These capabilities make SSTs more flexible, software-updatable, and immune to commodity price fluctuations affecting copper and steel. Startups like DG Matrix, Heron Power, and Amperesand have recently raised substantial funding rounds to scale production of SST technologies, targeting data centers initially due to their need for compact, efficient, and controllable power systems. However, the broader opportunity lies in upgrading the aging electrical grid, where over half of distribution transformers in
energysolid-state-transformerselectrical-gridpower-electronicsrenewable-energydata-centerspower-distributionNASA pumps 2.8 million liters of fuel in historic Artemis 2 rehearsal
NASA successfully completed a critical wet dress rehearsal (WDR) for the Artemis 2 mission at Kennedy Space Center, marking a major milestone toward returning humans to the moon. Over two days, the team tested the Space Launch System (SLS) rocket and Orion spacecraft through full pre-launch procedures, including fueling the rocket with 2.76 million liters (730,000 gallons) of propellant. A key achievement was resolving a recurring liquid hydrogen leak issue by replacing seals, allowing the rocket’s tanks to remain stable and pressurized throughout fueling. The rehearsal also involved securing the Orion capsule’s hatch, verifying emergency systems, and conducting two simulated terminal countdowns, bringing the mission closer to a crewed launch planned as early as March 6, with a backup window in April. Artemis 2 will be the first human spaceflight beyond low Earth orbit since Apollo, carrying four astronauts—NASA’s Reid Wiseman, Victor Glover, Christina Koch, and Canadian Jeremy Hansen—on a
energyspace-explorationrocket-fuelArtemis-2NASAliquid-hydrogenspacecraft-fuelingScientists turn old phones, paper waste into next-gen battery material
Researchers from Shenyang Agricultural University in China have developed a sustainable method to create advanced electrode materials for sodium-ion batteries by recycling discarded mobile phone batteries and industrial lignin, a byproduct of paper and biofuel production. Using hydrothermal synthesis, they extracted nickel and cobalt from old batteries and combined these metal sulfides with lignin-derived carbon to form a composite material. This composite serves as an efficient anode, with lignin providing a conductive carbon coating that stabilizes the structure and enhances electrical conductivity, while the metal sulfides offer active sites for sodium-ion storage. Testing showed the material achieved an initial discharge capacity exceeding 1,000 mAh/g and maintained strong performance even at high current densities, indicating suitability for rapid charge-discharge cycles. This innovation exemplifies circular economy principles by addressing two environmental challenges simultaneously: electronic waste and industrial byproduct valorization. Sodium-ion batteries, favored for their abundance, low cost, and environmental friendliness compared to lithium-ion batteries, have faced challenges in electrode efficiency
energybattery-technologysodium-ion-batteriessustainable-materialsrecyclingelectrode-materialscircular-economyUS advanced nuclear reactors near deployment with new fuel deal
The Department of Energy’s Oak Ridge National Laboratory (ORNL) and Kairos Power have initiated a $27 million strategic partnership to accelerate the deployment of advanced nuclear reactors, focusing on the fluoride salt-cooled high-temperature reactor (KP-FHR). This innovative reactor design replaces traditional water coolant with molten fluoride salt, enabling operation at higher temperatures with enhanced inherent safety. Central to the technology are TRISO fuel pebbles, which are highly heat-resistant particles. The collaboration addresses critical technical challenges such as fuel manufacturing, component production via additive manufacturing, material performance under corrosive high-temperature conditions, and the development of remote maintenance systems suitable for radiation environments. These efforts support the Hermes 1 demonstration reactor in Oak Ridge, the first non-light-water reactor approved for construction by the US Nuclear Regulatory Commission, with construction having started in May 2025. In addition to technological development, Kairos Power secured a deal with the DOE to obtain High-Assay Low-Enriched Uranium (HALEU), essential for
energynuclear-reactorsadvanced-nuclear-technologymolten-salt-reactorTRISO-fueladditive-manufacturingenergy-innovationCould AI Data Centers Be Moved to Outer Space?
The article explores the growing energy and environmental challenges posed by the rapid expansion of AI data centers on Earth. These centers consume enormous amounts of electricity—AI servers alone are projected to require substantial power by 2028—leading to increased energy prices and greater carbon emissions. Additionally, the high heat output of AI chips necessitates advanced cooling methods, with many facilities turning to water evaporation cooling, which uses millions of gallons of water daily and strains local water resources. This has led to local opposition against new data center projects, raising the question of how to sustainably support the growing AI demand. One proposed solution is relocating data centers to outer space, where continuous solar energy is available and the cold environment could simplify thermal management. In orbit, data centers could perform heavy AI processing and transmit results back to Earth, similar to satellite internet. While theoretically feasible—Google’s AI overview confirms that space-based data centers can be built—the article urges caution, emphasizing the need for human intelligence to assess practical challenges. It also explains
energydata-centersAI-serverscooling-technologysolar-powerspace-technologythermal-managementUAE’s G42 teams up with Cerebras to deploy 8 exaflops of compute in India
Abu Dhabi-based technology firm G42 has partnered with U.S. chipmaker Cerebras to deploy a new supercomputer system in India delivering 8 exaflops of computing power. The system will be hosted in India, complying with local data residency, security, and compliance regulations, and aims to provide advanced AI computing resources to educational institutions, government bodies, and small and medium enterprises. This initiative is designed to bolster India’s sovereign AI infrastructure, enabling local researchers and innovators to develop AI technologies while maintaining full data sovereignty. The project also involves Abu Dhabi’s Mohamed bin Zayed University of Artificial Intelligence (MBZUAI) and India’s Centre for Development of Advanced Computing (C-DAC). This deployment marks a significant enhancement in India’s computational capacity and AI capabilities, accelerating the training and inference of large-scale AI models tailored to Indian needs. The collaboration builds on previous efforts such as the release of a Hindi-English large language model based on Meta’s Llama 3.1 by MBZU
energyAI-infrastructuresupercomputingdata-centerscloud-computingIndia-technologysovereign-AISwiss nanodevice uses saltwater evaporation to produce electricity
Researchers at the Laboratory of Nanoscience for Energy Technology (LNET) at EPFL in Switzerland have developed a novel nanodevice that generates electricity by harnessing saltwater evaporation driven by both heat and light. Unlike traditional hydrovoltaic (HV) technologies that primarily use water movement, this device leverages the interaction of evaporating saltwater with silicon nanopillars to control ion and electron flows, producing a stable electric current. The device’s trilayer structure—comprising layers for evaporation, ion transport, and electrical charge collection—enables efficient charge separation at the solid-liquid interface, creating an electric field that drives electricity generation. A key innovation is the dual role of heat and light: heat accelerates evaporation and enhances the device’s negative surface charge, while light excites electrons in the silicon semiconductor, together increasing energy output by a factor of five compared to previous designs. The device achieves a voltage of 1 V and a power density of 0.25 W/m².
energynanodevicehydrovoltaic-technologysaltwater-evaporationelectricity-generationsilicon-nanopillarsrenewable-energyWorld’s largest steam heat pump begins operations at Italian plant
Turboden, a Mitsubishi Heavy Industries group company, has successfully launched what it claims to be the world’s largest steam-producing heat pump at Delfort, an Italian specialty paper manufacturer. The system integrates a Large Heat Pump (LHP) with Mechanical Vapor Recompression (MVR) to generate 12 MWth of superheated steam at 3.4 bar(a) and temperatures between 150–180°C. It recovers low-grade waste heat from the industrial process and upgrades it using CO₂-free electricity, enabling high-temperature steam production without direct carbon emissions. The installation operates 10% above its guaranteed coefficient of performance (COP), demonstrating the technical and commercial viability of large-scale heat pump technology for decarbonizing industrial steam generation. This project addresses Delfort’s need for fully decarbonized steam while maintaining reliability and continuity with existing fossil-fuel boilers. The heat pump system was custom-engineered to fit within the plant’s limited footprint and fully integrated into the mill’s heat
energyheat-pumpdecarbonizationindustrial-steamwaste-heat-recoveryCO2-free-electricityMitsubishi-Heavy-IndustriesHigh-performance sodium-ion batteries could be made with new method
Researchers in Japan have developed a new method to enhance the performance of all-solid-state sodium-ion batteries by adding phosphorus to sodium-yttrium-silicate glasses. This addition promotes the formation of the Na5RSi4O12 crystal phase (where R represents rare earth elements), which serves as an effective solid electrolyte material. The phosphorus expands the formation range of this crystal phase when obtained as a glass ceramic, without compromising ionic conductivity. Analytical techniques such as neutron and X-ray diffraction, nuclear magnetic resonance spectroscopy, and microscopy confirmed that phosphorus integrates into the crystal structure by substituting silicon sites, potentially influencing ionic conductivity due to phosphorus’s higher electronegativity. Sodium-ion batteries operate on principles similar to lithium-ion batteries but offer advantages including the abundance and low cost of sodium, which is widely available from salt and seawater. These batteries also exhibit improved safety and better performance at low temperatures, making them suitable for large-scale energy storage supporting renewable sources like solar and wind. The development of phosphorus
energysodium-ion-batteriessolid-electrolytesglass-ceramicsphosphorus-dopingbattery-materialsenergy-storageTesla Receives FCC Waiver for Cybercab Wireless Charging System - CleanTechnica
Tesla has received a Federal Communications Commission (FCC) waiver to use Ultra-Wideband (UWB) radio technology for the wireless charging system of its upcoming Cybercab vehicle. The Cybercab, Tesla’s next production model expected to go on sale this year, is notable for lacking a steering wheel and pedals, emphasizing autonomous operation. Its wireless charging system uses a UWB transceiver on the vehicle and a corresponding transceiver on a ground-level pad to precisely position the vehicle for optimal inductive charging. Before activating UWB, the system employs Bluetooth to locate the charging pad and exchange data, a process not requiring an FCC waiver. This wireless charging approach allows the Cybercab to charge without human intervention, complementing traditional charging methods such as Tesla Superchargers and Level 2 stations. While inductive wireless charging technology has existed for some time, it has not become a mainstream option for passenger electric vehicles. Tesla’s implementation, enabled by the FCC waiver, represents a significant step toward integrating wireless charging into
energywireless-chargingelectric-vehiclesTesla-CybercabUltra-Wideband-technologyFCC-waiverinductive-chargingGeneral Catalyst commits $5B to India over five years
General Catalyst, a Silicon Valley venture firm managing over $43 billion in assets, has committed to investing $5 billion in India over the next five years, significantly increasing its previous allocation of $500 million to $1 billion. This expansion follows its merger with local venture firm Venture Highway and aims to bolster startups in artificial intelligence, healthcare, defense technology, fintech, and consumer technology. The announcement was made at the India AI Impact Summit in New Delhi, highlighting India's emergence as a major AI investment hub with ambitions to attract over $200 billion in AI infrastructure investments within two years. The firm’s CEO, Hemant Taneja, emphasized India's potential to build the next generation of global platform companies, citing the country’s large digital infrastructure, vast market, and skilled talent pool as key advantages. General Catalyst focuses on large-scale AI deployment rather than frontier model development and has already invested in Indian startups across various sectors, including Zepto and Jeh Aerospace. The firm plans to support companies from early stages through public
energyAI-infrastructuredata-centerscloud-computinginvestmenttechnology-startupsIndiaTrump GOP: Forget Progress, Back to the Caves! - CleanTechnica
The article from CleanTechnica criticizes the Trump administration and its Republican allies for attempting to pressure the International Energy Agency (IEA) to focus exclusively on fossil fuels while ignoring renewable energy sources. The author highlights the absurdity of this stance, emphasizing that the majority of new power capacity globally and in the U.S. comes from cheaper, cleaner solar and wind energy. The article argues that supporting fossil fuels over renewables is not only economically and environmentally irrational but also reflects a regressive, anti-science mindset that seeks to halt progress and drag society backward. Despite these political pressures, the IEA has resisted calls to abandon renewable energy coverage, reaffirming its commitment to secure, affordable, and sustainable energy based on data-driven analysis. Fatih Birol, the IEA head, underscores the agency’s non-political stance and dedication to advancing global energy transitions for humanity’s benefit. Meanwhile, the article notes that much of the world is moving forward with electrification and clean energy adoption, leaving the
energyrenewable-energysolar-powerwind-powerfossil-fuelselectric-vehiclessustainable-energyWorld’s largest solar-plus-storage site confirms safe grid connection
The world’s largest solar-plus-storage project, MTerra Solar in the Philippines, has achieved a major milestone by successfully completing its initial grid synchronization and energization with the Luzon grid. This event, held on February 12 in Gapan, Nueva Ecija, confirms the system’s readiness and safe connection, marking a critical step toward operational status. Phase 1 of the project is progressing on schedule, with 1,288 MWdc of solar photovoltaic capacity installed as of January 2026, making it the largest solar installation in the country. Additionally, 622 battery energy storage system units have been installed, positioning MTerra Solar to become the largest integrated solar and storage facility in the Philippines once fully operational. Key stakeholders highlighted the significance of this development for the country’s energy landscape. DOE Undersecretary Rowena Guevara emphasized that the switch-on enables MTerra Solar to begin exporting power and supplying firm, dependable capacity through its combined solar and battery storage system, which is especially
energysolar-powerenergy-storagebattery-energy-storage-systemgrid-integrationrenewable-energyclean-energyThe War Against Solar Power Is Doomed To Fail
Despite recent shifts in federal energy policy favoring fossil fuels, demand for solar power in the United States remains strong, with the domestic solar industry advancing rapidly. A key development is the introduction of high-efficiency TOPCon (Tunnel Oxide Passivated Contact) solar cells, which feature an extra reflective layer to boost conversion efficiency. Although TOPCon technology was first developed in Germany in 2013, high production costs initially limited its commercial adoption in favor of competing PERC technology. However, companies like Talon in Texas are now driving TOPCon manufacturing domestically, exemplified by a multi-year supply agreement with German wafer producer NexWafe to supply around 7 gigawatts of advanced silicon wafers through 2032. This partnership is expected to catalyze further multi-gigawatt manufacturing ventures in the U.S., supported by ongoing collaboration with Germany’s Fraunhofer Institute to enhance wafer quality and solar cell efficiency. Meanwhile, other players such as Japanese startup Toyo Solar and major
energysolar-powerTOPCon-solar-cellsrenewable-energysolar-manufacturingsilicon-wafersclean-energy-technologyEnhanced Geothermal Systems Could Expand Geothermal Power Generation - CleanTechnica
The article discusses the potential of Enhanced Geothermal Systems (EGS) to significantly expand geothermal power generation in the United States. Unlike conventional geothermal systems that rely on naturally occurring hydrothermal reservoirs found in limited locations near tectonic boundaries or volcanic hotspots, EGS uses advanced drilling technologies—borrowed from oil and gas industries—to create artificial hydrothermal reservoirs where none exist. This innovation could allow geothermal power plants to be established across a much wider geographic area, beyond the western states where geothermal resources are currently concentrated. The U.S. currently has about 3.7 gigawatts (GW) of conventional geothermal capacity, representing only 0.2% of summer peak generating capacity. However, the U.S. Geological Survey estimates that the Great Basin alone could support 135 GW of EGS capacity, and other studies project that up to 500 GW of cost-effective geothermal power could be developed nationwide by 2050. Despite this promise, challenges remain, including the high costs and technical difficulties of deep
energygeothermal-energyrenewable-energyenhanced-geothermal-systemsclean-energypower-generationsustainable-energySolar Power Used To Charge An EV In The Sub-Arctic - CleanTechnica
A pilot project by Easee and Subaru successfully demonstrated that off-grid solar power can be used to charge an electric Subaru vehicle in the sub-Arctic, challenging the misconception that solar panels only work in hot climates. The project utilized a temporary setup of four 455-watt portable solar panels and a 4000-watt battery, achieving a charging power of 2.9 kW. The entire off-grid charging system cost approximately £4500, with somewhat lower costs in Canada. The technology is fully portable and adaptable, with potential applications for charging electric snowmobiles, e-bikes, ATVs, and motorcycles using the Easee Type 2 charger. The pilot also highlighted the interest and suitability of clean, renewable energy solutions for indigenous communities in northern regions, who value both environmental stewardship and the practical benefits of fuel-independent mobility. These communities face rapid climate change impacts, including extreme weather events like flooding and wildfires, which have increased the urgency to transition away from fossil fuels. The success
energysolar-powerelectric-vehiclesoff-grid-chargingrenewable-energysub-Arctic-technologyportable-solar-panelsSierra Club Report: PFAS Found in Nearly All Alabama’s Waterways - CleanTechnica
A recent Sierra Club report reveals that per- and polyfluoroalkyl substances (PFAS), toxic "forever chemicals," have been detected in nearly all of Alabama’s waterways. Testing of 29 water samples across the state found PFAS in every sample, with 88% of surface waters containing PFAS levels high enough to warrant fish consumption advisories. The highly toxic compounds PFOA and PFOS were present at 27 of the 29 sites, and a total of 14 different PFAS chemicals were identified. These substances are persistent in the environment, pose serious health risks including cancer and immune damage, and remain largely unregulated by U.S. authorities, allowing industries to discharge them into wastewater systems. Nancy Muse, Chair of the Sierra Club Alabama Chapter, emphasized the urgent need for state legislators and regulators to act against polluters and halt the unregulated dumping of PFAS into waterways to protect public health. The Sierra Club, a leading environmental organization, advocates for clean energy,
energyenvironmental-pollutionPFAS-contaminationwater-qualitytoxic-chemicalswastewater-treatmentpublic-healthColoradans Push Back On Trump Trying To Force Coal On Them - CleanTechnica
The article discusses the pushback from Colorado legislators and environmental groups against the Trump administration’s attempts to keep aging coal power plants operational under a claimed “emergency” order. Specifically, the administration is using a Department of Energy 202(c) order to extend the operation of the Craig 1 coal unit beyond its planned retirement at the end of 2025, despite Colorado’s clean energy goals and prior approvals for renewable projects being blocked. Critics argue this move is unjustified, costly—potentially up to $85 million annually—and harmful to public health and the environment, as it forces Coloradans to endure dirty air and higher energy prices for the profit of others. In response, Colorado legislators introduced HB26-1226, a bill designed to counteract the federal order by increasing transparency on the costs of keeping coal plants running past retirement, requiring modern pollution controls for any coal plants operating after 2030, and directing the Public Utilities Commission to approve new clean energy resources to meet the state’s
energycoal-powerrenewable-energyclimate-policyair-pollutionenergy-legislationpublic-utilitiesRail integrity lab opens to tackle wear, vibration and load stress
The Christian Doppler Laboratory for Structural Integrity in Rail Vehicle Design has opened at Graz University of Technology in Austria to address the challenges of mechanical stress, wear, vibration, and load on rail vehicles. Funded by Austria’s Federal Ministry of Economy, Energy and Tourism, the lab aims to develop scientific methods that enable the creation of safer, lighter, and longer-lasting rail cars and locomotives. This initiative supports Austria’s broader industrial strategy by advancing energy efficiency, climate action, and technological sovereignty in rail transport, which is considered a critical component of the nation’s mobility and infrastructure policy. The laboratory’s research is divided into two main modules. The first focuses on the fatigue strength of welded steel structures in vehicle frames and lightweight wheelset axles, analyzing how materials and manufacturing processes impact durability under complex, real-world load conditions. The second module investigates the structural integrity and dynamic behavior of brake systems, particularly friction-induced vibrations, using simulations and experimental testing on an advanced brake test rig. Both modules integrate vibration
energymaterialsrail-technologystructural-integrityfatigue-strengthlightweight-designenergy-efficiencyFAW Begins Testing Semi-Solid-State Battery With 500 Wh/kg Energy Density - CleanTechnica
FAW, through its subsidiary China Automotive New Energy Battery (CANEB) and in collaboration with Nankai University, has developed and begun testing a semi-solid-state battery boasting an energy density of 500 Wh/kg. This battery uses a novel approach by replacing expensive nickel with abundant and cheaper manganese, resulting in a lower-cost battery pack with energy density comparable to solid-state batteries. The battery features in situ cured composite electrolyte technology, offering high ionic conductivity, flame retardancy, and improved safety. The lithium-manganese cathode achieves an energy density of 300 mAh/g, more than double that of the best lithium iron phosphate (LFP) cells, enabling prototype vehicles to potentially exceed 1,000 km (over 600 miles) on a single charge, with future versions targeting up to 700 miles. The semi-solid-state battery is categorized under China’s new solid-state battery classification system, which defines batteries by the percentage of solid electrolyte content; those with 95% solid electrolyte
energybattery-technologysemi-solid-state-batteryelectric-vehiclesmanganese-batterysolid-state-batteryenergy-densityNew dry battery design boosts conductivity, reduces side reactions
Researchers at the University of Chicago have developed a novel dry electrode design for lithium-ion batteries that promises to make them cheaper, cleaner, and more powerful. Unlike conventional slurry-based manufacturing, which uses toxic solvents and struggles with thicker electrodes, the dry processing method eliminates solvents entirely, reducing cost and environmental impact while simplifying production. Importantly, the team discovered that dry-processed electrodes exhibit stronger conductivity, can be made thicker, and demonstrate better cycling stability at high voltages compared to traditional electrodes, marking a significant materials breakthrough beyond just manufacturing improvements. A key finding is the unexpected synergistic interaction between the carbon conductive additive and the polymer binder in the dry process. Traditionally viewed as independent components, the binder in the dry electrodes partially coats the reactive carbon surfaces, reducing their reactivity and suppressing side reactions that typically occur at high voltages. This coating effect enhances the battery’s structural and chemical stability, enabling more robust performance and improved high-voltage cycling with minimal degradation. The researchers believe this advancement could accelerate the
energybattery-technologydry-electrodelithium-ion-batterymaterials-scienceelectric-vehiclesconductivity-improvementGermany’s Bid To Double Hydrogen Fuel Targets Ignores Operator Demand And Cost Signals - CleanTechnica
The article critiques Germany’s Bundesrat proposal to double mandated hydrogen fuel targets, arguing that it prioritizes salvaging existing investments over market efficiency and economic viability. The Bundesrat’s approach effectively positions the state as a guarantor of hydrogen demand, ignoring weak market signals and operator reluctance. Independent fiscal institutions in Germany and France have warned that hydrogen strategies for transport are significantly more expensive than alternatives, with costs per ton of CO2 avoided ranging from €400 to €520—far exceeding those of direct electrification methods. These audits highlight that hydrogen subsidies have disproportionately favored road transport, despite battery electric trucks demonstrating lower total ownership costs. Furthermore, Germany’s national hydrogen strategy has underperformed, with supply and demand lagging behind expectations despite substantial federal funding. Key hydrogen demand anchors, such as steel projects and power generation roles, have faced delays or reductions, undermining the economic rationale for extensive hydrogen infrastructure. This creates fiscal risks, as state-backed loans of up to €24 billion depend on future network utilization,
energyhydrogen-fueldecarbonizationrenewable-energygreen-hydrogenenergy-policyclean-energyAn Electric Chevy BrightDrop Van For 50% Off? - CleanTechnica
The article contrasts two approaches to electric recreational vehicles (RVs) and cargo vans, highlighting environmental and economic considerations. It critiques the 2026 Entegra Electric Class A Motorhome, a large hybrid RV priced between $300,000 and $400,000, which combines a limited electric range of about 105 miles with a gas generator that extends total range by 345 miles. Despite its partial electrification, the RV primarily relies on fossil fuels due to its size and weight, raising concerns about its environmental impact and efficiency. The article suggests that such large hybrids may delay the transition to fully electric transportation and questions the necessity of owning an oversized RV. In contrast, the article promotes the all-electric Chevy BrightDrop 600 cargo van, which offers an electric range of 250–272 miles, all-wheel drive, and a significantly lower price point under $50,000. With an additional $15,000 investment for DIY RV conversion—including rooftop solar and battery systems—the BrightDrop can serve
energyelectric-vehicleselectric-vanshybrid-vehiclesbattery-technologyrenewable-energytransportation-efficiencyIEA Focus On Clean Energy Gives US Officials Heartburn - CleanTechnica
The article discusses tensions between the U.S. government and the International Energy Agency (IEA) over the agency’s evolving focus on clean energy. Originally established in the 1970s to monitor oil and gas supplies following the OPEC embargoes, the IEA has shifted its attention over the past decade toward renewable energy sources like wind and solar. By 2020, the agency prioritized reporting on renewables rather than fossil fuels, reflecting the sector’s rapid growth. This shift has caused friction with U.S. officials aligned with pro-fossil fuel policies, who have pressured the IEA to revert to its original mandate focused on oil and methane production. The U.S., as a major funder of the IEA, asserts influence over its direction, though other countries such as the UK continue to support the agency’s clean energy programs. The article highlights outspoken criticism from U.S. Energy Department officials and some Republican lawmakers who reject climate science and oppose the IEA’s clean energy emphasis. They
energyclean-energyrenewable-energyInternational-Energy-Agencyenergy-policyfossil-fuelsenergy-transitionGreen NGOs & Renewable Fuel Producers: Commission Must Resist Pressure to Reopen the Rules Governing Renewable Hydrogen - CleanTechnica
The article discusses the recent completion of the EU’s hydrogen regulatory framework with the enforcement of Delegated Regulation (EU) 2025/2359, known as the Low-Carbon Fuel Delegated Act. This framework, finalized in 2025, provides essential regulatory certainty for hydrogen producers, offtakers, and investors, which is critical for the successful development and market rollout of renewable hydrogen within the EU. The regulation sets clear rules on additionality, temporal, and geographical correlation requirements that underpin the sustainability and climate goals tied to hydrogen production. Green NGOs and renewable fuel producers are urging the European Commission to resist pressures from certain industrial and political groups seeking to accelerate the review of these rules ahead of the planned 2028 deadline. They argue that weakening or reopening the hydrogen framework prematurely would undermine climate objectives, threaten grid stability, and create uncertainty that could deter investment in a sustainable hydrogen market. The article emphasizes the importance of maintaining the current regulatory timeline to ensure a stable and effective transition to renewable hydrogen in
energyrenewable-energyhydrogen-fuelEU-energy-policyclimate-goalssustainable-energyenergy-regulationOregon Adopts New Building Codes to Reduce Energy Costs and Increase Energy Efficiency in Newly Constructed Homes - CleanTechnica
Oregon’s Residential and Manufactured Structures Board (RMSB) has approved updates to the state’s residential energy code requiring new homes to use energy-efficient heat pumps instead of traditional ducted air conditioning. This change is expected to save residents an average of $125 per month, or over $1,700 annually, on energy bills. The update aims to improve comfort, affordability, and resilience in new homes while reducing pollution by relying more on clean heating technologies and cutting energy waste. Heat pumps provide efficient heating and cooling, helping to address rising energy costs and increasing household energy burdens across the state. The code update aligns with Oregon’s broader energy strategy to achieve reliable, affordable, and clean energy, and has received support from building professionals, elected officials, and climate organizations. It allows heat pumps to serve as the primary heating source, with methane gas permitted only for supplemental heating to ease grid demand during peak periods. This move brings Oregon’s building standards closer to those of California and Washington, supporting the state
energyenergy-efficiencyheat-pumpsbuilding-codesresidential-energyclean-energyenergy-savingsSierra Club, Partners Sue EPA Over Illegal Repeal of Climate Protections - CleanTechnica
A coalition of health and environmental organizations, including the Sierra Club, American Public Health Association, American Lung Association, and others, has filed a lawsuit against the EPA in the D.C. Circuit Court. The suit challenges the Trump administration’s repeal of the 2009 endangerment finding, which recognized climate pollution as a threat to public health and welfare and formed the basis for vehicle emissions standards aimed at reducing carbon pollution. The repeal also eliminated clean vehicle standards that were projected to deliver the largest reduction in U.S. carbon emissions, save lives, and reduce fuel costs for Americans. The plaintiffs argue that the EPA’s rollback is unlawful and contradicts the Supreme Court’s 2007 Massachusetts v. EPA decision, which affirmed greenhouse gases as air pollutants under the Clean Air Act and mandated EPA to regulate them based on scientific evidence. The lawsuit names EPA Administrator Lee Zeldin and the EPA as defendants, emphasizing the agency’s legal obligation under the Clean Air Act to regulate pollutants that endanger public health.
energyclimate-changeEPA-regulationsvehicle-emissionsclean-air-actcarbon-pollutionenvironmental-lawScientists improve lithium batteries with breakthrough gel electrolyte
Researchers at Columbia University have developed a novel gel electrolyte for anode-free lithium-ion batteries that significantly enhances their safety and lifespan. By reengineering the nanoscale interactions between polymer electrolytes and lithium ions, the team created a parasitic salt-phobic polymer network that selectively repels lithium ions while attracting solvent molecules. This design leads to nanoscale phase separation within the electrolyte, promoting the formation of a thin, inorganic-rich protective layer on the lithium surface. This layer facilitates smoother, denser lithium deposition and suppresses parasitic reactions that typically degrade battery performance, addressing key challenges such as unstable lithium plating and electrode-electrolyte interface reactions. Laboratory tests demonstrated that batteries using this gel electrolyte retained over 80% of their capacity under near-real-world conditions and exhibited enhanced thermal stability. Notably, multilayer pouch cells with the gel electrolyte resisted thermal runaway during abuse tests like drilling, unlike conventional liquid electrolyte batteries that ignited or exploded. The research highlights that engineering the nanoscale environment of electrolytes
energylithium-ion-batteriesgel-electrolytebattery-safetybattery-lifetimepolymer-electrolytesenergy-storageSoftBank to spend an eye-popping $33B to build huge U.S. gas power plant
SoftBank subsidiary SB Energy plans to build a massive 9.2 gigawatt natural gas-fired power plant on the Ohio-Kentucky border, with an estimated cost of $33 billion. This project would be significantly more expensive than recent natural gas plants, reflecting a sharp rise in construction costs. It remains unclear who will ultimately bear the financial burden, though traditionally, rate-payers fund new generating capacity. The plant’s purpose—whether to supply the general power grid or to support data centers—is also not specified, though SoftBank has partnerships with OpenAI involving data center power solutions. The project is expected to take many years, potentially up to a decade, to complete, especially given current shortages of natural gas turbines. Environmentally, the plant could emit approximately 15 million metric tons of carbon dioxide annually, with potentially greater climate impacts when factoring in emissions from the natural gas supply chain. The article highlights the significant financial, logistical, and environmental challenges associated with this large-scale fossil fuel infrastructure investment
energynatural-gaspower-plantSoftBankSB-Energycarbon-emissionsenergy-infrastructureUS tech to turn nuclear waste into power, cut radioactive life by 99.7%
Researchers at the U.S. Department of Energy’s Thomas Jefferson National Accelerator Facility are developing Accelerator-Driven Systems (ADS) technology to transform spent nuclear fuel into a source of carbon-free electricity while drastically reducing its radioactive lifespan. Supported by $8.17 million from the DOE’s NEWTON program, the ADS approach uses particle accelerators to fire high-energy protons at targets like liquid mercury, triggering neutron spallation that transmutes long-lived radioactive isotopes in nuclear waste. This process can cut the hazardous storage time of nuclear waste from about 100,000 years down to just 300 years, effectively turning nuclear waste from a permanent liability into a recyclable fuel source. To make ADS economically viable, the Jefferson Lab team is addressing key technical challenges related to accelerator efficiency and power. They are innovating by coating niobium cavities with tin to allow operation at higher temperatures using standard commercial cooling, avoiding costly cryogenic systems. Additionally, they are developing advanced spoke cavity designs to improve neutron production efficiency.
energynuclear-energyaccelerator-driven-systemsradioactive-waste-managementparticle-accelerator-technologysuperconducting-materialsclean-energy-innovationA US Sodium-Ion Battery Maker Challenges Powerwall
The article discusses the rising prominence of sodium-ion batteries as a competitive alternative to lithium-ion batteries, particularly Tesla’s Powerwall, in the US energy storage market. Rising electricity costs and shifts in federal energy policy have accelerated demand for energy storage solutions that complement rooftop solar, off-peak electricity rates, and virtual power plants. While lithium-ion batteries remain dominant, they face challenges such as safety concerns highlighted by a recent Tesla recall and lawsuit over overheating risks. In contrast, sodium-ion batteries offer advantages in cost, safety, and supply chain security due to the abundance and thermal stability of sodium, though they currently lag in energy density and lifespan. To address these limitations, the US Department of Energy launched the Sodium-ion Alliance for Grid Energy Storage (SAGES) in late 2024, a four-year initiative aimed at improving sodium-ion technology for grid-scale applications. Concurrently, private companies like Syntropic (formerly Emtel Energy) are advancing sodium-ion battery products tailored for various uses, including short
energysodium-ion-batteriesenergy-storagerenewable-energybattery-technologygrid-energy-storageTesla-PowerwallBattery Storage System Replaces Wastewater Facility Diesel Generator - CleanTechnica
The article discusses a New York municipal project where a Viridi Battery Energy Storage System (BESS) replaced a diesel generator at a wastewater lift station, highlighting significant cost savings and environmental benefits. The installed cost of the lithium-ion Nickel Manganese Cobalt (NMC) battery system was $130,000, but federal incentives under the Clean Energy Investment Tax Credit (including a 30% base credit plus a 10% domestic content bonus) reduced the net municipal capital cost to $78,000. Additional state incentives in New York, such as the Inclusive Storage Incentive (ISI), may further lower or eliminate upfront costs for qualifying municipalities. The battery system incorporates Viridi’s Fail-Safe Anti-Propagation™ technology to prevent thermal runaway and enhance safety. Viridi’s battery packs are rated for 4,000 full charge-discharge cycles before degrading to 80% of their initial capacity, translating to an expected operational life exceeding 20 years in applications like the Erie County Pumping Station
energybattery-storagelithium-ionclean-energyenergy-incentivesenergy-storage-systemrenewable-energyFrench firm's sodium test rig to replicate 1382°F nuclear reactor temp
French company Blue Capsule Technology has begun constructing a full-scale sodium test rig named ELISE, designed to replicate the high-temperature conditions of its sodium-cooled small modular reactor (SMR). The test rig will simulate temperatures up to 1,382°F (750°C), matching the operational environment of Blue Capsule’s high-temperature reactor (HTR). Standing nine meters tall upon completion, ELISE aims to provide critical data on thermo-hydraulics and natural circulation of liquid sodium at these elevated temperatures. This installation marks the first step in Blue Capsule’s development roadmap and will operate for several years at Peyrolles-en-Provence in collaboration with France’s CSTI Group. Blue Capsule’s HTR targets energy-intensive industries such as cement, metal refining, hydrogen production, and chemical manufacturing, offering a reliable source of fossil-free heat (up to 700°C), steam (up to 650°C), and 50 MW of electricity. The reactor design incorporates robust TRISO fuel for enhanced safety
energynuclear-reactorsmall-modular-reactorhigh-temperature-reactorsodium-cooled-reactorTRISO-fuelfossil-free-energyUS: 'Wall of steel' to provide shield for shipping and oil, Navy missions
Two US defense firms, Janus Marine & Defense and Raven Defense, are collaborating to create a high-tech “wall of steel” in the Gulf of America aimed at protecting critical oil, gas, and commercial shipping operations. The initiative seeks to reduce the US Navy’s operational burden while enhancing security across the Caribbean and Gulf regions. Their integrated security system combines persistent intelligence, surveillance, and reconnaissance (ISR), autonomous maritime patrols using unmanned surface and aerial drones, rapid interception capabilities, and remote operations center support. This approach leverages over a decade of experience with unmanned vessels, including autonomous mine-hunting missions, to provide continuous maritime coverage, faster response times, and reduced risk to personnel. The “wall of steel” is designed to safeguard offshore energy infrastructure, ports, and vital shipping corridors by integrating advanced signal detection and layered cybersecurity measures. By relying on autonomous platforms and remote monitoring, the system aims to maintain round-the-clock situational awareness and strengthen protection against offshore threats. Meanwhile, the US
robotIoTenergyautonomous-maritime-patrolunmanned-surface-vesselsoffshore-energy-securitysurveillance-technologyCanada's silicon drone battery delivers 2x flight, 50% faster charging
Canada’s NEO Battery Materials has developed a silicon-enhanced drone battery, the NBM Drone Cell, which nearly doubles flight time and enables 50% faster charging compared to a leading Chinese benchmark. In real-world tests using a commercial Korean surveillance drone, the battery increased flight duration from 29.9 to 59.2 minutes under cold conditions, without requiring any modifications to the drone’s propulsion or control systems. The battery achieves this through a silicon-anode structure that boosts energy density to 260 Wh/kg and total capacity to 755 Wh, representing significant improvements over Chinese alternatives. Additionally, the battery maintains stable voltage to reduce power loss risks. The NBM Drone Cell also supports ultra-fast charging rates up to 0.5 Ah per minute, a 150% increase over previous speeds, enhancing operational readiness. With China dominating the drone battery supply chain, NEO’s breakthrough offers a strategic non-Chinese alternative, particularly for defense and unmanned systems. The company is now refining battery
energymaterialsdrone-batterysilicon-anodefast-chargingbattery-technologyunmanned-aerial-systemsMechanical Reality Is Catching Up To ICE Pickups - CleanTechnica
The article from CleanTechnica discusses the growing reliability issues in modern half-ton internal combustion engine (ICE) pickup trucks, contrasting them with older models and heavier-duty trucks. The author, drawing from personal experience towing travel trailers with both a 2001 Suburban and a new Silverado EV, highlights a troubling trend: newer light-duty pickups are becoming less durable despite higher prices. Data shows that trucks likely to reach 250,000 miles are predominantly heavy-duty models or hybrids, with popular half-ton trucks like the Ford F-150 and Ram 1500 less likely to endure long-term use compared to their predecessors. The Toyota Tundra is an exception, but overall, many modern half-ton trucks struggle with reliability, especially under towing and daily work stresses. This decline in longevity is attributed to stringent fuel economy standards imposed on half-ton trucks, which have driven manufacturers to implement complex, fragile engineering solutions on aging engine platforms. Examples include cylinder deactivation systems that can cause severe mechanical failures and intricate
energyelectric-vehiclesclean-energyEV-trucksvehicle-longevityautomotive-engineeringsustainable-transportationUS nuclear fission chamber passes extreme heat stress test at 1,472°F
The Department of Energy’s Oak Ridge National Laboratory (ORNL) has successfully tested a prototype high-temperature nuclear fission chamber capable of operating reliably at 800°C (1,472°F), a temperature consistent with advanced reactor designs like molten salt and high-temperature gas-cooled reactors. This weeklong irradiation test, conducted at The Ohio State University Research Reactor, demonstrated that the sensor maintained expected performance across all reactor power levels without degradation. The fission chamber, developed by Curtiss-Wright, is critical for detecting neutrons to safely start and monitor reactor power, especially in reactors operating at higher temperatures than conventional light-water reactors. The testing involved a custom rig engineered by ORNL experts to simulate extreme reactor environments, combining high thermal loads with constant irradiation. The collaborative effort between ORNL and Curtiss-Wright engineers validated the sensor’s mechanical and electrical integrity under these conditions. This successful validation supports the Department of Energy’s Advanced Sensors and Instrumentation program and was facilitated through the GAIN voucher program, which
energynuclear-energyhigh-temperature-reactorsfission-chambernuclear-sensorsOak-Ridge-National-Laboratoryadvanced-reactor-technologyUS study advances powerful EV batteries with dry-electrode method
Engineers at the University of Chicago have developed a novel dry-electrode manufacturing technique for lithium-ion batteries that eliminates the use of toxic liquid slurries traditionally employed in battery production. This solvent-free dry process creates a more robust electrode architecture, resulting in batteries that are more powerful, longer-lasting, and capable of cycling efficiently at high voltages. The method addresses economic, environmental, and societal concerns by reducing manufacturing complexity, energy consumption, and hazardous waste, while also enabling thicker electrodes with better conductivity. A key discovery underpinning the improved battery performance is a synergistic chemical interaction between carbon additives and binders in the dry process, which was previously unrecognized. This interaction forms a superior conductive network and reduces the reactivity of carbon at high voltages, minimizing side reactions that typically degrade battery life. The resulting electrodes are more durable and allow for denser energy storage without the fragility seen in wet-processed materials. This advancement could significantly lower production costs, enhance charging speed, and improve the affordability
energybattery-technologyelectric-vehiclesdry-electrode-methodlithium-ion-batteriessustainable-manufacturingelectrode-materialsUS approves Tesla radio technology for outdoor Cybercab EV charging
Tesla has received a significant regulatory approval from the U.S. Federal Communications Commission (FCC) to use ultra-wideband (UWB) radio technology in an outdoor, fixed wireless charging system for its upcoming Cybercab robotaxi. The waiver, granted on February 18, 2026, exempts Tesla from two FCC rules that typically restrict UWB devices to handheld use and prohibit outdoor fixed antennas. This approval is crucial for Tesla’s wireless charging system, which relies on a ground-level pad installed outdoors to communicate with the vehicle for precise parking and alignment before charging. The Cybercab, a two-passenger, fully autonomous vehicle unveiled in October 2024 and produced at Tesla’s Texas Gigafactory, is expected to enter broader production by 2027 with a projected price of around $30,000. Tesla’s UWB system operates by first establishing a Bluetooth Low Energy connection between the vehicle and the charging pad, followed by brief, low-power UWB transmissions in the 7.7–
robotIoTenergywireless-chargingultra-wideband-technologyautonomous-vehiclesTesla-CybercabReliance unveils $110B AI investment plan as India ramps up tech ambitions
Reliance Industries, led by billionaire Mukesh Ambani, announced a massive $110 billion (₹10 trillion) investment plan to develop AI computing infrastructure in India over the next seven years. The initiative includes building gigawatt-scale data centers, a nationwide edge computing network, and integrating new AI services with Reliance’s Jio telecom platform. Construction has already started on multi-gigawatt data centers in Jamnagar, Gujarat, with over 120 megawatts of capacity expected by late 2026. This investment complements similar large-scale AI infrastructure commitments from other Indian conglomerates like Adani Group and government projections of over $200 billion in AI spending within two years. Global tech firms such as OpenAI are also expanding their AI capacity in India through partnerships with local companies like Tata Group. Ambani emphasized the strategic importance of this push for India’s technological self-reliance, stating that the country “cannot afford to rent intelligence” and aiming to drastically reduce AI service costs, similar
energyAI-computingdata-centersedge-computinggreen-energysolar-powertechnology-investmentChemical used to create much of world’s plastics produced from waste gas
Researchers at the Weinberg College of Arts and Sciences in the United States have developed an innovative electrolyzer that produces ethylene—a key chemical used in much of the world’s plastics—from syngas, a waste gas derived from plastic. Traditional ethylene production generates a substantial carbon footprint, producing one ton of carbon dioxide per ton of ethylene. The new method uses electricity and a novel material, sodium polyacrylate (PANa), to catalyze the reaction efficiently, reducing the overall energy consumption of the process by over 60% compared to previous electrified methods. This system operates in a solid-state, gas-fed configuration without liquid water, mimicking a liquid salt environment to enhance performance and stability over extended periods. The research, published in Nature Energy, highlights the potential for this technology to integrate with renewable energy sources, enabling a greener and more circular ethylene supply chain that minimizes fossil fuel use. The team overcame challenges related to activating the CO-to-ethylene transformation without alkali an
energymaterialselectrolysisethylene-productionrenewable-energycarbon-footprint-reductionchemical-recyclingOpenAI taps Tata for 100MW AI data center capacity in India, eyes 1GW
OpenAI has entered a strategic partnership with India’s Tata Group to secure 100 megawatts (MW) of AI-ready data center capacity, with plans to scale up to 1 gigawatt (GW) over time. This collaboration, part of OpenAI’s Stargate project, aims to build advanced AI infrastructure and accelerate enterprise AI adoption globally, with India as a key growth market. OpenAI will be the first customer of Tata Consultancy Services’ (TCS) HyperVault data center business, leveraging the local capacity to run its most advanced AI models domestically. This will reduce latency for Indian users and ensure compliance with data residency and security regulations, which is critical for enterprises handling sensitive data under India’s data localization laws. Beyond infrastructure, the partnership includes deploying ChatGPT Enterprise across Tata’s workforce, starting with hundreds of thousands of TCS employees, marking one of the largest enterprise AI rollouts globally. TCS will also use OpenAI’s Codex tools to standardize AI-native software
energydata-centersAI-infrastructureOpenAITata-Groupenterprise-AIpower-consumptionIEA Focus On Clean Energy Gives US Officials Heartburn - CleanTechnica
The article discusses tensions between the U.S. government and the International Energy Agency (IEA) over the agency’s evolving focus on clean energy. Originally established in the 1970s to monitor oil and gas supplies, the IEA has shifted its emphasis over the past decade toward renewable energy sources like wind and solar. By 2020, the IEA had largely ceased reporting on fossil fuels, prioritizing clean energy instead. This shift has caused friction with U.S. officials, particularly those aligned with pro-fossil fuel policies, who have pressured the IEA to revert to its original mandate of focusing on oil and methane production. The U.S., as the primary funder of the IEA, asserts influence over the agency’s direction, though other countries like the UK continue to support the IEA’s clean energy initiatives with additional funding. The article highlights the political divide in the U.S., where some officials reject the scientific consensus on climate change and oppose the IEA’s green energy agenda
energyclean-energyrenewable-energyInternational-Energy-Agencyenergy-policyoil-and-gasenergy-transitionSierra Club, Partners Sue EPA Over Illegal Repeal of Climate Protections - CleanTechnica
A coalition of health and environmental organizations, including the Sierra Club, American Public Health Association, American Lung Association, and others, has filed a lawsuit against the EPA in the D.C. Circuit Court. The suit challenges the Trump administration’s repeal of the 2009 EPA endangerment finding, which recognized climate pollution as a threat to public health and welfare and underpinned vehicle emissions standards aimed at reducing carbon pollution. The repeal also eliminated clean vehicle standards that were projected to deliver the largest reduction in U.S. carbon emissions, save lives, and reduce fuel costs for Americans. The lawsuit argues that the EPA’s rollback is unlawful and contradicts the Supreme Court’s 2007 Massachusetts v. EPA decision, which affirmed greenhouse gases as air pollutants under the Clean Air Act. The plaintiffs contend that the Trump EPA’s actions will increase gas prices, harm the economy, and jeopardize public health by removing critical protections against climate pollution. Sierra Club’s Environmental Law Program Director Joanne Spalding emphasized that the
energyclimate-changeEPAvehicle-emissionsclean-air-standardscarbon-pollutionenvironmental-lawOregon Adopts New Building Codes to Reduce Energy Costs and Increase Energy Efficiency in Newly Constructed Homes - CleanTechnica
Oregon’s Residential and Manufactured Structures Board (RMSB) has approved updates to the state’s residential energy code requiring new homes to be built with energy-efficient heat pumps instead of traditional ducted air conditioning. This change is projected to save homeowners an average of $125 per month, or over $1,700 annually, on energy bills. The update aims to improve comfort, affordability, and resilience in new homes by reducing energy waste and reliance on fossil fuels, aligning with Oregon’s broader goals for clean, reliable, and affordable energy. The new code allows heat pumps to serve as the primary heating source, with methane gas permitted only for supplemental heating to help manage peak grid loads. The update has garnered support from building professionals, elected officials, and environmental organizations like the Sierra Club and Earth Advantage, who emphasize its role in advancing state decarbonization, climate resilience, and housing affordability. The code also brings Oregon’s building standards closer to those of neighboring states California and Washington, reflecting a regional
energyenergy-efficiencyheat-pumpsbuilding-codesresidential-energyclean-energyenergy-savingsGreen NGOs & Renewable Fuel Producers: Commission Must Resist Pressure to Reopen the Rules Governing Renewable Hydrogen - CleanTechnica
The article discusses the recent completion of the EU hydrogen regulatory framework with the entry into force of the Delegated Regulation (EU) 2025/2359, known as the Low-Carbon Fuel Delegated Act. This framework, finalized in 2025, provides essential regulatory certainty for hydrogen producers, offtakers, and investors, which is critical for the successful development and market rollout of renewable hydrogen within the EU. The regulation sets clear rules on additionality, as well as temporal and geographical correlation requirements, which are designed to ensure that hydrogen production aligns with climate goals and grid stability. Green NGOs and renewable fuel producers are urging the European Commission not to yield to recent pressures from some industrial and political actors who want to accelerate the review of these key requirements ahead of the planned 2028 deadline. They warn that weakening or reopening the hydrogen rules prematurely could undermine climate objectives, destabilize the energy grid, and jeopardize the investment certainty needed to build a sustainable hydrogen market. The article emphasizes the importance
energyrenewable-hydrogenEU-hydrogen-policylow-carbon-fuelclimate-goalssustainable-energyhydrogen-marketEngineers build quietest ship propellers to save marine life
German researchers at HAW Kiel have launched the MinKav project, funded by a €390,000 grant from Schleswig-Holstein, to develop quieter ship propellers aimed at reducing underwater noise pollution that disrupts marine life. The project, which began in January 2026 and will run until the end of 2028, focuses on mitigating noise caused by cavitation—a process where vapor bubbles form and violently collapse on propeller blades, generating loud sounds that interfere with marine mammals’ communication, feeding, and mating behaviors. Using advanced tools such as cavitation tunnels, high-speed cameras, and underwater microphones, the team seeks to understand and slow down bubble collapse to reduce noise without compromising ship efficiency or speed. Led by Prof. Jörn Kröger and doctoral researcher Leonie Föhring, the project addresses a critical gap in maritime engineering, where noise reduction has not been a priority despite environmental concerns. Unlike current solutions that often require ships to slow down—resulting in longer travel times and higher costs
energymarine-technologyshipbuildingnoise-reductionenvironmental-protectioncavitationfluid-dynamicsPhotos: BYD Racco’s 100 kW charging and 186-mile range set new standards for small EVs
The BYD Racco is set to launch in Japan this summer as the company’s first electric kei car, aiming to disrupt the traditionally domestic-dominated minicar segment. Designed specifically to meet Japan’s strict kei car regulations, the Racco measures 3,395 mm in length and features a tall, boxy design that maximizes interior space, rivaling popular models like the Honda N-Box. Its cabin adopts BYD’s “ocean aesthetics” with a minimalist, tech-forward interior highlighted by a central floating touchscreen and digital driver cluster, elevating the small EV segment’s appeal. The Racco offers two Blade Battery options: a 20 kWh pack delivering about 180-200 km range and a 30 kWh pack extending up to roughly 186 miles, tailored for urban commuters. It is powered by a single front electric motor optimized for smooth city driving and reportedly supports DC fast charging up to 100 kW, enabling quicker battery replenishment than many competitors. Priced
energyelectric-vehiclesbattery-technologyfast-chargingurban-mobilitysustainable-transportationelectric-kei-carThe Fire Horse Energy Transition & Creative Destruction - CleanTechnica
The article "The Fire Horse Energy Transition & Creative Destruction" from CleanTechnica explores the rapid and disruptive transformation underway in the global energy system, likening it to Joseph Schumpeter’s concept of creative destruction in capitalism. This process involves waves of innovation that dismantle existing capital, reprice assets, and reorganize industries. The current period, symbolized by the Chinese Year of the Fire Horse, is marked by intense speed and disruption, driven by the convergence of physics, cost reductions, and geopolitics. Electrification emerges as a key economic driver, significantly improving energy efficiency—electric drivetrains convert 85-90% of energy into motion compared to 20-25% for internal combustion engines—and reducing primary energy demand by 40-60%, thereby undermining fossil fuel use and associated economic rents. Cost declines in renewable technologies reinforce this shift. Since 2010, utility-scale solar costs have dropped by about 85%, onshore wind by 60%, and lithium
energyclean-energyelectrificationrenewable-energysolar-powerwind-powerbattery-storage4x energy at 482°F: New polymer capacitor targets EVs, data centers
Penn State researchers have developed a novel high-temperature polymer capacitor capable of operating at temperatures up to 482°F (250°C) while storing four times more energy than conventional polymer capacitors. This advancement addresses a critical limitation of existing capacitors, which typically degrade above 212°F (100°C), restricting their use in high-heat environments such as electric vehicles, data centers, aerospace systems, and other demanding applications. Unlike batteries, polymer capacitors provide rapid charge and discharge capabilities essential for stabilizing voltage and delivering sudden power surges, but their performance has been limited by thermal instability. The breakthrough was achieved by creating a polymer alloy from two commercially available high-temperature plastics, PEI and PBPDA, which self-assemble into a stable nanostructure with a high dielectric constant of 13.5—significantly higher than each polymer alone. This nanostructured interface blocks charge leakage at elevated temperatures, enabling both high energy density and thermal tolerance, a combination previously difficult to achieve
energypolymer-capacitorelectric-vehicleshigh-temperature-materialsnanostructuredielectric-materialpower-electronicsThe Hydrogen Workshop Transit Agencies Actually Need - CleanTechnica
The article discusses an upcoming hydrogen bus workshop hosted by CUTRIC and sponsored by Mississauga’s transit agency, MiWay, scheduled for March 20, 2026. The workshop assumes hydrogen buses are inevitable in transit fleets and focuses on preparing agencies for their arrival. However, the author argues that transit agencies actually need a workshop centered on managing the risks and challenges associated with hydrogen buses, rather than promoting their adoption. Key concerns include operational reliability, fiscal risks, staffing strains, and maintaining progress on battery electric bus deployment, which currently dominates the zero-emission bus market globally. Battery electric buses are far more efficient and widely adopted than hydrogen fuel cell buses. Electric buses convert 75-85% of electricity into motion, whereas hydrogen buses have an end-to-wheel efficiency of about 30%, requiring 2.5 to 3 times more electricity per kilometer. This inefficiency leads to higher operating costs, greater infrastructure demands, and increased grid loads. Additionally, hydrogen buses face reliability issues such as
energyhydrogen-fuel-cellsbattery-electric-buseszero-emission-vehiclestransit-agenciesclean-energysustainable-transportationAn Electric Chevy BrightDrop Van For 50% Off? - CleanTechnica
The article contrasts two approaches to electric recreational vehicles (RVs) and cargo vans, highlighting the inefficiencies of a large hybrid electric RV versus smaller, fully electric alternatives. It discusses the 2026 Entegra Electric Class A Motorhome, a hybrid RV priced between $300,000 and $400,000, which combines a limited electric range of about 105 miles with a gas generator extending total range by another 345 miles. Despite being partially electric, the RV still relies heavily on fossil fuels due to its size and weight, raising concerns about its environmental impact and questioning the necessity of such a large vehicle for typical use. In comparison, the article promotes the Chevy BrightDrop 600, a fully electric cargo van with an all-wheel-drive system and a range of 250–272 miles, available for under $50,000. When converted into a DIY RV with added solar panels and battery systems (at an estimated additional cost of $15,000), it offers a more energy-efficient
energyelectric-vehiclesChevy-BrightDrophybrid-vehiclesbattery-technologyelectric-rangesustainable-transportationChina's new battery achieves fire, electricity separation for safer EVs
Chinese battery manufacturer Svolt Energy Technology has introduced the Dragon Armor 3.0 battery, featuring a novel "fire and energy separation" design aimed at enhancing electric vehicle (EV) safety and driving range. This innovation physically separates the electrical terminals from the pressure relief channels, isolating the pathways for electricity from those that vent heat, flames, and gases during battery failure. This separation helps manage thermal runaway—a dangerous chain reaction in lithium-ion batteries that can lead to fire—by directing flames away from the passenger cabin and reducing the risk of fire spreading inside the vehicle. The Dragon Armor 3.0 battery also offers improved performance and capacity, increasing total battery capacity by 7-10% within the same package size, partly due to a five-millimeter increase in cell height. It incorporates semi-solid state battery technology, which raises the self-heating temperature by 8°C, enhancing cold-weather reliability and reducing energy loss during warmup. The design delays thermal runaway escalation by 10%, raises
energybattery-technologyelectric-vehicleslithium-ion-batteriesthermal-runawaybattery-safetyenergy-storage-systemsFord Still Holds A Torch For EVs
The article highlights Ford Motor Company's renewed commitment to electric vehicles (EVs), showcased through a recent media event emphasizing its future-forward EV strategy. Ford is introducing a new mid-sized electric pickup truck designed to be affordable and competitive with gasoline vehicles while offering superior performance and features like bi-directional charging. A key focus is enhancing battery range through aerodynamic improvements inspired by Formula 1 technology, including a sleek cab roofline, smaller side mirrors, and an underbody sheath to reduce drag. These design tweaks could increase the truck’s driving range by up to 15%, with even greater gains at highway speeds. Additionally, Ford is innovating in battery technology by moving away from the traditional "bigger-is-better" approach. The company’s skunkworks team is focused on cutting battery costs and weight while improving range, partly by bringing high-voltage power electronics development in-house following the acquisition of Auto Motive Power. This integration aims to reduce charging times, extend battery life, and lower total ownership costs
energyelectric-vehiclesEV-batteriesbattery-rangeaerodynamicsFordvehicle-electrificationAsia-Pacific Takes The Lead In Global Wind Expansion As The Philippines Moves Into The Investment Spotlight - CleanTechnica
The Asia-Pacific region is rapidly becoming the global leader in wind energy expansion, surpassing its previous status as an emerging market to become a central driver of record installations, new supply chains, and future project pipelines. According to the Global Wind Energy Council (GWEC), the region is expected to add around 150 gigawatts of new wind capacity in 2025, marking the highest annual total ever recorded. While China remains the dominant player in volume, other Asia-Pacific countries, including India and Southeast Asian markets, are accelerating their wind energy development from policy formulation to project execution. This growth is projected to push total global wind installations beyond two terawatts by the end of the decade, underscoring wind power's increasing role in industrial strategy, energy security, and economic development, especially in fast-growing Asian economies with rising electricity demand. Within this regional transformation, the Philippines is emerging as a significant new market for wind energy investment. Historically recognized for its offshore wind potential but hindered by regulatory and
energywind-energyrenewable-energyAsia-Pacificclean-energyoffshore-windenergy-investmentUber Putting $100 Million into EV Charging for Robotaxis - CleanTechnica
Uber is committing $100 million to develop electric vehicle (EV) charging infrastructure specifically for robotaxis, signaling a major push toward supporting autonomous, electric ride-hailing services. The initial investments will focus on key U.S. markets including Los Angeles, the San Francisco Bay Area, and Dallas. This infrastructure is crucial to enable self-driving vehicles to charge autonomously without human intervention, reducing operational costs and improving efficiency. Uber plans to collaborate with multiple robotaxi companies and has entered into “utilization guarantee agreements” with EV charging providers such as EVgo in the U.S. and Electra, Hubber, and Ionity in Europe. Uber’s CEO Dara Khosrowshahi emphasized that self-driving vehicles represent a multitrillion-dollar opportunity for the company, leveraging Uber’s existing platform strengths like global scale and real-time marketplace technology. The investment aligns with Uber’s broader strategic focus on autonomous vehicles and electrification, aiming to unlock the full potential of these technologies for urban mobility. Despite earlier setbacks in
robotenergyelectric-vehiclesEV-charging-infrastructureautonomous-vehiclesrobotaxistransportation-technologyBattle Over Colorado River Water Ends In A Draw - CleanTechnica
The ongoing dispute among the seven U.S. states relying on the Colorado River for drinking water and irrigation has reached an impasse, with the states twice failing to meet federal deadlines to resolve the chronic water shortage. The core problem is that water withdrawals exceed natural replenishment, causing historically low levels in key reservoirs Lake Powell and Lake Mead. Experts estimate that to address the imbalance, the states must collectively reduce water demand by up to four million acre-feet annually—an enormous volume equivalent to covering thousands of football fields with a foot of water. The Colorado River spans seven states and Mexico, supplying roughly 40 million people and irrigating 5.5 million acres of farmland, supporting $1.4 trillion in economic activity and vital ecosystems. Legal disputes complicate negotiations, rooted in historic water rights based on the principle of “first in time, first in right.” Upper basin states (Colorado, Wyoming, Utah, New Mexico) hold longstanding agreements but blame the lower basin states (Arizona, Nevada,
energywater-managementColorado-Riverdroughtirrigationwater-conservationenvironmental-impactUS firm advances nuclear fuel supply for military, next-gen reactors
Centrus Energy has partnered with engineering firm Fluor to significantly expand its uranium enrichment facility in Piketon, Ohio, marking a key effort to rebuild the United States' domestic nuclear fuel supply chain. Fluor will serve as the Engineering, Procurement, and Construction (EPC) contractor, managing design, supply chain, and commissioning of the new enrichment capacity. This expansion aims to end the U.S.'s decade-long reliance on foreign uranium sources, especially from Russia, following the 2013 closure of the last large-scale domestic enrichment plant. The project is part of Centrus’s broader growth strategy, which includes addressing a $2.3 billion backlog of orders for current nuclear reactors and developing 12 metric tons annually of High-Assay, Low-Enriched Uranium (HALEU) for next-generation reactors, supported by a $900 million Department of Energy contract. Additionally, Centrus is investing over $560 million to upgrade its centrifuge manufacturing facility in Oak Ridge, Tennessee, to support
energynuclear-energyuranium-enrichmentnuclear-fuel-supplyadvanced-reactorsenergy-securityCentrus-EnergyBig Tech Says Generative AI Will Save the Planet. It Doesn't Offer Much Proof
The article critically examines claims made by major tech companies, particularly Google, that generative AI will significantly reduce global greenhouse gas emissions—specifically citing Google's assertion that AI could cut emissions by 5 to 10 percent by 2030. This figure, widely publicized and used in policy discussions, traces back to a 2021 Boston Consulting Group (BCG) analysis based largely on the company’s client experience rather than robust scientific data. Despite Google's later admission that AI infrastructure expansion has increased its own emissions, it continues to promote these optimistic estimates without providing detailed evidence or transparent methodology. The piece highlights the broader tension between the rapid growth of energy-intensive AI data centers and the environmental promises made by tech leaders. While executives from companies like Google, OpenAI, and organizations such as the Bezos Earth Fund emphasize AI’s potential as a climate solution, independent analysis reveals a lack of rigorous support for many such claims. Ketan Joshi’s recent report, supported by environmental groups, found that only about
energyartificial-intelligenceclimate-changedata-centerssustainabilitygreenhouse-gas-emissionstech-industryElectric trucks prove megawatt charging works even in subzero cold
European electric truck manufacturers MAN, Scania, and Volvo successfully demonstrated megawatt charging (MCS) technology under subzero conditions at the Kempower MCS Live Winter Days 2026 event in Sweden. Hosted by Finnish fast-charging solutions provider Kempower, the showcase took place at Sweden’s first MCS truck charging hub at Alfredsson Transport, featuring 12 charging points delivering between 400 kW and 1.2 MW. The hub integrates a 2.4 MW grid connection, 2.4 MWh battery storage, and a 400 kW solar array to optimize energy costs and support reliable, high-power charging for heavy-duty electric trucks up to 34 meters long. MAN’s eTGX truck, with a 480 kWh battery and up to 750 kW charging capability, demonstrated adding approximately 217 miles (350 km) of range in a 45-minute charge, highlighting the potential for megawatt charging to reduce downtime and accelerate fleet electrification
energyelectric-trucksmegawatt-chargingEV-charging-infrastructurebattery-storagerenewable-energyfast-chargingFire tornado experiment could transform how we tackle ocean oil spills
Researchers from Texas A&M and UC Berkeley have pioneered the first large-scale experiment using fire whirls—tornado-like spinning flames—to remediate offshore oil spills. This innovative method offers a greener and faster alternative to traditional in-situ fire pools, which burn oil on the water’s surface but produce thick soot and leave behind toxic tar mats. By constructing a 17-foot-tall, three-walled triangular structure to control airflow around a crude-oil-coated pool, the team demonstrated that fire whirls can consume up to 95% of the oil fuel while generating 40% less soot. The vortex effect acts like a natural turbocharger, drawing in oxygen to vaporize the oil more completely and rapidly. The fire whirl technique significantly reduces atmospheric pollution and toxic residue, transforming oil spill cleanup into a rapid “search-and-destroy” operation that can prevent oil from reaching sensitive marine habitats. Fire whirls burn oil nearly twice as fast as conventional fire pools, offering faster response times for emergency crews.
energyoil-spill-cleanupfire-whirlenvironmental-technologypollution-reductionsustainable-energyoffshore-oil-spillCanada: Human urine turned into electricity using microbial fuel cells
Researchers at McGill University in Canada have developed an optimized process using Microbial Fuel Cells (MFCs) to convert human urine into electricity while simultaneously treating wastewater. MFCs are bioelectrochemical devices that utilize microorganisms to oxidize organic matter, generating electricity as a byproduct. The team, led by Professor Vijaya Raghavan, investigated how varying concentrations of urine affect the electrochemical performance, pollutant removal efficiency, and microbial community dynamics within MFCs. Their experiments with synthetic wastewater mixed with urine at concentrations of 20%, 50%, and 70% demonstrated that higher urine concentrations enhanced energy production due to the presence of essential ions and organic compounds that stimulate microbial activity. The study also revealed shifts in dominant bacterial species depending on urine concentration: Sediminibacterium prevailed at lower concentrations (up to 50%), while Comamonas dominated at higher concentrations, influencing electricity generation and system function. These findings fill a knowledge gap regarding the biological and electrochemical behavior of M
energymicrobial-fuel-cellsrenewable-energywastewater-treatmentbioelectrochemical-deviceselectricity-generationsustainable-energyVolkswagen Launches The All-New Caravelle PHEV In South Africa - CleanTechnica
Volkswagen has announced the launch of the all-new Caravelle plug-in hybrid electric vehicle (PHEV) in South Africa, set to arrive mid-2026. The Caravelle PHEV, built on Volkswagen Group’s MQB platform, offers seating for up to seven passengers and features an advanced electric all-wheel-drive system with one electric motor on each axle. It is equipped with a 19.7 kWh battery pack capable of fast charging, enabling a purely electric driving range of up to 91 kilometers (57 miles). The vehicle supports AC charging up to 11 kW and DC rapid charging up to 50 kW, allowing the battery to charge from 10% to 80% in approximately 26 minutes. This launch comes amid a significant shift in South Africa’s automotive market, where sales of plug-in hybrids surged by 280% in 2025 compared to 2024, reaching 2,808 units sold, though still representing a small market
energyplug-in-hybridelectric-vehicleVolkswagen-Caravellebattery-technologyautomotive-innovationSouth-Africa-marketHeron Power raises $140M to ramp production of grid-altering tech
Heron Power, a startup founded by former Tesla executive Drew Baglino, has raised $140 million in a Series B funding round to accelerate production of its solid-state transformers, branded as Heron Link. These transformers are designed to replace traditional iron-core transformers in data centers and the electrical grid, offering advantages such as smaller size, higher efficiency, and intelligent power management. The funding round was led by Andreessen Horowitz’s American Dynamism Fund and Breakthrough Energy Ventures, with participation from several other investors. The company plans to build a factory capable of producing 40 gigawatts of transformers annually, aiming to start pilot production in early 2027 and scale up over the next two years. Heron Power’s solid-state transformers address key challenges faced by data centers by converting medium voltage electricity to the 800-volt power required by modern server racks, handling up to 5 megawatts each. Their modular design allows for quick replacement of faulty components, reducing downtime compared to traditional transformers
energysolid-state-transformersdata-centerspower-conversiongrid-technologyrenewable-energylithium-ion-batteriesHalf-ton magnet aces world-first 1.8 million°F fusion plasma confinement
New Zealand-based fusion startup OpenStar Technologies has achieved a significant milestone by successfully confining plasma heated to over 1,000,000 degrees Celsius using a 0.5-tonne superconducting magnet levitated inside a 5-meter vacuum chamber. Their $10 million prototype, named “Junior,” demonstrated the viability of their unique levitated dipole reactor architecture, which differs from conventional tokamak designs by placing a single superconducting magnet inside the plasma cloud. This internal magnet levitation eliminates mechanical supports that typically cause heat loss and plasma instability, thereby enhancing plasma stability and confinement—key factors for sustained nuclear fusion. The levitated dipole configuration mimics magnetic structures found around planets like Jupiter and offers potential advantages in creating more compact and cost-effective fusion reactors. While the current prototype does not yet produce net energy gain, the successful levitation and magnetic field generation mark critical progress toward scaling the technology for commercial fusion energy. OpenStar Technologies views this demonstration as a proof of concept that integrates magnetics,
energynuclear-fusionsuperconducting-magnetplasma-confinementlevitated-dipolefusion-reactorclean-energyCompressorless German hydrogen turbine sets 303-second runtime record
Researchers at the Karlsruhe Institute of Technology (KIT) in Germany have developed a compressorless hydrogen gas turbine that set a new runtime record of 303 seconds, surpassing NASA’s previous record of 250 seconds. Unlike conventional gas turbines that rely on mechanical compressors to pressurize air—consuming about 50% of the generated power—this turbine uses pressure gain combustion, which employs detonation waves to generate high pressure without compressors. This design reduces moving parts and improves efficiency, enabling more electrical output from the same fuel input. The KIT team successfully generated electricity directly from the turbine during the record run, marking a significant milestone given the challenges of stable energy transfer amid rapid combustion processes. The turbine primarily uses hydrogen fuel due to its fast reaction times and potential for sustainable production via renewable energy, aligning with global efforts to replace fossil fuels and reduce carbon emissions. The researchers plan to showcase their compressorless turbine at the Hannover Messe in April 2026, highlighting its potential for highly efficient, flexible, and
energyhydrogen-turbinecompressorless-turbinerenewable-energysustainable-fuelpower-generationclimate-changeUS military satellites to spy on adversary spacecraft at 6-mile range
The U.S. Department of Defense, through the Defense Innovation Unit (DIU), has issued a solicitation for low-cost commercial surveillance satellites under the Geosynchronous High-Resolution Optical Space-Based Tactical Reconnaissance (Ghost Recon) project. This initiative aims to close a critical gap in the Pentagon’s ability to monitor space by acquiring satellites capable of high-resolution space-to-space imagery and close-range inspections of other satellites, particularly in geosynchronous orbit (GEO). The satellites are expected to be launched within two years of contract signing, become government-owned within three years, and perform frequent reconnaissance missions—at least one per week—within four years. The Ghost Recon satellites must be capable of maneuvering within 10 kilometers of target satellites, including uncooperative ones that may attempt to evade surveillance, and adjust their position to optimize solar lighting for imaging. These capabilities will enhance the U.S. military’s ability to characterize resident space objects (RSOs), conduct battle damage assessments, and achieve positive and
energysatellite-technologyspace-surveillancereconnaissance-satellitesdefense-technologyspace-based-imagingmilitary-technologyDG Matrix raises $60M to make data center power smarter
DG Matrix, a startup focused on modernizing data center power infrastructure, has raised $60 million in a Series A funding round led by Engine Ventures with participation from ABB, Cerberus Ventures, Chevron Technology Ventures, and others. The company develops solid-state transformers, specifically its Interport device, which acts as a power router capable of handling up to 2.4 megawatts. This technology enables integration of diverse power sources such as solar panels and grid-scale batteries, potentially replacing bulky, inefficient traditional transformers and uninterruptible power supplies (UPS) in data centers. The Interport device significantly reduces the physical footprint of power conversion equipment—from large skids to a compact four-by-four-foot unit—while improving efficiency from 82-90% to 95-98% and enhancing reliability by using fewer components. DG Matrix is currently deploying initial units to customers, primarily targeting data centers, which make up about 90% of its business pipeline, with the remainder focused on electric vehicle fleet charging
energydata-centerssolid-state-transformerspower-managementrenewable-energymicrogridsenergy-efficiency7 automakers betting big on sodium-ion batteries for budget EVs
Several automakers in China and Europe are increasingly adopting sodium-ion battery technology for budget electric vehicles (EVs), particularly city cars, minicars, and fleet vehicles. This shift marks sodium-ion batteries’ transition from experimental stages to practical, mass-market solutions. While lithium-ion batteries remain dominant, sodium-ion chemistry is gaining traction due to its cost advantages, as sodium is more abundant and less expensive than lithium, cobalt, or nickel. Sodium-ion battery packs are estimated to be 20-40% cheaper than lithium iron phosphate batteries at scale, though they have lower energy density, making them better suited for compact and urban vehicles rather than long-range SUVs. Additionally, sodium-ion batteries perform well in low temperatures and offer strong safety features, enhancing their appeal for entry-level EVs and urban fleets. Key players investing in sodium-ion technology include BYD, which plans to offer both sodium-ion and lithium iron phosphate versions of its Seagull micro-hatchback to maintain affordability amid lithium price fluctuations. CATL
energyelectric-vehiclessodium-ion-batteriesbattery-technologyEV-affordabilitylithium-ion-alternativeautomotive-innovationSierra Club & SW Detroiters Celebrate $100M Penalty, Clean Air Wins in EES Coke Ruling - CleanTechnica
A federal court ruled against DTE Energy and its subsidiary EES Coke for violating the Clean Air Act by allowing their Zug Island facility near Detroit to emit thousands of tons of sulfur dioxide, contributing to severe health issues including asthma, Alzheimer’s, heart attacks, and approximately 98 early deaths between 2019 and 2022. The court ordered the companies to pay a $100 million civil penalty to the U.S. Treasury and an additional $20 million to fund community health and air quality improvement projects. Furthermore, DTE and EES Coke must re-apply for the facility’s operating permit with Michigan’s environmental agency, which is expected to require updated pollution controls. The Sierra Club, represented by Earthjustice and the Great Lakes Environmental Law Center, intervened in the lawsuit alongside local residents from Southwest Detroit and River Rouge, communities heavily impacted by pollution. The court also mandated the creation of a Community Quality Action Committee, composed of residents and environmental advocates, to oversee the allocation of the $20 million
energyenvironmental-justiceair-pollutionclean-air-actDTE-Energysulfur-dioxide-emissionscommunity-health-projectsEnvironmental Groups Sue DOE Over Approval of CP2 LNG Export Application - CleanTechnica
Environmental groups, including the Sierra Club, NRDC, and Earthjustice, have filed a lawsuit challenging the U.S. Department of Energy’s (DOE) approval of Venture Global’s CP2 liquefied natural gas (LNG) export facility under construction in Louisiana. The lawsuit argues that the DOE’s approval was unlawful due to an inadequate analysis of the project’s impact on domestic energy prices, failure to consider lifecycle greenhouse gas emissions, and lack of proper environmental review. The groups contend that the project will increase climate-warming pollution without lowering energy costs for Americans, and that the DOE improperly used a regulatory loophole to avoid assessing the health and environmental consequences. The CP2 LNG export terminal, if completed, would be one of the largest in the nation, exporting 20 million metric tons of LNG annually, with significant associated methane emissions. Opponents highlight that the project will exacerbate fossil fuel dependence, raise domestic energy prices amid rising demand, and harm local communities already affected by construction impacts.
energyLNGDepartment-of-Energyenvironmental-impactgreenhouse-gas-emissionsfossil-fuelsenergy-policyFord Hypes "Bounty" Culture and UEV Platform - CleanTechnica
The article from CleanTechnica discusses Ford's evolving approach to electric vehicles (EVs), highlighting the company's past struggles and current ambitions. Initially, Ford's early EV efforts, such as the Fusion Electric and plug-in hybrids like the C-Max Energi and Fusion Energi, were seen as weak attempts that did not fully leverage EV advantages. Despite some sales success, these models had small batteries and limited innovation. Ford later made a more serious push with the Mustang Mach-E and F-150 Lightning, developing EVs from the ground up rather than adapting gas models. However, these vehicles were still not efficient or competitive enough to dominate sales, and shifting U.S. policies under the Trump administration led Ford to scale back its EV plans significantly. Ford is now focused on creating a highly efficient and lightweight Universal Electric Vehicle (UEV) platform to compete globally, including against Chinese EV makers. Alan Clarke, Ford’s executive director of Advanced EV Development, emphasizes the need to reduce battery size to lower costs and
energyelectric-vehiclesEV-platformbattery-technologyFord-Mustang-Mach-EF-150-Lightningvehicle-efficiencyTo Chinese Clean Tech Companies: 恭喜發財 - CleanTechnica
The article from CleanTechnica marks the celebration of Chinese New Year (Lunar New Year) on February 17, highlighting its extended festivities, including public school closures and multiple events in New York City. It emphasizes the traditional greeting 恭喜發財 (Gong Xi Fa Cai), which wishes prosperity and happiness, reflecting a broader sentiment of inclusive goodwill. The article connects this cultural celebration to the clean technology sector, noting that the financial savings and improved user experience from electric vehicles (EVs) and clean tech contribute to greater prosperity and happiness for consumers. Additionally, the article references the Year of the Fire Horse, symbolizing energy, boldness, and accelerated progress, framing it as a time for breakthroughs and transformative change. This symbolism is used to inspire optimism for the clean technology industry, hoping for a year marked by bold advancements and increased adoption of sustainable solutions. The author also extends wishes for safe and cleaner travel during the holiday, aligning the themes of the celebration with the goals of environmental progress
energyclean-technologyEVsrenewable-energysustainabilityclean-tech-adoptionenergy-transformationMeta signs multiyear NVIDIA deal to power next-gen AI data centers
Meta and NVIDIA have entered a multiyear, multigenerational partnership to develop hyperscale AI infrastructure across Meta’s on-premises data centers and cloud environments. This collaboration involves deploying large volumes of NVIDIA CPUs—including Arm-based Grace and future Vera processors—and millions of Blackwell and Rubin GPUs to scale AI training and inference systems that power Meta’s global platforms. The partnership emphasizes deep codesign across compute, networking, and software, integrating NVIDIA Spectrum-X Ethernet switches into Meta’s Facebook Open Switching System to enhance network efficiency and throughput for AI clusters. The goal is to build data centers optimized for training large frontier AI models and running inference at scale, supporting personalization and recommendation systems used by billions of Meta users. The deal also focuses on improving energy efficiency and performance per watt, with Meta undertaking the first large-scale rollout of Grace CPUs and planning potential large-scale adoption of Vera CPUs by 2027. Meta will deploy NVIDIA GB300-based systems and unify its architecture across data centers and NVIDIA Cloud Partner environments to
energyAI-infrastructuredata-centersNVIDIA-GPUsenergy-efficiencynetworking-technologyArm-CPUsNo, Claude Is Not Conscious - CleanTechnica
The article from CleanTechnica critiques the current hype surrounding artificial intelligence (AI), particularly addressing misconceptions about AI consciousness. It highlights the significant environmental impact of AI development, noting that massive data centers powering AI consume large amounts of electricity, much of which comes from polluting sources, thereby exacerbating global heating emissions. Despite the heavy investment and media attention, the author argues that much of the output from AI systems is often inaccurate or misleading, yet people tend to accept AI-generated responses without verification. A central point of contention is the notion promoted by some in the AI field that AI systems, like Anthropic’s Claude chatbot, might be or become conscious. The article strongly rejects this idea, emphasizing that AI is not a living organism and that generating coherent responses does not equate to consciousness. It references statements from Anthropic’s CEO Dario Amodei, who ambiguously entertains the possibility of AI consciousness, which the author finds both unconvincing and frustrating. The article concludes with a call
energyartificial-intelligencedata-centerselectricity-consumptionglobal-warmingAI-technologypower-plantsFord turns to F1 and bounties to build a $30,000 electric truck
Ford plans to launch an affordable electric truck next year starting at $30,000, aiming to compete with Chinese automakers while maintaining profit margins. This initiative follows Ford’s discontinuation of the battery-electric F-150 Lightning and reflects a strategic pivot toward a new line of EVs built on a universal electric vehicle platform (UEV). The UEV, Ford’s first ground-up EV platform, will initially underpin a mid-sized truck and later support various vehicle types including sedans, SUVs, and commercial vans. Key innovations include the use of single-piece aluminum unicastings to reduce parts and speed assembly, lithium iron phosphate batteries licensed from China’s CATL, and a revamped production system designed to increase manufacturing speed by 15%. To achieve cost efficiency and performance, Ford assembled a team drawing talent from Formula 1, Apple, Lucid Motors, Rivian, Tesla, and a recent startup acquisition. This team employs a bounty program that assigns numerical efficiency metrics to every vehicle aspect, encouraging design decisions
energyelectric-vehiclesEV-manufacturinglithium-iron-phosphate-batteriesautomotive-materialsFord-electric-truckvehicle-efficiencyB.C. 2026 budget sends mixed signals regarding its economic future but keeps important programs for households - Clean Energy Canada
The B.C. 2026 budget presents a mixed economic outlook, balancing progress in clean energy with continued reliance on traditional industries. Clean Energy Canada highlights that the budget makes significant strides by emphasizing clean electricity, including over $6 billion in projects and plans for increased power capacity by 2028. The introduction of a $400 million Strategic Investment Fund aims to support emerging clean economy sectors and leverage federal investments, though there is concern that this fund might instead subsidize established, polluting industries. Notably, the budget still heavily features liquefied natural gas (LNG) projects despite their uncertain future, while giving limited attention to transformative sectors like critical minerals and electrification. On the household front, the budget maintains important programs for low- and moderate-income families, such as funding for heat pumps and public electric vehicle (EV) charging infrastructure. However, Clean Energy Canada urges the government to adopt additional no-cost measures to accelerate clean energy adoption and reduce costs for residents. These include implementing stricter efficiency
energyclean-energyclean-electricityelectrificationEV-chargingenergy-efficiencyclean-economyAI-driven nuclear push targets 2x faster builds, 50% lower costs
The Idaho National Laboratory (INL) and NVIDIA have partnered to leverage artificial intelligence (AI) to accelerate the deployment of advanced nuclear reactors in the U.S., aiming to halve development timelines and reduce operational costs by over 50%. This collaboration, part of the Department of Energy’s Genesis Mission, focuses on creating a scientific computing platform to drive energy innovation and national security. The initiative, codenamed Prometheus, employs AI tools—including generative AI models, digital twins, and agent-based workflows—to streamline the design, licensing, manufacturing, construction, and operation of nuclear reactors. By automating traditionally time-consuming engineering processes while maintaining human oversight, the partnership expects to at least double the speed of nuclear reactor deployment. Central to the effort is the use of digital twins trained on decades of nuclear data and experimental operations at INL, enabling simulation and validation of reactor systems before physical construction. NVIDIA contributes its AI infrastructure and GPU-accelerated computing to enhance nuclear simulation codes, reducing computation times and expanding modeling
energynuclear-energyartificial-intelligenceadvanced-reactorsdigital-twinsAI-infrastructureenergy-innovationClimactic launches hybrid fund to get startups through the ‘valley of death’
The article discusses a new initiative called Material Scale, launched by Josh Felser, co-founder of the venture firm Climactic, aimed at helping climate tech startups—particularly those producing novel materials—overcome the challenging "valley of death" phase. This phase occurs after startups have developed prototypes but struggle to scale production and secure enough sales to sustain growth. Unlike software companies that can scale rapidly with cloud services and often operate at negative margins initially, materials startups face skepticism from markets about their ability to scale without guaranteed customers. Material Scale addresses this by creating a hybrid debt-equity investment vehicle that leverages purchase orders from established buyers to fund startups’ production costs with minimal equity dilution. Material Scale’s initial focus is on climate tech startups in the apparel industry, with Ralph Lauren joining as a buyer for the platform’s launch. The model involves buyers committing funds to cover material costs at market price, while Material Scale provides the remaining capital through loans and warrants. This simultaneous deal structure between buyers, Material Scale,
energymaterialsclimate-techstartupsinvestmenthybrid-fundscaling-productionX-Energy is building a Gen IV reactor it claims can't melt down
X-energy, a Maryland-based company, is developing the Xe-100, a Generation IV pebble-bed, high-temperature gas-cooled nuclear reactor designed to be meltdown-proof. Unlike conventional reactors that use long fuel rods submerged in water, the Xe-100’s core contains thousands of graphite spheres ("pebbles") filled with TRISO fuel particles—uranium kernels coated with multiple ceramic and carbon layers that trap radioactive materials even at extreme temperatures. This design allows the reactor to operate safely near urban or industrial areas and eliminates the need for active cooling systems, as spent fuel can be stored on-site in dry casks without interim cooling. The Xe-100 uses helium gas as a coolant, which is chemically inert and does not become radioactive, avoiding the instability risks associated with water-based cooling systems. The reactor dissipates heat passively through conduction and convection, maintaining fuel integrity even if helium coolant is lost. Each 80 MWe module is fully modular and can be scaled up to a 320 M
energynuclear-energyGeneration-IV-reactorpebble-bed-reactorTRISO-fuelnuclear-safetymodular-reactorNew Jersey Promotes Solar To Lower Utility Bills - CleanTechnica
The article discusses New Jersey’s efforts to reduce rising utility bills, which have increased nearly 30% over the past two years, by promoting residential solar energy adoption. Newly elected Governor Mikie Sherrill is continuing initiatives started under former Governor Phil Murphy aimed at streamlining the solar permitting process, which currently adds $3,000 to $5,000 in costs and significant delays that discourage many potential solar adopters. New Jersey ranks third slowest in the U.S. for residential solar permitting, with complex, multi-departmental reviews and outdated procedures creating barriers for residents and installers. Implementing smart solar permitting, as seen in states like California and Maryland, could accelerate approvals, reduce staff time, and potentially lead to an additional 200,000 residential solar installations by 2040, benefiting both consumers and the electric grid. Governor Sherrill has made addressing high electricity costs a priority, signing executive orders to declare a state of emergency and expedite solar and energy storage deployment while modernizing methane
energysolar-energysmart-permittingrenewable-energyenergy-policyenergy-storageelectricity-billsWill The MiBot Work In Amsterdam? Here's A Biased Comparison - CleanTechnica
The article discusses the introduction of Japan’s MiBot, an ultra-compact, single-seat micro-EV, and explores its potential fit within Amsterdam’s urban mobility landscape, particularly in comparison to the Dutch Waaijenberg Canta microcar. The MiBot, delivered to its first customer in late 2025 with production ramping up in 2026, is designed as an affordable urban commuter vehicle with about 100 km range, a top speed near 60 km/h, and a target price around US$7,000. Unlike the Canta, which is a two-seater designed primarily for accessibility and operates under a legally protected Dutch category allowing use of bicycle paths and relaxed licensing, the MiBot is positioned as a radically downsized vehicle for general urban mobility rather than as a disability aid. The article further explains the distinction in Japan between kei cars and gentsuki minicars, two small vehicle categories with very different regulatory and functional profiles. Kei cars are fully certified automobiles with standard safety
energyelectric-vehiclesmicro-EVurban-mobilitymicrocarsustainable-transportationelectric-microcarVinFast: From California Dreaming To Midwest Reality - CleanTechnica
The article "VinFast: From California Dreaming To Midwest Reality" highlights the Vietnamese automaker VinFast’s strategic shift in its U.S. market approach, as observed at the 2026 Chicago Auto Show. After facing challenges in California due to software and quality issues, VinFast has moved away from flashy, large-scale presentations toward a more pragmatic, community-focused presence, particularly in the American Midwest. Instead of expansive showrooms, the company now emphasizes direct consumer engagement through test drives and local dealership partnerships, aiming to build trust with buyers who prioritize reliability and practical experience over hype. VinFast’s streamlined booth at the Chicago event functioned more like a tactical command center, underscoring a shift from “California Dreamin” to “Midwest Reality.” This approach also includes diversifying its product ecosystem, as seen with the introduction of the DrgnFly electric bike, which offers a lower-commitment entry point for consumers hesitant about full vehicle electrification. Despite delays in opening its North Carolina
energyelectric-vehiclesVinFastmobilityelectric-bikeEV-marketautomotive-industryThe US Can Still Make Tidal Energy Happen
The article "The US Can Still Make Tidal Energy Happen" highlights the renewed interest and potential for tidal energy as a reliable, carbon-free power source in the United States. Historically used for over 1,500 years, tidal energy had been overshadowed by fossil fuels but is now gaining attention amid the global decarbonization movement. The U.S. federal government, despite a 2025 energy emergency declaration that favored certain renewables like wind and solar less, has included tidal energy within its broader support for reliable, dispatchable clean energy sources such as hydropower, biomass, and geothermal. The Department of Energy emphasizes that even capturing a fraction of the U.S.'s vast marine energy potential could significantly contribute to the nation’s electricity needs and provide clean, local power. While other countries like the UK are advancing rapidly in tidal energy development, the U.S. has been slower to commercialize this resource. Notable projects include Washington State’s OPALCO demonstration using technology from Scotland
energytidal-energyrenewable-energymarine-energyclean-energyUS-energy-policyenergy-innovationElectricity Prices Decreased In South Australia Because Of Clean Renewables - CleanTechnica
The article highlights South Australia's significant progress in renewable energy adoption, noting that in the last quarter of 2025, 84% of its electricity was generated from solar and wind power—the highest share of any major grid worldwide. The state aims to reach 100% renewable electricity by the end of the following year. This shift to renewables has contributed to a 30% drop in average wholesale electricity prices in South Australia compared to the previous year, making it one of the cheapest regions in Australia alongside Victoria, which also has a high share of wind and solar power. The article challenges common misconceptions that renewable energy is more expensive than fossil fuels, emphasizing that renewables actually reduce electricity costs and avoid many hidden expenses associated with fossil fuels. These include billions in climate change-related damages, health costs from air pollution causing thousands of premature deaths annually in Australia, and economic instability due to volatile fossil fuel prices—such as a 500% rise in gas prices following geopolitical events like the Russian invasion of Ukraine.
energyrenewable-energysolar-powerwind-powerelectricity-pricesclean-energySouth-AustraliaCan We Dare To Be Hopeful About Clean Energy? - CleanTechnica
The article "Can We Dare To Be Hopeful About Clean Energy?" from CleanTechnica presents a nuanced view of the current state and future prospects of clean energy, particularly in the context of US policy and global trends. It highlights the contrast between the US federal government's stance under former President Donald Trump—who rejected international climate cooperation, expanded fossil fuel production, and hindered renewable projects—and the broader global momentum toward renewables. Despite Trump's efforts to promote fossil fuels and suppress clean energy initiatives, renewable energy continues to grow faster than fossil fuels worldwide, with the International Energy Agency suggesting oil demand may peak around 2030. The article also notes that sustainable finance is gaining traction, with banks generating more revenue from climate-focused financing than from fossil fuels, signaling a shift toward decarbonization technologies. Internationally, the article points to successful examples like South Australia, where renewables supplied 74% of electricity consumption in 2024 and are projected to reach 100% by 2027, resulting
energyclean-energyrenewable-energyfossil-fuelsclimate-changesustainable-financewind-powerRolls-Royce's new hybrid engine could reduce aviation emissions by 30%
Rolls-Royce, in collaboration with the Norwegian research organization SINTEF, is developing a hybrid aircraft engine that combines electric motors with traditional combustion engines to reduce aviation emissions by up to 30%, particularly for domestic short-haul flights. This hybrid technology aims to replicate the success of hybrid cars by using both electricity and fuel to lower CO2 output while maintaining reliability. A key technical challenge involves creating effective electrical insulation for the engine’s stator, which must withstand high voltages and frequencies (up to 50 kHz) without compromising lifespan or safety—standards that currently do not exist in the aviation industry. The initiative is part of broader efforts to reduce the aviation sector’s environmental impact, which accounts for about 4% of the EU’s total emissions. SINTEF estimates that hybrid aircraft could cut the EU’s CO2 emissions by around 1%. The focus on short domestic routes, such as Trondheim-Oslo, is due to the weight limitations of batteries compared to fuel
energyhybrid-engineaviation-emissionselectric-motorinsulation-materialsCO2-reductionRolls-RoyceHelp Us Get Over The Line On Kickstarter! - CleanTechnica
The article is a call to support CleanTechnica’s ongoing Kickstarter campaign, which has only a few days left and needs additional contributions to reach its goal. Supporters can choose from various rewards such as themed apparel (t-shirts, hoodies, mugs, tote bags) with slogans like "Smash The Oiligarchy" and "Keep Calm And Charge On," as well as a new book titled *Outta Gas*, praised for its insightful coverage of the climate crisis. Other rewards include promotional opportunities for cleantech or sustainability projects and licenses to host Electric Home Shows with CleanTechnica’s support. CleanTechnica encourages readers to back their work either through the Kickstarter campaign, Substack subscriptions, or direct payments via Stripe. The article also highlights the expertise of Zachary Shahan, CleanTechnica’s director and chief editor, who is recognized internationally for his knowledge in electric vehicles, solar energy, and energy storage. Overall, the piece serves as both a fundraising appeal and a reminder of Clean
energyrenewable-energycleantechelectric-vehiclesenergy-storagesustainabilityclimate-crisisChina outpaces US in nuclear submarine launches over past five years
A recent report by the International Institute for Strategic Studies (IISS) reveals that China has surpassed the United States in launching nuclear-powered submarines over the past five years (2021–2025). China launched 10 nuclear submarines totaling about 79,000 metric tons, compared to the US’s seven submarines totaling 55,500 metric tons during the same period. This marks a significant shift from 2016–2020, when the US led in both numbers and displacement. Despite this surge, the US still maintains a substantial advantage in active submarines, operating 65 nuclear-powered boats versus China’s 12, alongside 46 conventional submarines. China’s expansion of the Huludao shipyard has been key to this growth, enabling production of ballistic missile submarines that enhance its nuclear triad, as well as guided missile submarines equipped with advanced vertical launch systems. The report also highlights challenges facing US submarine production, including delays in Virginia-class attack submarines and the Columbia
energynuclear-powersubmarinesnaval-technologymilitary-technologyshipbuildingpropulsion-systemsGermany clears 99% radioactivity as nuclear fuel leaves Brokdorf site
The Brokdorf nuclear power plant in Germany has reached a significant milestone in its decommissioning process with the removal of the last CASTOR cask containing spent nuclear fuel. Operated by PreussenElektra, the company responsible for the shutdown, the site is now 99 percent free of radioactivity. The plant, which housed a 1,410 MWe pressurized water reactor, was shut down on December 31, 2021, and since 2023, 764 fuel assemblies have been carefully extracted and transferred to an interim storage facility. This removal of the radioactive core is a critical step that enables further dismantling activities. Following the fuel removal, the plant can begin shutting down additional systems and reduce operational staff, whose expertise will be redirected to dismantling the reactor pressure vessel internals, scheduled to start in spring 2025. Preparations include clearing the spent fuel area to create necessary storage and handling zones and constructing a transport preparation hall, which requires official permits before
energynuclear-powerdecommissioningradioactive-wastenuclear-fuelBrokdorf-nuclear-plantenergy-transitionIndia bids to attract over $200B in AI infrastructure investment by 2028
India aims to attract over $200 billion in artificial intelligence (AI) infrastructure investment by 2028, positioning itself as a global hub for AI computing and applications. Announced by IT Minister Ashwini Vaishnaw at the government-backed AI Impact Summit in New Delhi, the initiative includes tax incentives, state-backed venture capital, and policy support to draw more global AI value chain activities to the country. Major U.S. tech firms like Amazon, Google, and Microsoft have already committed about $70 billion to expand AI and cloud infrastructure in India, providing a strong foundation for further investment. The government’s efforts also feature long-term tax relief for export-oriented cloud services and a ₹100 billion ($1.1 billion) venture program targeting high-risk sectors such as AI and advanced manufacturing. India plans to expand its shared AI compute capacity under the IndiaAI Mission by adding 20,000 GPUs to the existing 38,000, with a second phase focusing on research, innovation, and broader access to
energyAI-infrastructuredata-centerscloud-computinginvestmenttechnology-policyadvanced-manufacturingTesla's Change in Market Share in 13 European Countries - CleanTechnica
The article from CleanTechnica analyzes Tesla's market share trends in the pure electric vehicle (EV) segment across 13 European countries during January of 2024, 2025, and 2026. The key finding is a consistent decline in Tesla’s share of the EV market in most countries over this period. For example, Tesla’s market share in the UK dropped from 7.6% in January 2024 to 2.5% in January 2026, and in Norway from 21.6% to 2.9%. Similar downward trends were observed in countries like the Netherlands, Germany, Denmark, and Portugal. Out of the 13 countries examined, 11 showed a lower Tesla market share in January 2026 compared to January 2024, indicating a broad and significant market share erosion. The article emphasizes that this decline is not simply due to seasonal fluctuations or an overall downturn in EV sales, as the comparison is made between the same month across consecutive
energyelectric-vehiclesTeslamarket-shareEuropeclean-energyEV-sales-trendsAdani pledges $100B to build AI data centers as India seeks bigger role in the global AI race
The Adani Group has announced a $100 billion investment over the next decade to build AI-specialized data centers across India, signaling the country’s intent to become a significant player in the global AI infrastructure race. These data centers will be powered by renewable energy and are expected to catalyze an additional $150 billion in related investments, creating a $250 billion AI infrastructure ecosystem by 2035. The initiative aligns with India’s expanding digital economy and renewable energy capacity, positioning the nation as an attractive destination for AI infrastructure development. Adani plans to leverage its existing data-center platform and partnerships with global tech giants like Google and Microsoft, with large-scale campuses already underway in Visakhapatnam and Noida, and future projects planned for Hyderabad and Pune. Central to Adani’s strategy is the integration of renewable energy, with the company’s 30-gigawatt Khavda renewable project supplying carbon-neutral power to the data centers. The group also intends to invest $55 billion in expanding renewable
energydata-centersAI-infrastructurerenewable-energybattery-storageIndiaAdani-GroupNew additive helps solar cells retain 93% power-conversion efficiency
Researchers at Penn State University have discovered that adding the chemical additive 9,10-phenanthrenequinone (PQ) significantly enhances the stability and efficiency of organic solar cells, potentially making them viable for large-scale manufacturing and deployment. Unlike traditional silicon solar panels, which require energy-intensive production and toxic chemicals, organic photovoltaics are more environmentally friendly but typically suffer from short lifespans and rapid efficiency degradation. The study, led by Assistant Professor Nutifafa Doumon and doctoral candidate Souk Yoon “John” Kim, demonstrated that PQ, a low-cost and safer hydrocarbon derivative, helps organic solar cells retain over 93% of their original power conversion efficiency after 180 hours of sustained heat exposure—substantially outperforming commonly used toxic additives that retain only about 76%. The research involved testing organic cells with various structures and additives under different environmental conditions to assess longevity, resilience, and efficiency. PQ was incorporated into the active layer of the cells, which absorbs sunlight, resulting in
energysolar-cellsorganic-photovoltaicsmaterials-scienceadditive-manufacturingpower-conversion-efficiencysustainable-energyWorld’s largest electric ship hits safety milestone ahead of launch
The Hull 096, currently under construction by Australian shipbuilder Incat, is set to become the world’s largest battery-electric ship when it enters service in 2026. This 130-meter roll-on/roll-off passenger catamaran ferry is powered entirely by electricity, carrying 250 tons of batteries with a combined capacity of 40 megawatts—equivalent to powering nearly 500 Tesla electric vehicles. The vessel can transport 225 vehicles and 2,100 passengers, propelled by eight Wärtsilä waterjets that enable a top speed of 29 mph (46 kph). It marks a significant milestone in maritime transport as the largest battery-EV ship ever built, shifting from an original plan to use liquefied natural gas to full battery-electric propulsion. A key safety milestone was recently achieved with the successful deployment of the Marine Evacuation System (MES) supplied by Liferaft Systems Australia. Six 22-meter MES units, supported by 13 linked life rafts
energyelectric-shipbattery-electric-ferrymaritime-transportrenewable-energyelectric-propulsionmarine-evacuation-systemOxford imaging technique could improve EV battery charging and life
Researchers at the University of Oxford have developed a novel staining technique that enables visualization of polymer binders in the negative electrodes (anodes) of lithium-ion batteries. These binders, which constitute less than 5% of the electrode by weight, are crucial for maintaining electrode integrity, electrical and ionic conductivity, and mechanical stability but have been difficult to image due to their small quantity and lack of distinct features. By tagging cellulose- and latex-derived binders with traceable silver and bromine markers, the team used X-ray spectroscopy and electron microscopy to reveal the binders' distribution at nanoscale resolution, providing new insights into their behavior during electrode manufacturing. This innovative imaging method allowed the researchers to identify how subtle variations in binder distribution significantly impact battery performance. For example, optimizing slurry mixing and drying protocols reduced internal ionic resistance by up to 40%, addressing a key limitation to fast-charging capabilities. The study also uncovered that thin carboxymethyl cellulose (CMC) binder layers intended as uniform coatings often
energylithium-ion-batteriesbattery-technologypolymer-binderselectrode-materialselectric-vehiclesmaterials-scienceThe Evolution Of The US Floating Solar Industry
The US floating solar industry is gaining momentum as stakeholders recognize the benefits of installing solar panels over water bodies, which helps conserve land space. However, floating solar projects face challenges such as competition with recreational uses and habitat conservation. Companies like Florida-based AccuSolar, which evolved from AccuDock’s experience in providing floating structures since 2009, are pioneering the sector by targeting reservoirs, irrigation ponds, stormwater retention sites, flood zones, irrigation canals, and industrial water features as promising locations. These sites often involve water bodies that fluctuate in level, allowing floats to rest on dry ground most of the time and float when water collects, making efficient use of otherwise unusable land. The industry’s growth is supported by leveraging existing water-based industry supply chains and workforce, alongside technological advancements in solar panel efficiency and floating solar trackers, such as those developed by US firm Noria. These innovations enable more power generation from fewer panels, which is crucial for sites shared with other uses. Studies by the US Department
energysolar-energyfloating-solarrenewable-energyclean-energysolar-panelssustainable-technologyRolling Back Climate Rules Will Cost Americans Bigly - CleanTechnica
The article from CleanTechnica critically examines the recent rollback of U.S. climate and vehicle emissions regulations under the Trump administration, highlighting that contrary to official claims, these rollbacks are projected to increase costs for Americans rather than reduce them. While the administration asserted that repealing these regulations would save Americans $1.3 trillion by 2055, the government’s own Environmental Protection Agency (EPA) analysis reveals a different picture. The EPA’s regulatory impact analysis suggests that although vehicle prices might decrease, the resulting increase in gasoline consumption, along with higher vehicle maintenance, insurance, congestion, and noise costs, will lead to an overall additional expense of $1.5 trillion—$200 billion more than the projected savings. The article also points out that the EPA’s optimistic assumptions about lower gasoline prices rely on unrealistic scenarios from the Energy Information Administration, which do not account for the complex global oil market dynamics. Environmental advocates, such as Kathy Harris from the Natural Resources Defense Council, argue that the EPA is effectively
energyclimate-policyvehicle-emissionsEPA-regulationsfuel-costselectric-vehiclesenvironmental-impactPhotos: 2026 GMC Hummer EV humiliates five elite supercars in 15-run drag race
The 2026 GMC Hummer EV Carbon Fiber Edition has demonstrated remarkable acceleration prowess by outperforming five elite supercars—including the Ferrari F8 Tributo and Porsche Taycan Turbo S—in a series of 15 consecutive drag race runs. Despite its substantial weight of over four tons, the Hummer EV’s 1,160-horsepower tri-motor system and specialized "Watts to Freedom" launch mode enabled it to reach 60 mph in just 2.8 seconds, consistently out-launching lighter and traditionally faster competitors. This electric "supertruck" leverages instant torque delivery and advanced torque vectoring to overcome its massive inertia, defying expectations based on weight and conventional mechanical transmissions. While GMC advertises an impressive 13,000 lb-ft of torque measured at the wheels, the actual motor torque is approximately 1,100 lb-ft, which still provides more than enough force to outperform high-revving internal combustion engines. The Hummer EV’s launch control system optimizes aer
energyelectric-vehicleselectric-powertraintorqueautomotive-technologylaunch-controlelectric-trucksThe End Game Economics of Maritime Fuels - CleanTechnica
The article "The End Game Economics of Maritime Fuels" from CleanTechnica analyzes the future economic landscape of maritime fuels under a scenario where road transport is fully electrified, liquid fuels are largely confined to aviation and shipping, emissions control areas expand, and carbon pricing becomes significant. The author emphasizes that fuel comparisons should be based on energy delivered to the engine crankshaft rather than per ton or barrel of fuel. For example, very low sulfur fuel oil (VLSFO) delivers about 5.4 MWh of energy to the crankshaft per ton, while electricity requires about 5.85 MWh to deliver the same output due to conversion efficiencies. Using this metric, current VLSFO prices of around $510 per ton translate directly to $510 per 5.4 MWh delivered, but in an end-state scenario with reduced refinery scale and carbon pricing, prices could rise dramatically to between $1,273 and $1,584 per crank equivalent depending on carbon price assumptions. The
energymaritime-fuelscarbon-pricingelectrificationshipping-industryfuel-economicslow-sulfur-fuel-oilIt Isn’t That Simple: Why "Free Trade" Needs A New Playbook - CleanTechnica
The article from CleanTechnica challenges the simplistic notion that opening U.S. markets to Chinese electric vehicle (EV) competition will naturally force American automakers to improve through free-market dynamics. It argues that the current market is heavily distorted due to decades of aggressive state-led industrial policies, particularly in China, where the government has subsidized the entire EV supply chain—from raw materials to infrastructure—giving Chinese companies like BYD and CATL a significant, unfair advantage. The U.S. market lacks a comparable domestic supply chain and production incentives, meaning that simply removing trade barriers would drop American automakers into a highly uneven competitive environment. Additionally, the article highlights the substantial hidden subsidies supporting fossil fuels, which artificially lower the cost of internal combustion engines and impede EV adoption. These subsidies, estimated by the IMF at $7 trillion globally in 2022, create a market distortion that favors traditional fuel sources over cleaner alternatives. To foster genuine competition and innovation in the EV sector, the article calls for a comprehensive policy
energyelectric-vehiclessubsidiesclean-energyautomotive-industryindustrial-policymarket-competitionThe Highlander BEV: Toyota's Missing Debut at the 2026 Chicago Auto Show - CleanTechnica
At the 2026 Chicago Auto Show, Toyota revealed its new Highlander BEV, a three-row battery-electric SUV and a key element of its multipath electrification strategy, but notably did not display the vehicle physically on the show floor. Instead, Toyota showcased the existing Highlander in hybrid and gasoline versions alongside the updated bZ crossover, the only BEV present. This deliberate choice emphasized Toyota’s current sales focus on hybrid models, particularly the RAV4, which was prominently featured with its full electrified range. The RAV4’s strong market presence and diverse powertrain options illustrated Toyota’s approach to balancing immediate consumer demand with gradual EV adoption amid challenges like high vehicle prices and limited charging infrastructure. The Highlander BEV, built in Kentucky with batteries from Toyota’s North Carolina plant, marks Toyota’s first BEV assembled in the U.S., aligning with domestic supply chains and federal incentives. It offers competitive performance with a dual-motor AWD system producing about 338 horsepower and an estimated
energyelectric-vehiclesbattery-electric-vehicleToyotahybrid-technologyEV-transitionautomotive-energy-storageUK report examines space-based solar power for offshore wind sites
The UK government has commissioned a report by Frazer-Nash Consultancy exploring the feasibility of space-based solar power (SBSP) as a means to deliver clean electricity directly to the national grid and support the country’s net-zero emissions targets. Published in February 2026 by the Department for Energy Security and Net Zero (DESNZ), the study proposes deploying satellite receivers called rectennas within existing offshore wind farms. These rectennas would capture microwave energy beamed from solar power satellites in geostationary orbit and convert it into grid-ready electricity, leveraging the existing grid infrastructure at offshore wind sites. SBSP offers significant advantages over terrestrial solar, including continuous sunlight exposure, no atmospheric losses, and the potential to generate up to 13 times more energy than ground-based solar installations. The report highlights that a single space-based solar platform could produce up to two gigawatts of reliable, 24/7 power—comparable to a large nuclear reactor—and operate regardless of weather conditions. While upfront costs
energyspace-based-solar-poweroffshore-windrenewable-energysatellite-technologynet-zero-targetsclean-electricityHeat Pump Water Heaters Can Save Over $500/Year On Utility Bills - CleanTechnica
The article from CleanTechnica highlights the significant cost savings that heat pump water heaters (HPWHs) offer compared to traditional water heating methods. HPWHs operate by moving heat rather than generating it, making them much more energy-efficient than electric resistance or fossil gas water heaters. According to data from the U.S. Energy Information Administration and ENERGY STAR, HPWHs use about four times less energy than electric resistance water heaters, leading to substantial utility bill savings. For a typical four-person household, switching from an electric resistance water heater to a HPWH can result in the unit paying for itself in just over two years. When compared to gas water heaters, HPWHs are also more efficient—often five to six times more—resulting in average annual savings of $150 to $300, despite the lower cost of gas per BTU. While HPWHs generally provide savings across most of the United States, there are exceptions in certain regions, such as parts of California where electricity costs are
energyheat-pump-water-heatersenergy-savingsutility-billsENERGY-STARelectric-resistance-water-heatersfossil-gas-water-heatersJay Leno Drives A Slate Pickup Truck (Video) - CleanTechnica
The article discusses Jay Leno’s recent experience driving the Slate pickup truck, an upcoming fully electric vehicle (EV) that has generated significant anticipation alongside new Rivian models. Unlike previous coverage that mostly featured photos and speculation, Leno’s test drive provides valuable real-world insight into the vehicle’s performance. The Slate is notable for its affordability, with a base price around $25,000—roughly half the average cost of new vehicles in the U.S.—making it an accessible option for buyers interested in electric pickups. Manufactured in the U.S., the Slate offers two battery options providing either 150 or 230 miles of range, rear-wheel drive, regenerative brakes, air conditioning, a frunk, and safety features including airbags and a liquid-cooled battery. A key selling point of the Slate is its high degree of customization, allowing owners to configure and style their trucks to personal preferences. Additionally, the vehicle supports DIY warranty repairs, enabling owners to perform certain fixes without voiding the warranty.
electric-vehiclesEVenergybattery-technologyregenerative-brakingelectric-pickup-truckvehicle-IoTChina’s Carbon Market Expands Into Heavy Industry As USA Regresses - CleanTechnica
China’s national carbon market is expanding significantly as the Ministry of Ecology and Environment has extended mandatory carbon reporting to additional heavy industries, including petrochemicals, chemicals, flat glass, copper smelting, papermaking, and civil aviation. While this expansion does not immediately impose carbon pricing on these sectors, it establishes the necessary administrative framework to do so in the future. This move reflects China’s iterative and staged approach to climate policy, transitioning its emissions trading system (ETS) from pilot programs to a broad macroeconomic tool. Currently, China’s ETS directly covers four major sectors—power generation, steel, cement, and aluminum—which together account for approximately 60% to 65% of the country’s total carbon emissions (around 9,000 to 11,000 million tons of CO2 annually out of 15,000 to 16,000 million tons nationally). The carbon price in China’s ETS has remained relatively modest, typically between $8 and $13 per ton, serving more as
energycarbon-marketemissions-trading-systemrenewable-energyheavy-industryclimate-policyChina-energy-transitionMassive US cargo plane airlifts nuclear microreactor in historic first
The US Departments of Energy and Defense have successfully airlifted a nuclear microreactor for the first time, marking a historic milestone in the deployment of small-scale nuclear power. The microreactor, developed by California-based Valar Atomics, was transported aboard a C-17 military cargo plane from California to Hill Air Force Base in Utah. Slightly larger than a minivan, the Ward microreactor can generate up to 5 megawatts of electricity—enough to power approximately 5,000 homes. Notably, the reactor was transported without nuclear fuel, which will be delivered separately from the Nevada National Security site. The flight demonstrated the potential for rapid deployment of microreactors to support both military operations and civilian needs. Valar Atomics plans to begin operating the reactor at 100 kilowatts in July, ramping up to 250 kilowatts later this year before reaching full capacity. The company aims to commercialize the technology by 2028, with trial
energynuclear-microreactorValar-Atomicsmilitary-technologymicroreactor-deploymentsmall-modular-reactorspower-generationUS seventh grader claims to have built fusion reactor at makerspace
Aiden MacMillan, a 12-year-old seventh grader from Dallas, claims to have built a nuclear fusion reactor at a makerspace called Launchpad, where he developed prototypes over two years. His device reportedly generated neutrons, indicating that fusion occurred, making him potentially the youngest person to achieve this feat. MacMillan’s interest in fusion began during the COVID-19 lockdowns, driven by his belief that fusion is the future of energy. He now aims to break the Guinness World Record previously held by Jackson Oswalt, who built a fusion reactor at age 12 in 2020. While MacMillan’s accomplishment is impressive for his age and dedication, experts emphasize that such achievements do not advance nuclear fusion science in a practical sense. The main challenge in fusion energy research lies in creating a commercially viable process that can generate large-scale, cost-competitive power. Current efforts by research institutes and startups focus on making fusion energy a feasible alternative to fossil fuels and renewable sources like wind and solar.
energynuclear-fusionfusion-reactorclean-energyrenewable-energyenergy-researchfusion-technologyUK EVs At 34.6% Share In 2025 - Tesla Model Y Best-Seller - CleanTechnica
In 2025, electric vehicles (EVs) in the UK achieved a significant market share milestone, with plugin EVs reaching 34.6% of total auto sales, up from 28.1% in 2024. Battery electric vehicles (BEVs) alone accounted for 23.4%, while plugin hybrids (PHEVs) held 11.1%. December 2025 saw even higher monthly shares, with plugin EVs at 43.8%, BEVs at 32.2%, and PHEVs at 11.6%. The overall auto market volume also grew modestly, with 2,020,523 units sold in 2025, a 3% increase from the previous year. The UK's Zero Emission Vehicle (ZEV) mandate has been effective in driving these gains, with manufacturers meeting or exceeding the 2025 target of 28% EV share, despite some allowances and credit trading. The mandate's targets will increase in subsequent
energyelectric-vehiclesbattery-electric-vehiclesUK-EV-marketTesla-Model-YZEV-mandateclean-transportationJapan’s Smallest EV Gets Backing From One Of Its Largest Energy Companies - CleanTechnica
KG Motors, the manufacturer of Japan’s smallest electric vehicle (EV), the single-seat MiBot, delivered its first units on December 30, 2025, after a six-month production delay. Shortly after delivery, Idemitsu Kosan, one of Japan’s largest energy companies and refiners, expressed strong interest in the MiBot, leading to a formal business agreement signed on January 16, 2026. This partnership covers sales support, delivery, registration, insurance, and after-sales services, initially piloted at select apollostation service stations in Tokyo and Hiroshima starting April 2026. The collaboration integrates the MiBot into Idemitsu’s evolving energy infrastructure, which is transitioning from traditional gas stations to electrified energy hubs under the “Smart Yorozuya” strategy, incorporating EV charging, hydrogen fueling, solar power, and renewable energy. KG Motors plans to ramp up MiBot production from 300-500 units monthly at launch to 800-900 units monthly,
energyelectric-vehiclesEV-charging-infrastructurerenewable-energymobilityJapanenergy-transitionAs AI data centers hit power limits, Peak XV backs Indian startup C2i to fix the bottleneck
The article highlights a significant shift in AI data center scaling challenges, where power efficiency, rather than raw compute capacity, is becoming the primary bottleneck. Peak XV Partners has invested $15 million in a Series A round for C2i Semiconductors, an Indian startup developing integrated, plug-and-play power solutions aimed at reducing energy losses in AI infrastructure. C2i’s technology focuses on redesigning power delivery from the data center grid directly to GPUs, addressing inefficiencies in power conversion that currently waste 15-20% of energy. By integrating power conversion, control, and packaging into a unified platform, C2i aims to cut end-to-end energy losses by about 10%, which translates to substantial savings in power consumption, cooling costs, and overall operational expenses. Founded in 2024 by former Texas Instruments executives, C2i is preparing to validate its first silicon designs with major data center operators and hyperscalers by mid-2026. The startup has grown to a team of
energydata-centerspower-efficiencyAI-infrastructuresemiconductorsenergy-consumptionpower-conversionIn The UK, "Power To The People" Is Latest Clean Energy Trend - CleanTechnica
The UK government has announced a £1 billion investment to support community-owned clean energy projects as part of its strategy to increase local engagement and reduce opposition to renewable energy infrastructure. Energy Secretary Ed Miliband emphasized that this funding aims to democratize the energy system by enabling local communities to own and control clean energy assets, ensuring profits benefit the community rather than large energy companies. The initiative will fund solar, wind, hydro, and biomass projects across the UK, including Wales, Scotland, and Northern Ireland, and will be managed by GB Energy, a government-owned company focused on delivering cheaper and more secure electricity. The program plans to support around 1,000 projects through grants or loans and may allow communities and local councils to buy shares in larger private schemes. Projects are expected to include solar panels on public buildings and new wind farms, with profits reinvested locally to foster energy resilience and financial independence. This approach aims to address resistance to large-scale transmission infrastructure by ensuring rural communities see direct benefits from renewable
energyclean-energyrenewable-energycommunity-energysolar-powerwind-energyUK-energy-policyOver 100 Million EV Charging Sessions Conducted On ChargePoint Chargers In Last Year - CleanTechnica
ChargePoint, a leading global provider of electric vehicle (EV) charging solutions, reported enabling over 100 million EV charging sessions in the past year, highlighting the rapid growth in EV usage and infrastructure demand. This milestone aligns with broader industry trends, as U.S. fast-charging networks recorded an estimated 141 million sessions in 2025, a 30% year-over-year increase. ChargePoint’s CEO emphasized that the EV market is transitioning from focusing on new EV sales to the total number of EVs on the road, which drives charger utilization and accelerates return on investment for charging infrastructure installed in 2026 and beyond. Since 2007, ChargePoint estimates its network has helped avoid the consumption of 714 million gallons of gasoline, saving drivers over $2 billion and reducing greenhouse gas emissions by more than 4.5 million metric tons. The shift to fully electric vehicles not only cuts fossil fuel use but also reduces toxic air pollution linked to serious health issues such as cancer, COPD
energyelectric-vehiclesEV-chargingChargePointclean-energytransportation-electrificationrenewable-energyGoogle to use large-scale solar power to meet data-center loads
French energy company TotalEnergies has signed two long-term power purchase agreements (PPAs) to supply Google with a combined 1 gigawatt of new solar power capacity for its expanding data centers in Texas. The electricity, estimated at around 28 terawatt-hours over 15 years, will come from two utility-scale solar projects currently under development: the 805-megawatt Wichita solar farm and the 195-megawatt Mustang Creek site. Construction is set to begin in the second quarter of 2026, timed to meet the anticipated increase in energy demand from Google’s growing cloud infrastructure in the region. This deal represents the largest renewable PPA TotalEnergies has signed in the US and highlights the rapid growth of data-center electricity consumption, which increasingly requires dedicated new clean energy generation rather than relying on existing supply. The agreement addresses key challenges in the sector, such as limited land availability and the need for reliable power, by enabling large-scale colocation projects that directly link computing
energysolar-powerrenewable-energydata-centersTotalEnergiespower-purchase-agreementclean-energyTOPCon Solar Cells Are Busting A Key Anti-Solar Myth
The article addresses and counters a common anti-solar argument that solar energy production is not truly clean due to the carbon emissions involved in manufacturing solar panels. It highlights how the global solar industry is advancing with the adoption of tunnel oxide passivated contact (TOPCon) solar cells, a technology that improves efficiency in converting sunlight to electricity while also reducing the carbon footprint of solar cell manufacturing. This advancement directly challenges claims from groups like Citizens for Responsible Solar (CRS), which argue that solar energy is not free from CO2 emissions, by providing context that lifecycle emissions from solar projects remain significantly lower than those from fossil fuel plants. TOPCon technology, introduced by Germany’s Fraunhofer Institute in 2013, has been slower to penetrate the market compared to PERC cells but is now gaining rapid adoption. Research from the University of Warwick demonstrates that TOPCon cells have lower environmental impacts in 15 out of 16 categories compared to PERC technology, including a 6.5% reduction in climate
energysolar-energyTOPCon-solar-cellsrenewable-energycarbon-emissionsclean-technologysolar-power-innovation2025 Saw EVs At 97.5% Share In Norway - Tesla Model Y Best-Seller - CleanTechnica
In 2025, Norway continued to lead the electric vehicle (EV) transition with plugin EVs capturing a remarkable 97.5% share of new car sales for the full year, up from 91.3% in 2024. Battery electric vehicles (BEVs) accounted for 95.9% of new sales, further eroding the market share of other powertrains. December 2025 was particularly notable, with plugin EVs reaching a 98.5% share and BEVs alone at 97.6%, driven by a surge in sales ahead of upcoming VAT increases on all vehicles starting January 2026. Total auto sales volume for 2025 rose sharply by 53% compared to 2024, reaching 179,547 units. The Tesla Model Y dominated Norway’s EV market, becoming the best-selling passenger car both in December 2025 and for the entire year. It posted its highest monthly sales volume in December with 5,064 units
energyelectric-vehiclesbattery-electric-vehiclesTesla-Model-YNorway-EV-marketclean-energyautomotive-trendsTechCrunch Mobility: Rivian’s savior
The article from TechCrunch Mobility highlights Rivian’s 2025 financial performance and outlook, emphasizing the critical role of its software and technology joint venture with Volkswagen Group in sustaining the company. Rivian’s automotive cost of goods sold (COGS) per unit decreased from $110,400 in 2024 to $100,900 in 2025, signaling progress in reducing losses per vehicle. The upcoming launch of the more affordable R2 SUV, expected in mid-2026, is positioned as a pivotal product for Rivian’s growth, with the company projecting vehicle deliveries between 62,000 and 67,000 units in 2026—a potential 59% increase from 2025’s 42,247 deliveries. This optimistic guidance led to a 27% surge in Rivian’s stock price following the earnings report. The article also contrasts Uber and Lyft’s differing strategies toward autonomous vehicles (AVs), noting Uber’s aggressive pursuit of AV partnerships while Lyft lags behind despite holding
energyelectric-vehiclesautomotive-technologyproduction-cost-reductionRivianelectric-SUVstransportation-technologyTesla Sales Down Tremendously in UK, Norway, Netherlands, Germany, Spain, Sweden, Denmark, Portugal, Switzerland - CleanTechnica
The article from CleanTechnica reports a significant decline in Tesla sales across multiple European countries between January 2024 and January 2026. Overall, Tesla’s sales dropped by 23% across 12 key markets, with some countries experiencing particularly steep decreases. For example, the UK saw a 55% decline, Germany a 59% drop compared to 2024 (and 69% compared to 2023), the Netherlands an 81% fall, and Norway the most dramatic decrease at 93%. Other countries like Denmark, Sweden, Portugal, Spain, and Switzerland also experienced notable sales reductions, though some showed mixed trends when comparing 2026 sales to 2023. Despite the widespread downturn, Italy was a notable exception, with Tesla sales rising by 82% from 2024 to 2026. Sweden and Portugal also showed some recovery when comparing 2026 figures to 2023, despite drops relative to 2024. The article hints at possible political factors
energyTeslaelectric-vehiclesautomotive-salesrenewable-energyclean-technologymarket-trendsEarth To Elon: Stop Flinging Poop And Start Selling More Tesla EVs
The article discusses the growing political and public backlash against Elon Musk, particularly focusing on efforts to reduce the influence of wealthy oligarchs like him in American politics. A group of Democratic Representatives—Rashida Tlaib, Pramila Jayapal, Delia C. Ramirez, and Summer Lee—introduced the “Defund the Oligarchs, Fund the People Resolution” aimed at eliminating public subsidies and tax breaks that benefit Musk and other affluent election influencers. Although the Democrats currently hold a minority in Congress and the Supreme Court, shifting political dynamics and support from progressive organizations suggest potential momentum for such legislation ahead of the 2026 midterm elections. Meanwhile, Musk’s reputation is facing challenges beyond politics. His involvement in controversies related to Jeffrey Epstein and public disputes with other tech billionaires, such as LinkedIn co-founder Reid Hoffman, have further damaged the Tesla brand. Tesla’s electric vehicle sales showed signs of weakening even before 2025, and Musk’s recent social media conflicts have exacerb
energyelectric-vehiclesTeslaclean-energysubsidieslegislationElon-MuskChina's lithium battery defies deep freeze with 85% capacity at –29°F
Chinese researchers at the Dalian Institute of Chemical Physics have developed a novel liquid-solid-state lithium battery that retains over 85% of its capacity after eight hours at –29°F, a temperature at which conventional lithium-ion batteries typically experience severe performance degradation. This innovative battery combines specially formulated low-temperature electrolytes with a liquid-solid architecture, enabling stable energy output and preventing the sharp capacity drops and start-up failures common below –4°F. The design maintains electrochemical activity and reduces the risk of complete power loss in extreme cold, making it suitable for harsh environments without requiring additional thermal insulation or heating systems. The technology has been successfully demonstrated in drones and robots operating in cold climates and high altitudes, highlighting its practical applications beyond laboratory settings. Importantly, the battery’s plug-and-play compatibility allows integration into existing systems, potentially benefiting electric vehicles (EVs) in cold regions where standard batteries can lose 50% to 80% of their usable capacity. While this represents a significant advancement for cold-weather energy
energylithium-batterycold-weather-batteryelectric-vehiclesbattery-technologyenergy-storageliquid-solid-batteryUS firm launches plugless charging pad for golf carts, commercial fleets
WiTricity has launched the MR/1 wireless charging pad tailored for electric golf carts and small utility vehicles, targeting retirement and golfing communities. The system uses magnetic induction to transfer power from a ground-installed pad to a receiver plate mounted under the vehicle, enabling automatic charging when parked over the pad without the need for cables. This plugless design reduces user anxiety about remembering to charge, eliminates connector wear, and enhances safety by minimizing tripping hazards and maintenance associated with cables. The receiver installation takes less than 30 minutes and supports various battery types, including Lithium Ion and Lead Acid. The MR/1 pad comes in two power variants: 600W for slower, cost-effective charging suited to golf courses and communities, and 900W for faster charging aimed at high-use commercial fleets. WiTricity emphasizes that while the product is not revolutionary in electric mobility, it addresses a practical pain point by improving convenience, safety, and reliability in predictable, controlled environments where golf carts typically operate. Larger electric vehicles
energywireless-chargingelectric-vehiclesinductive-chargingbattery-technologycommercial-fleetsgolf-cartsThe Nothing That Has the Potential to Be Anything
The article explores the concept of zero-point energy, a fundamental quantum mechanical phenomenon that prevents any physical system from being completely devoid of energy. Even if a box is emptied of all visible and invisible matter, including gases and dark matter, quantum mechanics dictates that it still contains residual energy known as ground-state or zero-point energy. This energy manifests in two forms: associated with fields like the electromagnetic field and with discrete particles such as atoms and molecules. Due to the Heisenberg uncertainty principle, particles cannot have both precisely defined position and velocity, ensuring a baseline energy level that cannot be eliminated, causing particles to appear as if they are always in motion even at near absolute zero temperatures. Historically, zero-point energy was introduced by Max Planck in 1911 and later taken seriously by Einstein and others to explain phenomena such as molecular vibrations, crystal lattice oscillations, and the unusual behavior of liquid helium at low temperatures. A recent 2025 experiment at the European X-Ray Free-Electron Laser Facility demonstrated
energyquantum-mechanicszero-point-energymaterials-scienceatomic-physicsquantum-vacuummolecular-vibrationsYouTuber's homemade electric motor from LEGO bricks spins at 4,000 rpm
YouTuber Jamie from the channel Jamie’s Brick Jams constructed a fully functional electric motor primarily from LEGO bricks, simple magnets, and minimal electronic components, demonstrating fundamental electromagnetic principles without relying on advanced motor controllers or microchips. The motor uses two neodymium magnets mounted on a rotor and a hand-wound copper coil to generate motion when powered by a 9-volt battery. A second coil acts as a sensor, detecting the rotor’s position and triggering a transistor to send timed bursts of power to the driving coil, maintaining continuous rotation. This simple setup achieves about 1,300 rpm in its basic form. The project highlights the core physics behind electric motors: electric current through a coil creates a magnetic field that interacts with permanent magnets to produce motion. Jamie’s design uses a minimalistic circuit with just one transistor, an LED indicator, two coils, and a battery, eliminating the need for complex control boards or mechanical commutators. By adding LEGO gears and a belt drive, the motor
energyelectric-motorelectromagnetismDIY-electronicsneodymium-magnetscopper-wiresimple-motor-designSweden’s EVs At 63.2% Share In 2025 - Volvo EX40 Best-Seller - CleanTechnica
In December 2025, plugin electric vehicles (EVs) accounted for 68.6% of new car sales in Sweden, up from 62.8% the previous year. Battery electric vehicles (BEVs) held a 43.1% share, while plug-in hybrid electric vehicles (PHEVs) made up 25.5%. For the full year 2025, EVs captured 63.2% of the market, an increase from 58.4% in 2024, with most of the growth driven by PHEVs, which rose from 23.4% to 26.7%. BEV share saw only a modest increase from 35.0% to 36.5%. Overall auto sales volume in December dropped by 9% year-on-year to 23,877 units, while the full year 2025 saw a slight 1% increase to 272,998 units. The Volvo EX40 emerged as the best
energyelectric-vehiclesEV-marketbattery-electric-vehiclesplug-in-hybridsclean-energyautomotive-industryFrance 2025 EVs at 26.7% Share - Renault 5 Best Seller - CleanTechnica
In 2025, electric vehicles (EVs) in France achieved a 26.7% market share, a modest increase from 25.4% in 2024, with battery electric vehicles (BEVs) growing from 16.9% to 20.0%, while plug-in hybrid electric vehicles (PHEVs) declined from 8.5% to 6.7%, limiting overall growth. December 2025 saw a notable surge with EVs capturing 34.4% of the market, including 24.4% BEVs and 10.0% PHEVs, compared to 29.6%, 16.1%, and 13.5% respectively the previous year. Total vehicle sales in France decreased by about 5-6% year-on-year, with December sales at 172,927 units and the full year totaling 1,631,862 units. The Renault 5 emerged as the best-selling BEV in France
energyelectric-vehiclesbattery-electric-vehiclesEV-marketRenault-5clean-energyautomotive-industryGeely & BYD Are Top Bidders For Nissan/Mercedes Aguascalientes Plant, Potentially Expanding Mexican EV Production - CleanTechnica
Recent reports reveal that Nissan and Mercedes are selling their joint venture factory in Aguascalientes, Mexico, with Chinese automakers BYD and Geely emerging as the top bidders. This marks a significant shift in the Mexican automotive landscape, as Nissan’s once-thriving operations have contracted, leading to closures of key plants and discontinuation of popular models like the Infiniti QX50/QX55 and the Nissan Versa. The Aguascalientes plant, originally built to produce premium compact vehicles for Mercedes and Nissan, now faces uncertainty amid declining sales and strategic shifts by legacy automakers. BYD and Geely’s potential acquisition could fill the emerging gap in affordable subcompact electric vehicles (EVs) in the Latin American market. BYD, which exclusively manufactures plug-in vehicles, and Geely, which still produces internal combustion engines alongside EVs, may leverage the plant to produce cost-effective EVs appealing to consumers in Latin America and possibly Canada. Favorable trade relations between Mexico and Canada could facilitate
energyelectric-vehiclesEV-productionautomotive-manufacturingBYDGeelyMexico-plantAmerica’s New Maritime Plan Is Competing for the Wrong Century - CleanTechnica
The new U.S. Maritime Action Plan acknowledges the severe decline of American commercial shipbuilding to less than 1% of global output, highlighting workforce shortages, fragmented procurement, and fragile supply chains. It proposes multiyear contracting, yard recapitalization, and supplier development to restore competitiveness. While the plan is coherent and realistic within a traditional framework, it is criticized for relying on a 20th-century approach that does not fully address the rapidly evolving global shipping market shaped by changing energy and environmental policies. Significant shifts are underway as regions like the European Union integrate maritime emissions into their Emissions Trading System and impose stricter greenhouse gas intensity standards, pushing the industry toward net-zero emissions by 2050. These regulations, along with China's aggressive low-carbon fuel strategies, are driving a fundamental change in shipping economics. Fuel costs combined with carbon pricing create strong financial incentives for adopting battery electric and hybrid propulsion technologies. For example, hybridization can reduce fuel consumption and carbon pricing exposure by 30%, yielding
energymaritimeshippingcarbon-emissionshybrid-propulsionbattery-energy-storagefuel-efficiencyWhether The Endangerment Finding Stays Or Goes Will Be Up To The Supreme Court - CleanTechnica
The article discusses the recent elimination by the US government of the "endangerment finding," a federal policy established in 2009 that recognizes excessive carbon dioxide (CO2) emissions as a threat to the environment. This finding underpinned regulatory actions to reduce CO2 emissions from industrial sources and vehicles. Critics of the repeal argue that while CO2 is essential for photosynthesis and life, excessive amounts are harmful—similar to how too much of any necessary substance can be detrimental. The article criticizes current political leaders for disregarding the need for environmental limits and allowing unchecked pollution from coal ash, nuclear waste, and industrial emissions. The article highlights the political rhetoric surrounding the repeal, including statements from former President Trump, who hailed it as a major deregulatory achievement that would reduce costs and lower vehicle prices, while dismissing previous climate regulations as a "green new scam." Despite the rollback, there remains hope that the Supreme Court could intervene. The Court has previously upheld the endangerment finding as
energyenvironmental-policycarbon-dioxideclimate-regulationSupreme-Courtpollution-controlgreenhouse-gasesChinese firm's new back-contact solar cells offer 27% efficiency
Chinese manufacturer Longi, in collaboration with Sun Yat-sen University researchers, has developed a new approach to enhance the efficiency of high-resistivity, lightly doped silicon wafers for solar cells. These wafers theoretically offer higher efficiency due to fewer recombination sites, but their fragility has limited commercial adoption. The team addressed this challenge by applying in-situ edge passivation to control edge recombination, which is a major factor reducing performance in these wafers. This passivation preserves carrier collection and enables the wafers to realize their intrinsic potential for high fill factors and efficiency. The researchers fabricated hybrid interdigitated back-contact (HIBC) solar cells using both high-resistivity (8–10 Ω·cm) and standard Czochralski-grown wafers (1.0–1.5 Ω·cm) to directly compare performance. Their results showed that edge passivation significantly improved efficiency, especially in high-resistivity wafers, which are more sensitive to edge
energysolar-cellsphotovoltaic-technologysilicon-waferspassivationhigh-efficiency-solar-cellsLongiCanada, California, & Europe: Three Ways to Force EV Adoption - CleanTechnica
The article examines three distinct regulatory approaches to accelerating electric vehicle (EV) adoption in Canada, California, and Europe, highlighting how each system shapes automaker behavior, market dynamics, and financial flows. Canada recently shifted from explicit EV sales mandates to a fleet average emissions standard measured in lifetime tons of CO2, combined with credit trading and trade policy adjustments. This approach calculates compliance based on the difference between a target emissions level and the manufacturer’s actual fleet average, multiplied by vehicle count and expected lifetime mileage. The resulting CO2 deficit or surplus is tradable as credits, creating a commodity-like carbon market embedded within vehicle regulations. For example, a hypothetical automaker with a fleet averaging 221 gCO2/km against a 170 gCO2/km target could face a multi-million-ton CO2 deficit, translating into hundreds of millions of dollars in credit costs or revenues. In contrast, California’s system uses Zero Emission Vehicle (ZEV) credits tied to specific vehicle characteristics rather than mass emissions, while
energyelectric-vehiclesemissions-standardsfleet-average-CO2regulatory-policyclean-transportationcarbon-creditsNew Energy Storage Systems Are Killing Trump's Coal Dreams
The article discusses how emerging energy storage technologies, particularly advanced compressed air energy storage (A-CAES), are undermining former President Trump's ambitions to sustain coal power. With the declining costs of wind and solar power, long-duration, non-battery storage solutions like compressed air storage are becoming economically viable alternatives to lithium-ion batteries, which have limitations in duration and rely heavily on critical minerals. Canadian startup Hydrostor is at the forefront of this innovation, developing A-CAES systems capable of delivering electricity for eight hours or more, thus supporting greater integration of renewable energy into the grid. Hydrostor recently signed a 50-megawatt off-take agreement with California Community Power (CC Power), a coalition of community choice aggregators representing millions of ratepayers across California. This deal advances the construction of Hydrostor’s 500-megawatt Willow Rock Energy Storage Center in Kern County, marking a significant step for both the company and the community choice aggregation movement, which empowers local
energyenergy-storagecompressed-air-energy-storagerenewable-energylithium-ion-batterieswind-powersolar-powerAI-driven digital twin make energy-efficient buildings easier to design
The article discusses a new AI-driven digital twin technology developed to aid architects and engineers in designing energy-efficient, zero-energy buildings with improved indoor comfort. Traditional design tools rely on static simulations that fail to provide real-time feedback on how heat, airflow, and comfort evolve as building designs change. This limitation is especially problematic for Task-Ambience Air Conditioning (TAAC) systems, which regulate climate around individual work areas and are known to save energy but have been difficult to evaluate during the design phase. The new AI-powered digital twin, called VEEM-ZEB, was created by researchers led by Professor Teng at Kanazawa University in collaboration with Fushou University. It enables real-time testing of energy consumption and thermal comfort by modeling a building as multiple climate zones rather than a single one, allowing simultaneous assessment of comfort and energy use using standard indicators like PMV and PPD. VEEM-ZEB incorporates a three-layer digital twin with rule-based symbolic AI and a VR interface that visually presents live results
energyAIdigital-twinzero-energy-buildingstask-ambience-air-conditioningenergy-efficiencybuilding-design280,000-pound payload: China’s electric loader to challenge diesel
Chinese construction equipment manufacturer XCMG has delivered two of its largest battery-electric machines—a wheel loader (XC9260BEWL) and a wheel dozer (XC9260BEWD)—to Australian mining company Fortescue. These machines, part of a record-setting US$400 million order, are designed to reduce Fortescue’s carbon footprint by replacing diesel-powered equipment with fully battery-electric alternatives. Both models feature a 783 kW electric motor powered entirely by onboard batteries, aiming to match or exceed the performance of XCMG’s existing diesel-hybrid models. The electric wheel loaders can handle payloads of about 280,000 pounds with bucket capacities between 15 and 19 cubic yards, placing them in the class of full-scale surface mining equipment. While specific battery details for these new machines have not been disclosed, XCMG’s previous 15-ton battery-electric loader used a 1,002 kWh lithium iron phosphate battery developed with BYD, suggesting similarly advanced energy storage
energyelectric-mining-equipmentbattery-electric-vehiclesheavy-duty-electrificationdecarbonizationlithium-iron-phosphate-batteryzero-emissions-miningRecord high fusion plasma temperature achieved to help clean energy goal
Helion, a Washington-based private fusion energy company, has achieved two significant industry firsts: demonstrating measurable deuterium-tritium (D-T) fusion and reaching plasma temperatures of 150 million degrees Celsius. These milestones mark critical progress toward Helion’s goal of making commercially viable fusion energy a reality. The company’s approach emphasizes rapid iteration and learning, having built and operated seven prototypes, with the latest, the Polaris prototype, being the first private fusion machine to use D-T fuel and receive regulatory approval to handle tritium for fusion demonstration. Helion’s recent achievements validate its ability to operate and scale fusion across multiple fuels, with ongoing tests aimed at reaching optimal temperatures for deuterium-helium-3 fusion, the fuel intended for commercial operations. Experts in the field, such as Dr. Alan Hoffman, recognize Helion’s advances as a continuation of decades of fusion research, highlighting the potential for plasma energy recovery to enable commercial-scale fusion. Building on this momentum, Helion
energyfusion-energyplasma-temperaturedeuterium-tritium-fusionclean-energycommercial-fusionHelionYou Can't Buy EVs Directly from Auto Manufacturers in Iowa ... But Maybe Soon - CleanTechnica
The article discusses the longstanding legal restriction in Iowa that prevents consumers from buying electric vehicles (EVs) directly from manufacturers, requiring sales to go through third-party auto dealers. This law, rooted in historical concerns about consumer protection and dealer competition, has become problematic with the rise of EVs. Traditional dealers, who profit from maintenance and repairs of gas-powered cars, are often disincentivized to sell EVs, which require less upkeep and about which dealers may have less expertise. Consequently, manufacturers like Tesla and Rivian have pushed for the ability to sell EVs directly to consumers, a practice allowed in most states but still blocked in a few, including Iowa, due to the powerful auto dealer lobby. However, Iowa is on the verge of changing this with the introduction of Senate Study Bill 3067, which would permit direct sales of EVs by manufacturers to consumers. The bill has passed an Iowa Senate subcommittee and is awaiting consideration by the full Senate Commerce Committee. Rivian has publicly
energyelectric-vehiclesEV-salesautomotive-industrydirect-salesRivianIowa-legislationeVTOL Certification Is Coming, But Commercial Runway Isn't - CleanTechnica
The article discusses the current state and challenges of certifying electric vertical takeoff and landing (eVTOL) aircraft, highlighting that regulatory pathways are now largely established by agencies like the FAA and EASA. The FAA finalized powered lift operational rules in 2024 and issued guidance on type certification in 2025, while EASA has had a VTOL framework since 2019. Despite this regulatory progress, the critical hurdles remain closing engineering risks, securing sufficient financing for the final certification stages, and ultimately achieving commercial profitability. Drawing comparisons to novel aircraft categories such as the tiltrotor AW609 and clean-sheet transport aircraft like the Airbus A350, the article emphasizes that eVTOL certification is expected to face significant schedule overruns due to the complexity of new flight modes, distributed propulsion, fly-by-wire systems, and stringent safety requirements. Engineering challenges are compounded by escalating costs during the transition from prototyping to certification and production readiness. Operating expenses for leading eVTOL companies such as Archer, Job
energyelectric-vertical-takeoff-and-landingeVTOL-certificationaerospace-engineeringelectric-propulsionaviation-technologyregulatory-complianceHyundai Claims To Be "Driving The Future Of Electrified Mobility" - CleanTechnica
Hyundai Motor Group positions itself as a key innovator in the future of electrified mobility, emphasizing its advanced research and development efforts at the Namyang R&D Center in Hwaseong, South Korea. This facility has been instrumental in developing award-winning electric vehicles (EVs) such as the Hyundai IONIQ 5 and 6, as well as the Kia EV9 and EV3, which have collectively earned 12 World Car Awards since 2022. Hyundai highlights its focus on aerodynamic optimization, environmental testing, driving dynamics, and creating quiet, refined EV experiences, though many of these efforts align with industry standards rather than groundbreaking advancements. A notable highlight is Hyundai’s Aerodynamic Testing Facility, a large-scale wind tunnel setup designed to simulate real driving conditions and optimize EV efficiency through ultra-low drag technologies. The company’s experimental ‘Aero Challenge Car’ prototype showcases innovative active aerodynamic features—such as an active cowl cover, rear spoiler, side blades, and rear diffuser—that achieve a
energyelectric-vehiclesHyundaiaerodynamic-testingEV-efficiencyactive-aerodynamicselectrified-mobilityCan the Rivian R2 Succeed & Propel Rivian to Prosperity? - CleanTechnica
The article from CleanTechnica discusses the potential impact of the upcoming Rivian R2 electric vehicle amid a challenging US EV market environment marked by declining sales, policy setbacks, and tariffs. Despite these headwinds, the Rivian R2 generates excitement as a mass-market, midsized electric SUV priced around $45,000, representing a significant opportunity for Rivian to expand its customer base. The company is seen as a fresh cleantech-focused alternative to legacy automakers pulling back on EV ambitions and to Tesla, whose leadership controversies have alienated some EV enthusiasts. However, the article expresses cautious skepticism about whether the R2 can truly stand out in a crowded segment filled with competitive models like the Ford Mustang Mach-E, Chevy Equinox EV, Audi Q4 e-tron, and others. Rivian’s future profitability and survival heavily depend on the R2’s success, but the author questions if it can achieve the high sales volumes needed to thrive given the intense competition and unfavorable policy climate. The
energyelectric-vehiclesRivianEV-marketclean-technologysustainable-transportationautomotive-industryMost Maritime Shipping Battery Propulsion Studies Are Already Obsolete - CleanTechnica
The article from CleanTechnica argues that most existing maritime shipping battery propulsion studies are now outdated due to rapid advancements in battery technology, particularly in cost and energy density. Earlier studies assumed battery costs between $300 and $500 per kWh and volumetric energy densities of 30 to 50 kWh per cubic meter. However, recent large-scale Chinese battery energy storage system (BESS) tenders have achieved prices near $65 per kWh, with containerized battery blocks reaching about 190 kWh per cubic meter—significantly higher than previous assumptions. Gravimetric energy densities for ship-appropriate battery packs are estimated between 140 and 175 Wh per kilogram, and fully installed maritime battery systems are projected to cost between $100 and $180 per kWh, including integration and compliance costs. These updated metrics provide a new baseline for evaluating maritime battery propulsion feasibility. The article also discusses how shifts in global shipping patterns, driven by declining fossil fuel bulk trade and increased steel recycling, are
energybattery-propulsionmaritime-shippingenergy-storagebattery-costselectrificationclean-energyUS grants first nuclear fuel license in 50 years to Amazon-backed firm
The US Nuclear Regulatory Commission (NRC) has granted its first new nuclear fuel manufacturing license in over 50 years to TRISO-X, a subsidiary of Amazon-backed X-energy. This license authorizes TRISO-X to produce advanced TRISO fuel using high-assay low-enriched uranium (HALEU) at two commercial facilities, TX-1 and TX-2, for an initial 40-year period. TX-1, currently under construction in Oak Ridge, Tennessee, is poised to become the first Category II nuclear fuel facility in the US. This milestone marks a significant step toward establishing a domestic supply chain for advanced nuclear fuel, reducing reliance on limited global sources. TRISO fuel features tiny uranium particles coated with multiple protective layers, enhancing safety and resistance to overheating compared to traditional nuclear fuel. The NRC’s approval followed comprehensive safety and environmental reviews confirming compliance with federal standards. TX-1 and TX-2 will support X-energy’s goal of deploying up to 144 Xe-100 small modular
energynuclear-fuelTRISOsmall-modular-reactorsadvanced-reactorsnuclear-energyenergy-securityCalcium-ion battery breakthrough may rival lithium-ion systems
Researchers at The Hong Kong University of Science and Technology (HKUST) have developed a novel calcium-ion battery featuring quasi-solid-state electrolytes made from redox-active covalent organic frameworks (COFs). This design addresses a major challenge in calcium-ion batteries—poor ion transport and unstable cycling—by creating aligned channels within the COFs that facilitate rapid calcium ion (Ca2+) movement. The new electrolyte achieved an ionic conductivity of 0.46 mS cm–1 and a Ca2+ transport number greater than 0.53 at room temperature. The assembled battery demonstrated a reversible specific capacity of 155.9 mAh g–1 at 0.15 A g–1 and retained over 74.6% capacity at 1 A g–1 after 1,000 cycles, indicating improved stability and performance nearing practical application. This breakthrough is significant because calcium is abundant and inexpensive compared to lithium, which faces resource limitations and challenges in further energy density improvements. The quasi-solid-state
energybattery-technologycalcium-ion-batteryenergy-storageelectrolytessustainable-energymaterials-scienceChina's new lithium cathode tech boosts EV energy density by 30%
Scientists at City University of Hong Kong, led by Professor Liu Qi, have developed a breakthrough lithium-rich layered oxide (LLO) cathode material that boosts electric vehicle (EV) battery energy density by over 30% while reducing costs. The team addressed the longstanding issue of voltage decay, which shortens battery life, by stabilizing the battery’s atomic “honeycomb” structure through the addition of specific transition metal ions. This innovation prevents oxygen release and structural degradation. Additionally, a carbon coating protects the cathode from surface wear, electrolyte corrosion, and metal dissolution, ensuring long-term stability and high performance. To commercialize this technology, the researchers founded SuFang New Energy Technology Co., Ltd., currently operating a 100-ton-per-year production line with plans to expand to a 1,000-ton facility in Southeast Asia or Korea, creating around 100 new jobs. This advancement not only strengthens Hong Kong’s position in next-generation energy technologies but also aligns with the global lithium-ion battery
energylithium-ion-batteriescathode-materialselectric-vehiclesbattery-technologyenergy-storagesolid-state-batteriesWhy top talent is walking away from OpenAI and xAI
Recent weeks have seen significant talent departures from leading AI companies, notably xAI and OpenAI. At xAI, half of the founding team has left, with some employees departing voluntarily and others exiting due to company restructuring. Meanwhile, OpenAI is undergoing internal upheavals, including the dissolution of its mission alignment team and the dismissal of a policy executive who opposed the introduction of an “adult mode” feature. These developments highlight a broader trend of instability and reshuffling within the AI industry, as companies face challenges in retaining top talent amid rapid growth and evolving strategic priorities. The situation was discussed in TechCrunch’s Equity podcast, which also covered major investments in fusion energy and robotics, emphasizing the ongoing shifts reshaping the tech landscape. The article underscores the importance of monitoring these personnel changes as they may impact the future direction and innovation capacity of prominent AI firms.
robotenergyAItechnologytalent-retentionroboticsfusion-energyFlorida Legislation Would Ban Local Climate Policies - CleanTechnica
The Florida legislature has advanced a bill, House Bill 1217, that would prohibit local governments—cities, towns, and counties—from adopting or implementing any “net-zero” climate policies. This ban extends to comprehensive plans, land development regulations, transportation plans, and other government procedures aimed at reducing greenhouse gas emissions. The bill also forbids local governments from paying dues to organizations promoting net-zero policies and from implementing cap-and-trade systems. Proponents, such as Seminole Republican Berny Jacques, argue the measure is intended to maintain uniformity across the state and prevent increased costs to consumers resulting from local clean energy initiatives, despite lacking concrete evidence that such policies impose excessive financial burdens. This legislation comes nearly two years after Governor Ron DeSantis signed a law removing climate change considerations from state energy policy. It threatens to undo progress made by at least 14 Florida localities that have committed to 100% clean, renewable energy goals, as well as regional collaborations like the Southeast Florida Climate Change Compact
energyclean-energyclimate-policyrenewable-energycarbon-emissionsnet-zero-policiesenvironmental-legislationBlue Origin Wants To Pollute A Pristine Florida Waterway - Just Say No - CleanTechnica
The article from CleanTechnica raises serious environmental concerns about Blue Origin’s request to the Florida Department of Environmental Protection (DEP) for permission to continue dumping industrial wastewater into the Indian River Lagoon (IRL), a highly biodiverse and ecologically significant estuary in Florida. The IRL, spanning 156 miles, supports over 2,100 plant species and 2,200 animal species, including numerous threatened and endangered species. The lagoon’s delicate ecosystem is already vulnerable due to pollution, and Blue Origin’s wastewater discharge threatens to exacerbate this degradation, potentially harming marine life and biodiversity that have evolved over billions of years. Blue Origin, founded by Jeff Bezos and known for its aerospace ventures, operates a launch site at Cape Canaveral, Florida, where it conducts large reusable rocket launches. The company has recently shifted focus to lunar missions, including the Blue Moon lander initiative. Despite its space ambitions, Blue Origin’s environmental practices on Earth are under scrutiny, as the wastewater dumping into the IR
energyenvironmental-pollutionwastewater-treatmentindustrial-wastebiodiversitymarine-ecosystemsconservationCould BYD’s Manchester City Partnership Indicate A Scandinavian Sales Offensive? - CleanTechnica
The article discusses BYD’s recent partnership with Manchester City, highlighting the involvement of star player Erling Haaland, a prominent Norwegian forward known for his exceptional scoring ability and popularity in Scandinavia. Haaland’s stature and playing style challenge traditional soccer norms, making the sport more exciting and potentially increasing BYD’s brand visibility in the region through this high-profile association. The partnership appears to be part of BYD’s broader marketing strategy, possibly signaling an upcoming sales push in Scandinavian markets. Although some BYD vehicles featured in promotional materials, including those seen with the players, have not yet been launched in Europe, the company’s new product lineup combined with significant marketing efforts could drive growth if leveraged effectively. The article implies that while product quality remains crucial, the Manchester City collaboration could enhance BYD’s market presence and sales prospects in Scandinavia.
energyelectric-vehiclesBYDclean-technologyautomotive-industrysustainable-transportationmarketing-strategyRecord Low Snow in the West Will Mean Less Water, More Fire, and Political Chaos
Western US states are experiencing record low snowpack levels, threatening the water supply for 40 million people across seven states reliant on the Colorado River Basin. Climate scientist Daniel Swain warns that unless there is a significant late-season snowstorm, the current deficit—which is about half the normal snowpack for mid-February—could exacerbate ecological and political crises in the region. Warm winter temperatures have led to precipitation falling as rain rather than snow, reducing snowpack accumulation despite steady or above-average precipitation in some areas. This "snow drought" undermines the natural water storage that snowpack provides, which typically melts in spring to replenish streams and reservoirs. The consequences of low snowpack extend beyond water shortages. Forests dry out more quickly, increasing vulnerability to wildfires, which in turn can further reduce the landscape’s ability to retain snow. The snowpack crisis compounds ongoing challenges in managing the Colorado River, where century-old water-sharing agreements—based on overestimated river flows—are being renegotiated amid
energyclimate-changewater-resourcessnowpackdroughtwildfireenvironmental-impactThe SEC closed its investigation into Fisker
The Securities and Exchange Commission (SEC) closed its investigation into the bankrupt electric vehicle startup Fisker in September 2025, about a year after the probe began. The investigation was initially disclosed in October 2024 during Fisker’s bankruptcy proceedings, with the SEC having issued subpoenas and indicating the possibility of further document requests. However, details on the investigation’s depth or findings remain unclear, as the SEC declined to comment and Fisker’s founder did not respond to inquiries. Fisker had filed for bankruptcy in June 2024 amid financial struggles and challenges with its Ocean SUV, ultimately liquidating assets through Chapter 11 proceedings. This closure occurs amid a broader decline in SEC enforcement actions during President Trump’s second term, with 2025 seeing the lowest number of enforcement actions in a decade and a significant drop in monetary settlements compared to 2024. Fisker was among the last electric vehicle startups under SEC scrutiny, following settlements with companies like Nikola, Lordstown Motors, and Canoo.
energyelectric-vehiclesSEC-investigationFiskerbankruptcyEV-startupsautomotive-technologyUS scientists swap neutrons for LEDs to build glowing nuclear reactor
US scientists at Idaho National Laboratory (INL) have developed ViBRANT (Visual Benign Reactor as Analog for Nuclear Testing), a glowing surrogate nuclear reactor that uses thousands of LEDs to safely simulate the complex physics of a real reactor core without the hazards of uranium fuel or radiation. Controlled by the Microreactor Automated Control System (MACS), ViBRANT mimics heat and neutron feedback by varying LED intensity and color to represent changes in core temperature and reactivity. This innovative approach provides a visually intuitive, safe platform for studying reactor behavior, accessible even to non-specialists, and accelerates microreactor development by enabling rapid, hands-on experimentation without radiation risks. ViBRANT’s LED-driven core and MACS use the same electromechanical actuators planned for the MARVEL microreactor, a sodium-potassium cooled system designed to produce 85 kW of power for applications like data centers and desalination. The surrogate reactor allows engineers to simulate processes that take MARVEL a full day
energymicroreactornuclear-simulationLEDsautomated-control-systemreactor-physicssensors175 MW Energy Storage Project Launched In Maine - CleanTechnica
Plus Power has launched the Cross Town Energy Storage project in Gorham, Maine, featuring a 175 MW capacity with approximately 350 megawatt-hours of storage and a two-hour duration. This battery system, utilizing Sungrow’s PowerTitan technology, can supply power to around 19,000 homes. It offers fully dispatchable electricity services comparable to conventional power plants but without water usage, emissions, or significant noise, representing a cleaner alternative to aging coal power plants that contribute to climate change and toxic air pollution. Before this project, Maine had about 63 MW of utility-scale energy storage, with a state goal to reach 400 MW by 2030. The initiative aligns with Maine’s broader strategy to attract renewable energy investments, create well-paying green jobs, reduce reliance on fossil fuels, and stabilize energy costs. The project also highlights the potential for pairing large-scale energy storage with solar and wind power to enhance grid reliability and sustainability. Overall, the Cross Town Energy Storage project exemplifies a shift
energyenergy-storagebattery-systemsrenewable-energygrid-electricityclean-energypower-plant-alternativesIs Tesla Really In Trouble This Time? - CleanTechnica
The article from CleanTechnica examines concerns about Tesla’s sales performance at the start of 2026, suggesting the company may be facing significant challenges. Historically, Tesla’s quarterly delivery schedules show slow starts in the first month followed by strong finishes, making early-month sales figures less indicative of overall performance. However, January 2026 sales appear notably weaker compared to January 2025, a period that had mitigating factors such as production pauses for a new Model Y launch and pent-up demand. Early data from 12 European markets and China—the company’s largest market outside the US—indicate a troubling decline, while increased marketing efforts in the US hint at attempts to boost flagging demand amid the loss of the $7,500 EV tax credit. The article also highlights Tesla’s ongoing reliance on the promise of full self-driving (FSD) and robotaxi capabilities to drive future sales growth. Despite nearly a decade of optimistic projections, these technologies have yet to materialize at scale, with coverage still
energyelectric-vehiclesTeslaself-driving-carsEV-marketrobotaxiautomotive-technologyChina Floating Turbine Passes Testing & Completes A Grid-Connected Flight - CleanTechnica
China’s S2000 Stratosphere Airborne Wind Energy System (SAWES), developed by Beijing Lanyi Yunchuan Energy Technology Co., recently achieved a significant milestone by completing a grid-connected test flight in Yibin, Sichuan Province. This megawatt-class airborne wind platform lifts multiple turbine-generator units to about 2,000 meters altitude, where winds are stronger and more consistent than those accessible to traditional turbines. During the January 2026 test, the system generated approximately 385 kilowatt-hours of electricity and successfully synchronized and fed this power into the local grid, demonstrating functional power conditioning, frequency matching, and voltage control necessary for integrating airborne wind energy into terrestrial infrastructure. The S2000 differs from kite-based airborne systems by using static buoyancy from its aerostat envelope to maintain altitude, which simplifies control but presents challenges such as helium retention, envelope durability, and tether material resilience under high-altitude stresses. While the system has a nominal design capacity of up to 3
energyairborne-wind-energygrid-connected-turbinerenewable-energywind-powerenergy-technologymaterials-scienceGiant 6,000-square-feet wing sail to provide 10 percent fuel savings
Oceanbird, a joint venture between Swedish marine technology firm Alfa Laval and shipping company Wallenius Lines, has secured its first commercial order for its innovative Wing 560 wind propulsion technology. The order, placed by an undisclosed shipowner, includes two 6,000-square-feet tiltable wing sails designed primarily for large vessels such as pure car and truck carriers (PCTCs), bulkers, and tankers over 200 meters. Installation is planned for early 2027 in Europe, marking a significant milestone as Oceanbird begins its commercial journey to scale production and serve the global shipping market. The Wing 560 technology can be retrofitted onto existing cargo vessels, enabling them to reduce fuel consumption and emissions. Depending on the vessel and route, fuel savings can reach up to 18 percent with two wing sails, particularly on routes like the North Atlantic, translating into a reduction of up to 111 tons of CO2 emissions. A single wing sail can provide approximately 10 percent fuel and
energyrenewable-energywind-propulsionmaritime-technologyfuel-efficiencysustainable-shippingcarbon-emissions-reductionUS team's fusion plasma heat control method to protect tokamak walls
Researchers at the DIII-D National Fusion Facility have developed a novel method to control destructive energy bursts, known as Edge-Localized Modes (ELMs), which threaten the structural integrity of tokamak fusion reactors. By precisely managing the plasma density in the scrape-off-layer (SOL)—the outermost plasma region interacting with the reactor walls—the team demonstrated suppression of large, damaging instabilities while preserving the high-performance core essential for energy production. This approach addresses the critical challenge of core-edge integration, balancing a hot fusion core with a stable edge to prevent damage to reactor components. Using advanced BOUT++ simulations, the researchers uncovered that increasing SOL density fundamentally alters plasma behavior, stabilizing the large-scale "peeling-ballooning modes" responsible for severe ELMs. Instead of infrequent, massive bursts, the plasma exhibits frequent, small, benign energy pulses that induce harmless turbulence, thereby protecting the reactor walls without compromising core pressure or efficiency. Experimental validation confirmed that shaping the SOL density profile can reliably maintain this
energyfusion-energyplasma-controltokamakfusion-reactorenergy-burstscore-edge-integrationRocket Lab announces new Mach 20 hypersonic test launch from Virginia
Rocket Lab is set to launch a hypersonic test mission later this month using its HASTE rocket, a modified version of the company’s Electron small-lift orbital rocket, tailored for suborbital hypersonic testing. The mission, conducted for the U.S. Defense Innovation Unit (DIU), will carry Hypersonix Launch Systems’ DART AE, a hydrogen-fueled scramjet-powered hypersonic demonstrator. This marks Rocket Lab’s fourth hypersonic test flight in under six months, with HASTE capable of reaching speeds up to Mach 20, a commercial industry first. The rocket’s design aims to reduce the cost of hypersonic testing, making it more accessible to both research institutions and commercial clients. The launch will occur from Rocket Lab’s Launch Complex 2 at the Mid-Atlantic Regional Spaceport in Virginia. HASTE can lift up to 700 kg to suborbital space, more than double the payload capacity of the standard Electron rocket to low
energyhypersonic-technologyrocket-launchhydrogen-fuelaerospace-materialsscramjethigh-temperature-alloysUS: Powerful X-rays capture fusion plasma instability in a first
Researchers at SLAC National Accelerator Laboratory have, for the first time, captured detailed real-time images of a plasma instability known as the current filamentation instability in high-density plasmas. Using SLAC’s powerful Linac Coherent Light Source (LCLS) X-ray laser, the team developed a novel experimental platform that overcomes the challenge of imaging dense plasmas, which are opaque to conventional methods. By firing a high-intensity laser at thin wire targets to create dense plasma and then using ultrafast X-ray pulses to take snapshots every 500 femtoseconds, the researchers visualized micrometer-scale filament patterns formed by the interaction of hot and cold electron streams. This breakthrough provides unprecedented insight into how such instabilities form and evolve, which is crucial for improving the efficiency of fusion reactions and understanding cosmic plasma phenomena. The study also revealed that the instability generates extremely strong magnetic fields—around 1,000 Teslas—far exceeding typical magnetic field strengths on Earth. These intense fields are similar to
energyfusion-energyplasma-instabilityX-ray-laserhigh-density-plasmainertial-fusionSLAC-National-Accelerator-LaboratoryChina’s stealth nuclear attack submarine spotted in satellite images
Satellite imagery has revealed what is believed to be China’s first next-generation Type 09V (095) nuclear-powered attack submarine, marking a major advancement in the modernization of the People’s Liberation Army Navy’s undersea fleet. The submarine was recently moved into a launch bay at the Bohai Shipbuilding facility in Huludao, where China builds its nuclear submarines. Initial images suggested it might be an upgraded Type 093B, but higher-resolution photos showed design features consistent with a new class, including a larger and wider hull estimated at 12 to 13 meters in beam and about 110 to 115 meters in length. This wider hull likely increases submerged displacement to around 9,000–10,000 tons, a significant jump from the roughly 7,000 tons of earlier Shang-class submarines. Key design changes include the first use of an X-shaped stern rudder configuration on a Chinese nuclear submarine and hull-mounted retractable dive planes instead of sail-mounted control surfaces. The hull
energynuclear-powersubmarine-technologymilitary-materialspropulsion-systemsstealth-technologynaval-engineeringUS firm's mass-producible Kaleidos nuclear reactor gets key approval
Radiant, a US-based manufacturer of portable nuclear microreactors, has received critical approval from the Department of Energy (DOE) for its DOE Authorization Request for Kaleidos (DARK). This approval, serving as a Preliminary Documented Safety Analysis (PDSA), is the second of three safety milestones under the DOE’s Authorization Pathway for Nuclear Facilities and enables Radiant to proceed toward a full-power test of its 1-megawatt electric Kaleidos microreactor. The reactor, designed for diverse environments, produces 1.9 megawatts of thermal power and features an innovative cooling system that uses fans and an air jacket for natural convection, eliminating the need for on-site water. The Kaleidos units are portable, fitting within standard shipping containers for transport by truck or aircraft, and have a 20-year lifespan. Radiant plans to produce 50 Kaleidos units annually at its upcoming R-50 factory in Oak Ridge, Tennessee, aiming for a commercial release in 202
energynuclear-reactormicroreactorportable-energyadvanced-nuclear-systemsDOE-approvalenergy-resilienceSimulations show gyroscopes can generate electricity from ocean waves
Researchers at the University of Osaka have developed a novel gyroscopic wave energy converter (GWEC) that efficiently harvests electricity from ocean waves across a broad range of wave frequencies, overcoming a key limitation of conventional wave energy converters (WECs). Unlike traditional WECs, which operate effectively only within narrow wave conditions and thus struggle with the ocean’s constantly changing waves, the GWEC uses a spinning flywheel inside a floating structure. The gyroscopic precession of this flywheel—its change in spin direction when subjected to external forces—enables continuous energy generation even as wave frequencies vary, maintaining high energy absorption. Using linear wave theory, the researchers modeled the interactions between ocean waves, the floating body, and the gyroscope to optimize control parameters for the flywheel and generator. Their simulations demonstrated that the GWEC can achieve a maximum energy absorption efficiency of 50% across a wide range of frequencies, not just at a single resonant frequency. This tunability and broadband efficiency suggest that gy
energyrenewable-energywave-energygyroscopeenergy-harvestingocean-waveswave-energy-converter7 electronic warfare innovations quietly disrupting battlefields
The article highlights seven key innovations in electronic warfare (EW) that are transforming modern battlefields by targeting the electromagnetic spectrum critical to communications, navigation, and sensing systems. Among these, High-Power Microwave (HPM) systems use intense microwave pulses to disrupt or permanently damage electronic circuits, effectively disabling multiple drones or electronic systems simultaneously without physical destruction. Cognitive electronic warfare systems leverage artificial intelligence and machine learning to sense, learn, and respond to threats in real time, shifting EW from static jamming to dynamic, adaptive countermeasures. Digital Radio Frequency Memory (DRFM) technology enables precise deception by intercepting and manipulating enemy radar signals to create false targets, fundamentally changing EW tactics from brute-force interference to sophisticated misdirection. The article also emphasizes the vulnerability of Positioning, Navigation, and Timing (PNT) systems like GPS, which are crucial for modern military operations. Large-scale jamming and spoofing threaten drones, precision weapons, and satellite communications, prompting advances in countermeasures such as encrypted
energyelectronic-warfarehigh-power-microwavecognitive-systemsAIdirected-energysignal-disruptionVinFast Teases Limo Green Electric MPV in Philippines, Formal Launch Expected in 1st Quarter - CleanTechnica
Vietnamese electric vehicle manufacturer VinFast is previewing its VF Limo Green electric MPV in the Philippines, targeting the seven-seat multi-purpose vehicle segment. Although the model has not been formally launched, it has been shown to the market and made available for test drives by select content creators. The VF Limo Green is designed for both private buyers and fleet operators, particularly focusing on high-utilization sectors such as ride-hailing, shuttle services, and institutional transport. The vehicle features a three-row, seven-seat configuration, powered by a 60.13 kWh battery and a single electric motor delivering about 201 horsepower and 280 Nm of torque, with a claimed driving range of up to 450 kilometers under the NEDC cycle. The VF Limo Green supports DC fast charging, capable of charging the battery from 10% to 70% in approximately 30 minutes. Pricing reportedly starts at around PHP 1.099 million (~$18,500), with a subscription model including
energyelectric-vehiclebattery-technologyEV-chargingsustainable-transportationVinFastelectric-MPVFusion startup Helion hits blistering temps as it races toward 2028 deadline
Helion, a fusion energy startup based in Everett, Washington, has achieved a significant milestone by heating plasmas inside its Polaris prototype reactor to 150 million degrees Celsius—about 75% of the temperature it believes necessary for commercial fusion power. The company is the first fusion firm to operate using deuterium-tritium fuel, which has led to a dramatic increase in fusion power output in the form of heat. Helion’s reactor design, known as a field-reversed configuration, differs from the more common tokamak approach by compressing plasma in an hourglass-shaped chamber and generating electricity directly from the fusion reaction’s magnetic fields, rather than extracting heat. Helion aims to reach 200 million degrees Celsius to optimize power plant operation and plans to transition to deuterium-helium-3 fuel, which produces more charged particles conducive to its direct electricity generation method. Unlike many fusion startups targeting the early 2030s for grid electricity, Helion has a contract with Microsoft to supply
energyfusion-powerHelionfusion-reactorclean-energyplasma-physicscommercial-fusionTesla's Sales in China Drop 45% Year over Year - CleanTechnica
Tesla's electric vehicle sales in China experienced a significant decline in January 2026, dropping 45% year over year. This decrease marks Tesla's lowest sales volume in China since November 2022. The downturn in China contrasts with a 23% sales decline across 12 European markets during the same period. Tesla delivered only 18,485 vehicles in China in January 2026, down sharply from 33,703 in January 2025 and a steep 80.3% decrease from the company's peak sales month of 93,843 vehicles. Despite the domestic sales slump, Tesla's Shanghai factory exports surged, reaching the company's second-best export volume ever with 50,644 vehicles shipped abroad. This export performance suggests Tesla may be shifting focus to international markets to compensate for weakening consumer demand in China and other regions such as Canada. The article highlights Tesla's current challenge of navigating collapsing demand while leveraging its manufacturing capacity to maintain overall sales momentum.
energyelectric-vehiclesTeslaChina-marketrenewable-energyEV-salesautomotive-industryUsing Taxpayer Money, Trump Bails Out Coal Power Plants in Kentucky, Ohio, West Virginia, & North Carolina - CleanTechnica
The article from CleanTechnica criticizes the Trump administration for using taxpayer money to bail out aging and inefficient coal power plants in Kentucky, Ohio, West Virginia, and North Carolina. Originally intended to support energy resiliency, efficiency, and greenhouse gas reductions in rural communities, these funds have instead been redirected to prop up coal plants such as Ohio’s Cardinal and OVEC Kyger Creek plants, as well as Kentucky’s Ghent Generating Station. This move is framed as part of a broader pattern of rollbacks on environmental protections, including revoking the EPA’s greenhouse gas endangerment finding and weakening mercury and air toxics standards, which threatens public health and the environment. The article highlights the financial burden these bailouts place on taxpayers and electric customers, noting that past coal plant subsidies in Ohio, like those under House Bill 6, cost residents hundreds of millions before repeal. Critics argue that these bailouts primarily benefit coal plant owners rather than the public, perpetuating pollution and delaying the transition to
energycoal-power-plantsfossil-fuelsenergy-policyenvironmental-impactclimate-changeenergy-bailoutElectric Vehicle Sales Fell As Hybrid Vehicle Sales Continued To Rise In 2025 - CleanTechnica
In 2025, approximately 22% of light-duty vehicles sold in the United States were electrified, including hybrid electric vehicles (HEVs), battery electric vehicles (BEVs), and plug-in hybrid electric vehicles (PHEVs), up from 20% in 2024. However, while hybrid vehicle sales continued to rise, sales of battery electric and plug-in hybrid vehicles declined. This decline was notably influenced by the expiration of federal tax credits for new electric vehicle purchases on September 30, 2025. BEV market share peaked at 12% in September but dropped to below 6% in the subsequent months. The tax credit expiration affected both luxury and non-luxury BEV sales similarly, with BEVs representing 23% of luxury vehicle sales, despite luxury vehicles comprising only 14% of the total market. Unlike BEVs and PHEVs, hybrids do not plug into the grid and thus do not directly increase electricity demand; they were also not eligible for
energyelectric-vehicleshybrid-vehiclesbattery-electric-vehiclesplug-in-hybridstax-creditsclean-energyXiaomi Targeting 550,000 Sales This Year - CleanTechnica
Xiaomi, traditionally known for its smartphones, has rapidly emerged as a significant player in the electric vehicle (EV) market since launching its first model 22 months ago. The company has already sold around 600,000 EVs, with its YU7 model becoming the top-selling vehicle in China in January 2026, accounting for nearly all of the 39,002 vehicles sold that month. The YU7 has achieved remarkable success, selling 150,000 units within six months—more than double the sales of Xiaomi’s initial SU7 model. In 2025, Xiaomi exceeded its internal delivery target by selling over 410,000 EVs, with December marking a record month of over 50,000 deliveries. Looking ahead, Xiaomi plans to continue its growth trajectory by launching an updated version of the SU7, which offers an impressive range of up to 902 km (560 miles) and is expected to be priced between 229,900 yuan ($33,315)
energyelectric-vehiclesXiaomiEV-salesclean-technologybattery-rangenew-energy-vehiclesSolar molecule locks sunlight in bonds, beats lithium-ion density
Chemists at UC Santa Barbara have developed a novel molecule based on a modified organic compound called pyrimidone that can capture sunlight and store it chemically for years, releasing the stored energy as heat powerful enough to boil water. This innovation belongs to the field of Molecular Solar Thermal energy storage (MOST), which differs from traditional solar panels by storing solar energy directly within molecular bonds rather than converting it to electricity. The molecule functions like a mechanical spring: it twists into a high-energy, strained configuration upon sunlight exposure and remains stable until triggered by heat or a catalyst to release the stored energy as heat. This process is reversible and recyclable, allowing repeated use without bulky batteries or complex infrastructure. Inspired by DNA components that undergo reversible changes under UV light, the researchers engineered a compact, lightweight molecule optimized for stability and energy storage. Computational modeling helped understand how the molecule maintains its high-energy state over time. The molecule achieves an energy density exceeding 1.6 megajoules per kilogram, roughly double that of typical
energysolar-energy-storagemolecular-solar-thermalrenewable-energychemical-energy-storagelithium-ion-alternativesustainable-materialsUS' blended wing aircraft to get double-decker setup with new funding
Natilus, a San Diego-based aerospace company, has redesigned its blended wing aircraft, Horizon Evo, transitioning it from a single-deck to a dual-deck platform. This change follows feedback from the Federal Aviation Administration (FAA) and global airline customers, aiming to enhance practicality, passenger experience, safety, and operational flexibility. The dual-deck design increases overhead storage, offers more window seats, and supports multiple aisles in both premium and economy cabins, facilitating better passenger flow and loading. Importantly, the aircraft maintains compatibility with existing airport infrastructure and can carry standard air-freight containers on its lower deck. The blended-wing body (BWB) design merges the fuselage and wings into a single lifting surface, reducing drag and improving fuel efficiency compared to conventional tube-and-wing aircraft. Natilus targets a 30% reduction in fuel usage and a 50% cut in carbon emissions and operational costs. With $28 million raised in Series A funding, the company plans to complete the first
energyaviationaircraft-designblended-wing-bodyfuel-efficiencyaerospace-materialstransportation-innovationSierra Club Statement on Trump Administration’s Elimination of the EPA’s Endangerment Finding - CleanTechnica
The Trump administration announced a rule revoking the Environmental Protection Agency’s (EPA) longstanding greenhouse gas endangerment finding under the Clean Air Act, a move that the Sierra Club condemns as a blatant attack on public health and climate policy. The 2009 endangerment finding, which was based on extensive scientific evidence and upheld unanimously in federal court, established the EPA’s authority to regulate greenhouse gas emissions from major sources like motor vehicles and power plants. This finding was a critical legal foundation for federal climate standards and followed the Supreme Court’s 2007 decision in Massachusetts v. EPA, which confirmed that the Clean Air Act covers greenhouse gas pollution. Sierra Club Executive Director Loren Blackford criticized the administration for prioritizing polluter profits over public health and the environment, warning that eliminating these federal standards will exacerbate climate change impacts, increase costs, and jeopardize future generations. The Sierra Club, which has a long history of legal advocacy for climate protections dating back to 2002, is exploring
energyenvironmental-policyclimate-changegreenhouse-gas-emissionsEPA-regulationsClean-Air-Actrenewable-energyTrump Administration Guts Clean Vehicle Standards and Wipes Out Longstanding Climate Finding - CleanTechnica
The Trump administration, through Lee Zeldin, finalized a federal regulation that dismantles the Environmental Protection Agency’s (EPA) greenhouse gas emission standards for light-, medium-, and heavy-duty vehicles. This rollback also eliminates the EPA’s 2009 “endangerment finding” (EF), a critical scientific determination that greenhouse gases such as carbon dioxide and methane pose a threat to public health and welfare. Despite overwhelming public opposition—over 97% of testifiers at a recent hearing opposed the proposal—the administration proceeded, prioritizing fossil fuel and certain auto industry interests over environmental and public health protections. The endangerment finding had provided the EPA with the legal authority to regulate vehicle emissions, which are the largest source of U.S. climate pollution. The Sierra Club, a leading environmental organization, condemned the rollback as a dangerous step that undermines decades of progress in reducing vehicle pollution and combating climate change. They emphasized that the transportation sector accounts for the largest share of greenhouse gas emissions in the U.S.,
energyclean-vehiclesgreenhouse-gas-emissionsclimate-changeEPA-regulationselectric-vehiclestransportation-sectorRivian was saved by software in 2025
In 2025, Rivian’s overall revenue grew by 8% to $5.38 billion, driven primarily by a significant increase in software and services revenue, which more than tripled to $1.55 billion. This growth was largely fueled by a joint venture with Volkswagen Group, established in 2024, through which Rivian supplies VW with its electrical architecture and software technology. The milestone-based JV resulted in a $1 billion payout to Rivian in 2025, with additional payments expected through 2027, including a projected $2 billion capital infusion in 2026 contingent on successful winter testing and other conditions. In contrast, Rivian’s automotive revenue declined 15% to $3.8 billion, impacted by lower vehicle deliveries and a drop in regulatory credit sales, although higher average selling prices partially offset these declines. Looking ahead, Rivian’s financial outlook for 2026 hinges on the launch and production ramp of its next EV model, the R2 SUV,
energyelectric-vehiclesautomotive-softwareRivianjoint-ventureVolkswagenEV-technologyMusk needed a new vision for SpaceX and xAI. He landed on Moonbase Alpha.
The article discusses Elon Musk’s evolving vision for SpaceX and his AI company xAI following their merger and upcoming IPO. Rather than focusing solely on artificial general intelligence (AGI) or deep learning breakthroughs, Musk has shifted to an ambitious concept centered on building a Moonbase Alpha. This lunar city would serve as a manufacturing hub for space-based AI computers, which could then be launched into deep space using a mass driver—a large electromagnetic accelerator akin to a maglev train. Musk envisions this as a way to harness a significant fraction of the Sun’s energy, potentially enabling AI systems of unprecedented scale and capability. This new vision marks a departure from Musk’s earlier focus on Mars colonization, a goal SpaceX has publicly de-emphasized due to technical and financial challenges, including the cancellation of plans to use the Dragon spacecraft as a Mars lander. The Moonbase concept fits into Musk’s broader narrative strategy of inspiring employees and investors with grand, science-fiction-like goals. It also aligns with the
energyspace-explorationlunar-baseSpaceXAI-satellitesrenewable-energymass-driverVolkswagen Group Produces 5 Millionth Electric Drive Unit - CleanTechnica
Volkswagen Group has reached a significant milestone by producing its 5 millionth electric drive unit across multiple factories worldwide, including plants in Győr, Kassel, Tianjin, and Zuffenhausen. This achievement highlights the Group's systematic expansion of e-mobility and the strength of its integrated technology and production network. Notably, the Kassel plant alone increased its electric drive production by about 24% year-on-year in 2025, reaching over 850,000 units. The milestone underscores Volkswagen’s commitment to scaling electric vehicle (EV) technology across its brands and regions. A key highlight is the development of the APP550 electric drive, the Group’s most popular powertrain used in models like Volkswagen’s ID family, Škoda Enyaq, and CUPRA Tavascan. Over one million APP550 units have been produced, delivering up to 240 kW and 560 Nm with improved efficiency—consuming 20% less energy while increasing torque and power by
energyelectric-vehicleselectric-drive-unitsVolkswagenelectric-powertrainautomotive-technologye-mobilityKenya Power Says Consumption From EV Charging Was Up 188% In Kenya In 2025 - CleanTechnica
In 2025, electricity consumption from Kenya Power’s E-Mobility tariff customers surged by 188%, rising from approximately 2.9 million kWh in 2024 to 8.4 million kWh. This increase translated into revenue growth from about KShs. 64.8 million ($502,660) to KShs. 190.8 million ($1.48 million). Currently, 205 customers are connected to the E-Mobility tariff, which charges KShs. 16/kWh during peak hours and KShs. 8/kWh off-peak. However, actual EV electricity consumption may be higher since not all EV users are on this tariff. Kenya has over 35,000 registered electric vehicles, predominantly electric motorcycles (around 33,000), which accounted for 15.3% of new motorcycle registrations in 2025 amid a booming motorcycle market. Kenya Power is actively supporting EV adoption by operating its own fleet of
energyelectric-vehiclesEV-chargingKenya-Powerrenewable-energyelectric-motorcyclesE-Mobility-tariffTrump administration undermines EPA enforcement of Clean Air Act
The Trump administration has officially repealed the EPA’s 2009 “endangerment finding,” which had determined that greenhouse gases like carbon dioxide and methane pose a threat to human health and welfare. This finding was the legal foundation for the EPA’s regulation of greenhouse gas emissions under the Clean Air Act. Although the repeal currently affects only car and truck tailpipe emissions, it is anticipated to be the first step in a series of rollbacks on federal air pollution regulations. However, fully repealing the endangerment finding will require a lengthy regulatory process similar to the original two-year procedure. EPA Administrator Lee Zeldin’s action is expected to slow the decline in emissions by about 10%, potentially increasing pollution levels. Environmental advocates, such as Fred Krupp of the Environmental Defense Fund, warn that this move will lead to more pollution, higher costs, and tangible harms to American families. Experts also highlight the broader consequences of unabated climate change, including increased mortality rates and economic damages projected to reach approximately
energyclean-air-actEPAgreenhouse-gasescarbon-dioxidemethaneair-pollution-regulationsSolid-State Battery Milestones Appear Encouraging For Near Future - CleanTechnica
The article highlights recent advancements and milestones in solid-state battery (SSB) technology for electric vehicles (EVs), emphasizing the potential benefits of SSBs over traditional lithium-ion and lithium iron phosphate batteries. Solid-state batteries offer advantages such as reduced risk of combustion, faster charging, and longer driving ranges. Several key developments include Karma Automotive partnering with Factorial Energy to initiate the first US solid-state battery production program, Volkswagen-backed QuantumScape launching a production line, and Mercedes achieving a 749-mile range on a test vehicle using lithium metal solid-state batteries. Looking ahead, automakers like Toyota, Chery, BYD, Nissan, and BMW have plans to introduce or pilot solid-state batteries between 2026 and the 2030s, although some timelines remain uncertain. The article also discusses the evolving battery market landscape over the next decade, predicting a hierarchy where solid-state batteries will compete alongside lithium-ion, lithium iron phosphate, nickel/manganese, and sodium-ion batteries. Initially, solid
energysolid-state-batterieselectric-vehiclesbattery-technologylithium-ionEV-marketbattery-manufacturingAutomotive Press Heaps Praise On Toyota Highlander EV - CleanTechnica
Toyota recently unveiled the next-generation Highlander as a fully battery-electric vehicle (BEV), surprising many given the company's previous slow adoption of electric cars. The Highlander EV offers two battery options: a standard 77 kWh pack with an EPA range of 287 miles, and an optional 96 kWh pack extending range to 320 miles. The entry-level XLE model features a front-wheel-drive single motor producing 221 horsepower, while the all-wheel-drive (AWD) versions add a rear motor for a combined 338 horsepower. The drivetrain shares components with Toyota’s smaller bZ electric SUV, both built on the TNGA-K platform. AWD models also include terrain-specific drive modes and Crawl Control for low-speed maneuvering. The Highlander EV supports modern charging technologies, including NACS ports, Plug and Charge, and an 11 kW onboard charger enabling Level 2 charging in about 6 to 8 hours depending on battery size. It also offers vehicle-to-load (V
energyelectric-vehiclesbattery-technologyToyota-Highlander-EVEV-chargingvehicle-to-loadclean-energyUS Navy plans Trump-class warships armed with lasers and hypersonics
The US Navy is advancing plans to equip the upcoming Trump-class battleships with cutting-edge directed energy (DE) weapons, including high-energy lasers and hypersonic missiles, marking a significant shift toward operationalizing laser systems fleet-wide. Chief of Naval Operations Admiral Daryl Caudle strongly supports this initiative, viewing the Trump-class vessels as a critical “forcing function” to accelerate the integration of laser weapons both on ships and at shore bases. This push follows former President Donald Trump’s December 2025 announcement of a new battleship program under the ‘Golden Fleet’ concept, promising ships that are larger and more powerful than current destroyers, with advanced armaments like electromagnetic railguns and high-energy lasers. While the Navy has experimented with laser weapons for over a decade, widespread deployment has been limited. Currently, the USS Preble is outfitted with Lockheed Martin’s HELIOS system designed to counter drones and ISR threats, and other destroyers carry lower-powered ODIN lasers for sensor disruption. Successful
energydirected-energy-weaponslaser-technologyhypersonic-missileselectromagnetic-railgunsnaval-defense-systemsmilitary-technologyEurope's most powerful rocket to launch with four boosters for Amazon
Europe is set to launch its most powerful rocket to date, the Ariane 64, from French Guiana. This mission, designated VA267 (LE-01 for Amazon Leo), marks the first flight of the Ariane 6 rocket in its full four-booster configuration and its inaugural commercial payload delivery. The rocket will deploy 32 Amazon Leo satellites into low Earth orbit, supporting Amazon’s broader plan to deploy over 3,200 satellites for its Starlink-competitive constellation, with 18 Ariane 6 launches already booked. The Ariane 64 configuration, featuring four boosters, can carry more than 20 metric tons to orbit and produces 3.5 million pounds of thrust at launch, making it Europe’s most powerful rocket, though still less powerful than SpaceX’s Falcon Heavy and Starship. The rocket is built collaboratively by 13 European Space Agency member nations and over 600 subcontractors. Designed to reduce operating costs by half compared to its predecessor Ariane 5,
energyrocket-launchAriane-6satellite-deploymentspace-technologypropulsion-systemsaerospace-engineeringNew cold-resistant EV battery from US maintains power even at -40°F
Researchers at Texas A&M University, led by Dr. Jodie Lutkenhaus, have developed a new polymer-based electric vehicle (EV) battery designed to maintain power even in extreme cold temperatures as low as -40°F (-40°C). This innovation addresses a critical limitation of current lithium-ion batteries, which rely on liquid electrolytes that freeze and stop functioning in severe cold, as seen during the 2024 polar vortex in Chicago when many EVs failed. The new battery replaces the traditional liquid electrolyte with a diglyme-based electrolyte that remains liquid at low temperatures and substitutes rigid inorganic electrodes with flexible redox-active polymers, allowing ion movement and battery operation in freezing conditions. In addition to improved cold-weather performance—retaining 85% capacity at 0°C and 55% at -40°C—the researchers enhanced durability by integrating carbon-fiber weaves as structural components, reducing weight and preventing mechanical cracking. This "structural battery" design not only stores energy but also provides physical strength to
energyelectric-vehicle-batterycold-resistant-batterypolymer-batterylithium-ion-batteryenergy-storagebattery-technologyEclipse backs all-EV marketplace Ever in $31M funding round
Ever, a startup positioning itself as the first “AI-native, full-stack auto retail business” for electric vehicles (EVs), has raised $31 million in a Series A funding round led by Eclipse, with participation from Ibex Investors, Lifeline Ventures, and JIMCO. The company aims to simplify the complex process of buying and selling used EVs through a digital-first platform that integrates an AI-powered orchestration layer to manage the numerous workflows involved in vehicle transactions. This approach contrasts with existing solutions that rely on multiple single-point tools, offering instead a unified customer experience that reduces friction and boosts sales team productivity by two to three times. Ever combines its online marketplace with physical locations to address the importance of in-person vehicle inspection, especially for first-time EV buyers. While early user feedback has been mixed, with some praising the ease of EV purchasing and others noting communication challenges, Ever’s CEO Lasse-Mathias Nyberg views these as growing pains as the company refines its system. The
energyelectric-vehiclesAIautomotive-retaildigital-marketplaceEV-marketplacestartup-fundingPhotos: New 2027 Toyota Highlander goes fully electric with 320 mile-range
Toyota has announced that the 2027 Highlander will transition to a fully electric SUV, marking the brand’s first three-row battery electric vehicle (BEV) in the U.S. This model, launching in late 2026, eliminates gasoline and hybrid powertrains entirely, offering a midsize SUV designed for families, daily driving, and long trips. The Highlander EV will be available in two trims—XLE and Limited—with the XLE offering front-wheel-drive (FWD) and all-wheel-drive (AWD) options, while the Limited is AWD only. Toyota provides two battery options: a 77.0 kWh pack delivering up to 287 miles of range (FWD) or 270 miles (AWD), and a larger 95.8 kWh battery in AWD models extending range to an estimated 320 miles. The Highlander EV supports fast charging via the North American Charging Standard (NACS) connector, enabling 10 to 80 percent DC fast
energyelectric-vehiclebattery-technologyfast-chargingToyota-Highlanderelectric-SUVelectrificationNext-gen nuclear reactor with 968°F high-temp output advances with deal
The EAGLES Consortium and French company newcleo have partnered to develop the LEANDREA technology demonstrator, focusing on the EAGLES-300, a lead-cooled small modular reactor (SMR) designed entirely within the European scientific and industrial ecosystem. Scheduled for completion in 2034 at the Belgian Nuclear Research Centre (SCK CEN) in Mol, the EAGLES-300 aims to support Europe’s goals of energy sovereignty, responsible resource management, and reduced high-level nuclear waste. This reactor uses liquid lead coolant, enabling operation at high temperatures (520°C/968°F) and low pressures, with a power output of 300 MWe. Its design incorporates passive safety systems capable of maintaining safe operation for over 72 hours without human intervention, and it supports efficient fuel use and compatibility with a closed fuel cycle. The high-temperature output also allows for electricity generation and industrial applications like hydrogen production. The LEANDREA facility will serve both as a technology demonstrator for lead-co
energynuclear-reactorsmall-modular-reactorlead-cooled-reactorhigh-temperature-outputpassive-safety-systemshydrogen-productionUltra-thin batteries to power new tsunami warning balloon system
Japan’s Tohoku University, in collaboration with NGK Insulators, is developing an innovative tsunami disaster-prevention system called the Tsunami Balloon Project. This system automatically deploys balloon markers into the sky upon receiving tsunami warnings via Japan’s Quasi-Zenith Satellite System (QZSS) “Michibiki.” The balloons inflate rapidly to a height of 40 meters and are illuminated by NGK’s ultra-thin, compact lithium-ion rechargeable battery, EnerCera, which powers high-intensity LED lights. These illuminated balloons serve as clear, visual guides to evacuation shelters, especially crucial during nighttime or poor visibility conditions. The project targets the Nankai Trough region, a submarine trench along Japan’s Pacific coast with a high probability (60-90%) of experiencing a magnitude 8.0 to 9.0 megaquake within the next 30 years. Given that tsunamis here could arrive within 10 minutes, the system aims to provide immediate, intuitive evacuation cues
energybattery-technologytsunami-warning-systemdisaster-preventionlithium-ion-batteryemergency-lightingevacuation-technologyUS lab tests fusion materials for strong nuclear reactor 'blanket'
Researchers at Oak Ridge National Laboratory (ORNL) have centralized their nuclear materials research in a new Translational Research Capability building to focus on the development of materials for fusion reactor blankets. These blankets, crucial components in magnetic confinement fusion devices like tokamaks and stellarators, must withstand harsh environments created by molten salts and liquid metals used as heat-transfer fluids. While these fluids enable high operating temperatures at low pressures, they also cause corrosion and material degradation, posing significant challenges. ORNL’s Corrosion Science and Technology Group is investigating how structural materials respond to these conditions, including the effects of neutron irradiation, mechanical stress, and atomic-level changes that can lead to embrittlement and cracking. The fusion blanket serves multiple purposes: absorbing heat and neutron energy to generate electricity and produce fuel on-site. Although fusion research has traditionally emphasized plasma sustainability, the blanket’s complex material interactions require dedicated study, especially regarding the incorporation of molten salts. ORNL leverages decades of expertise from past projects like the Molten Salt
energyfusion-reactornuclear-materialsmolten-saltcorrosion-researchhigh-temperature-materialsreactor-blanketThe Fight Over US Climate Rules Is Just Beginning
The article discusses the imminent rollback of the "endangerment finding," a 2009 EPA ruling that forms the legal and scientific foundation for regulating greenhouse gases under the Clean Air Act. This finding, mandated by the 2007 Supreme Court decision in Massachusetts v. EPA, requires the EPA to regulate air pollutants that threaten public health and welfare, including greenhouse gases. The rollback, driven by right-wing special interest groups over the past 15 years and supported by efforts like those from the Heritage Foundation, represents the most aggressive challenge to US climate regulation to date and is expected to trigger prolonged legal battles likely to reach the Supreme Court. The endangerment finding has historically been difficult to overturn, partly because many industries favored regulatory stability and EPA authority. Even during the Trump administration, EPA leaders resisted repealing the finding despite ideological pressure. The current rollback proposal includes numerous arguments aimed at undermining the scientific basis and legal authority of the finding, such as the claim that global greenhouse gas emissions should not be regulated
energyclimate-changeEPA-regulationsgreenhouse-gasesClean-Air-Actenvironmental-policyUS-climate-rulesWill Trump's Assault on Human Health Matter in Texas? - CleanTechnica
The article from CleanTechnica highlights the Trump administration’s aggressive rollback of environmental protections, particularly focusing on policies that increase pollution and harm human health, with a significant impact expected in Texas. Key actions include the anticipated elimination of the 2009 EPA “Endangerment Finding,” which scientifically established that greenhouse gases like carbon dioxide and methane endanger human health. Additionally, the EPA under Trump and Administrator Lee Zeldin is set to dismantle vehicle emission standards, weaken rules limiting mercury and toxic emissions from power plants, and extend deadlines for coal plants in Texas to reduce heavy metal water pollution. These moves collectively threaten to increase climate-warming pollution and exacerbate health risks for millions of Americans. Environmental advocates, such as representatives from the Sierra Club, emphasize that these policies prioritize the interests of fossil fuel industries over public health, leading to more extreme weather events, higher electricity costs, and increased mortality and illness. Texas, facing hurricanes, floods, droughts, fires, and grid instability, is particularly vulnerable
energyfossil-fuelscoal-powerenvironmental-policyclimate-changepollutionEPA-regulationsNew project could slash EV charging times with 1000V high-voltage tech
A new EU-funded research project called ODYSSEV, launched in early 2026 and involving Dortmund University researchers, aims to drastically reduce electric vehicle (EV) charging times by advancing high-voltage technologies beyond 800 volts, targeting voltages over 1000V. These higher voltages enable ultra-fast charging through thinner cables, which reduces vehicle weight and energy losses, making EVs more practical and appealing to consumers. The project addresses the technical challenges of operating at such high voltages, including enhanced insulation requirements, semiconductor limitations, and battery thermal management during rapid charging. ODYSSEV spans the entire development chain, from creating innovative semiconductors and high-performance power modules to integrating these into key EV components like on-board chargers, traction inverters, and a specially designed electric motor. The project also involves developing a reconfigurable battery pack to form a scalable, efficient drive system. Using advanced modeling and simulation, the team aims to optimize designs before physical prototyping, saving time and costs
energyelectric-vehicleshigh-voltage-technologyfast-chargingsemiconductorspower-moduleselectromobilityTesla Down Dramatically in UK, Norway, Netherlands, Switzerland - CleanTechnica
The article from CleanTechnica analyzes Tesla’s vehicle sales performance across various European markets in January 2026 compared to January 2025. Overall, Tesla experienced a significant decline in several key countries, including the UK (51% drop), the Netherlands (67% drop), Norway (88% drop), and Switzerland (72% drop). These declines also corresponded with notable reductions in Tesla’s EV market share in these regions. Germany saw a slight increase in sales (2%) and market share, while Denmark and Ireland showed little to no change in sales but a decrease in market share. Conversely, Tesla’s sales surged in southern and northern European countries such as Italy (77% increase), Spain (70% increase), Sweden (30% increase), and Finland (286% increase), with corresponding gains in market share in these markets. Despite some localized growth, Tesla’s aggregate sales across the 12 analyzed European countries fell from 6,925 vehicles (5.5% market share) in
energyelectric-vehiclesTeslaEV-marketrenewable-energyautomotive-industryclean-technologyNow Anyone Can Join A VPP, With Or Without Solr Panels
The article discusses the expansion of virtual power plant (VPP) participation to households without rooftop solar panels, highlighting SOLRITE Energy’s recent introduction of a battery-only option in Texas. Traditionally, VPPs allow ratepayers to reduce utility bills by sending electricity from their solar panels or home energy storage to the grid. SOLRITE’s new program, launched on February 11, enables customers to install home energy storage systems from sonnen (a Shell subsidiary) with no upfront costs, paying $20 monthly plus 12¢ per kWh for electricity usage. This battery-only virtual power plant agreement (VPA) opens VPP benefits to a broader audience, with expectations to sign up 10,000 new customers by 2026 and provide 600 MWh of flexible energy to the Texas grid. The program currently serves customers in Houston, Corpus Christi, and McAllen, with savings dependent on individual consumption and local utility rates. The 12¢/kWh rate is competitive compared
energyvirtual-power-planthome-energy-storagesolar-energybattery-storageenergy-gridrenewable-energyReasons For The Legacy EV Retreat - CleanTechnica
The article "Reasons For The Legacy EV Retreat" from CleanTechnica analyzes why traditional Detroit automakers have retreated from electric vehicle (EV) leadership despite substantial subsidies and political support. Historically, these legacy manufacturers consistently sold EVs below their cost of production, resulting in losses exacerbated by cutting corners and costly recalls. They benefited from massive government subsidies intended for EV manufacturing, including tax breaks and facility upgrades, but often repurposed these subsidized assets to produce internal combustion engine (ICE) vehicles instead. This practice highlights a systemic abuse of subsidy programs, facilitated by political narratives framing these incentives as tax breaks rather than direct government support. Furthermore, the article argues that the U.S. market's protectionist policies have blocked competition from more efficient and profitable EV manufacturers, particularly from China, where automakers have successfully produced affordable, profitable EVs that outpace legacy automakers’ offerings. Detroit’s automakers prioritized regulatory compliance over innovation and cost-effective EV design, moving too slowly to compete globally.
energyelectric-vehiclesEV-manufacturingsubsidiesautomotive-industryfossil-fuelsclean-energyMeta starts construction on $10B, 1GW AI data hub in Indiana
Meta has commenced construction on a massive $10 billion data center campus in Lebanon, Indiana, designed to deliver 1 gigawatt (GW) of capacity. This represents one of Meta’s largest infrastructure investments and will be its second data center in Indiana. The facility aims to support both Meta’s core digital platforms and rapidly expanding AI workloads, reflecting the growing demand for high-density, gigawatt-scale computing infrastructure. The campus is planned with long-term scalability and technological evolution in mind, allowing Meta to consolidate services and AI operations without needing separate facilities. The project is expected to create over 4,000 construction jobs at its peak and approximately 300 permanent positions once operational. Meta is also investing in the local community through workforce development initiatives via the Boone County Career Collaborative and committing $1 million annually for 20 years to assist local families with energy bills. Additionally, Meta will fund improvements to local infrastructure, including water systems, roads, and utilities, with over $120 million earmarked for these upgrades
energydata-centerAI-infrastructureclean-energywater-conservationsustainabilityenergy-efficiencyLatvian startup builds nuclear waste-powered system to generate electricity on the moon
Latvian startup Deep Space Energy is developing a compact radioisotope power generator designed to produce the same electrical output as traditional space nuclear systems while using five times less fuel. The system converts heat from radioactive decay—primarily Americium-241 extracted from commercial nuclear waste—into electricity, employing a novel architecture that improves fuel efficiency compared to conventional radioisotope thermoelectric generators (RTGs). The company has raised €350,000 in pre-seed funding and secured €580,000 in public contracts and grants, and has validated the technology in laboratory conditions. This reduction in fuel mass, from about 10 kg to 2 kg for generating 50 W of power, has significant implications for lowering launch costs and increasing payload capacity, especially for lunar missions where every kilogram can cost up to €1 million to send. Deep Space Energy targets applications in satellites operating in Medium Earth Orbit, Geostationary Orbit, and Highly Elliptical Orbit, where solar power is unreliable or insufficient
energynuclear-powerspace-technologyradioisotope-power-generatorsatellite-power-systemslunar-energyDeep-Space-EnergyxAI lays out interplanetary ambitions in public all-hands
xAI publicly shared a 45-minute all-hands meeting video revealing key updates about its organizational changes, product roadmap, and future ambitions. CEO Elon Musk explained that recent layoffs, which included a significant portion of the founding team, were part of a necessary restructuring to support rapid company growth. The company is now organized into four main teams focused on the Grok chatbot, app coding system, Imagine video generator, and the Macrohard project—a broad initiative aimed at simulating computer use and modeling corporations, with ambitions for AI-designed rocket engines. The meeting also highlighted xAI and X platform metrics, with X reportedly surpassing $1 billion in annual recurring subscription revenue, driven by a holiday marketing push. The Imagine tool is said to generate 50 million videos daily and over 6 billion images in the past month, though some of this content includes controversial AI-generated explicit images. The most notable vision Musk shared involves space-based AI infrastructure, including a moon-based factory for AI satellites and a lunar mass driver
energyAI-satellitesspace-based-data-centerslunar-mass-driverinterplanetary-energy-captureAI-infrastructurerenewable-energy-sourcesDonald Trump to Give Coal Industry Another Massive Handout — via Department of Defense - CleanTechnica
The article from CleanTechnica reports that former President Donald Trump, during his second term, planned to provide substantial financial support to the coal industry by directing the Department of Defense to enter contracts to purchase electricity from coal-fired power plants. This move involves hundreds of millions of taxpayer dollars and aims to prop up aging, polluting, and costly fossil fuel power plants, despite the fact that renewable energy sources are now cheaper, cleaner, and better for public health. The article criticizes this policy as forcing American families to pay higher electricity bills while supporting an industry that is being phased out due to environmental and economic reasons. Environmental advocates, including Laurie Williams from the Sierra Club Beyond Coal Campaign, condemned the policy as an illegal bailout for coal industry interests, exacerbating the energy affordability crisis faced by many Americans. The article portrays Trump as prioritizing fossil fuel interests over innovation and clean energy progress, describing his administration as heavily influenced by fossil fuel lobbying. It highlights the contradiction between the United States’ potential as a leader
energycoal-industryfossil-fuelsrenewable-energyDepartment-of-Defenseenergy-policyelectricity-costs2026 B.C. budget needs to protect rebates and incentives that lower energy bills - Clean Energy Canada
As British Columbia prepares its 2026 budget, Clean Energy Canada emphasizes the critical need to protect and expand CleanBC rebates and incentives that help lower household energy bills. Rising home-heating gas costs—up 28.5% in the past year—and forecasts of further increases due to LNG exports are placing significant financial strain on families, especially those with lower incomes or older homes. CleanBC programs, which support home energy upgrades, electric heat pumps, and cleaner transportation options, have been identified by an independent review as essential tools that reduce costs, cut pollution, and support health and jobs. However, uncertainty or cuts to these programs risk delaying investments and increasing expenses for households. The article highlights specific benefits of CleanBC initiatives, such as electric heat pumps that can reduce annual energy bills by hundreds of dollars compared to traditional heating systems, and electric vehicles (EVs) that save thousands annually on fuel and maintenance. Despite these savings, upfront costs and program complexity remain barriers for many families. Therefore, predictable
energyclean-energyrebatesincentiveshome-heatingelectric-heat-pumpselectric-vehiclesSierra Club: Trump’s Latest Environmental Rollbacks Are Yet Another Move To Cut Corners For The Coal And Fossil Fuel Industries - CleanTechnica
The article reports on the Trump Administration’s anticipated environmental rollbacks aimed at supporting the coal and fossil fuel industries. These rollbacks include revoking the Environmental Protection Agency’s (EPA) greenhouse gas endangerment finding under the Clean Air Act, weakening mercury and air toxics standards for power plants, and loosening greenhouse gas emission standards for vehicles. Such measures are expected to prolong the operation of coal plants, increase pollution, and worsen climate impacts. Elayne Coleman, Michigan Chapter Director of the Sierra Club, criticized these rollbacks for undermining environmental protections and public health, particularly highlighting the continued operation of the outdated Campbell coal plant in Michigan. She condemned the administration for prioritizing corporate polluters’ interests over the well-being of communities and clean energy progress. The Sierra Club, as America’s largest grassroots environmental organization, continues to advocate for clean energy, environmental justice, and the protection of natural resources through activism, education, and legal efforts.
energycoal-industryfossil-fuelsenvironmental-policyclean-energygreenhouse-gas-emissionsair-pollutionThe search is on: 2026 Joseph C. Belden Innovation Award nominations are open
The 2026 Joseph C. Belden Innovation Award nominations are now open, inviting groundbreaking technologies and solutions that drive significant impact across connected industries. Named after Joseph C. Belden, a pioneer in telecommunications and connectivity, the award honors innovations that push technological boundaries and shape the future. With a legacy spanning over 120 years, the program recognizes breakthrough advancements in sectors such as manufacturing, energy, healthcare, and telecommunications. This year, the award has expanded its focus to include IT/OT convergence, highlighting solutions that integrate information technology with operational systems—a crucial area for modern industrial and enterprise innovation. Eligible nominees are small- to medium-sized companies (under $500 million in revenue) with products launched after July 1, 2024, and at least one customer deployment. Finalists will be announced in April, and winners gain visibility with industry leaders, networking opportunities, and co-marketing support. The nomination deadline is February 13, 2026.
IoTenergyinnovationIT/OT-convergencetelecommunicationsindustrial-technologyAI-platforms8,000 New EV Chargers To Be Installed In Canada - CleanTechnica
Canada plans to install 8,000 new electric vehicle (EV) chargers at a cost of $84 million, adding to the existing network of approximately 35,000 public chargers. This expansion supports the country's broader goal of accelerating zero-emission vehicle (ZEV) adoption, as outlined in Canada’s 2030 Emissions Reduction Plan. The government aims for 100% of new light-duty vehicle sales to be zero-emission by 2035, with interim targets of at least 20% by 2026 and 60% by 2030. These targets are embedded in the recently finalized Electric Vehicle Availability Standard. Incentives are provided to encourage EV adoption, including a $5,000 rebate for fully electric vehicles and additional incentives for plug-in hybrids. However, the article highlights concerns about plug-in hybrids, noting that many owners do not regularly charge them, resulting in continued fossil fuel use and limited environmental benefits. It suggests that focusing incentives solely on fully electric vehicles might be
energyelectric-vehiclesEV-chargerszero-emission-vehiclessustainable-transportationcarbon-emissionsclean-energy-infrastructureThe Four People At The Center Of The Endangerment Finding Storm In The US - CleanTechnica
The article from CleanTechnica discusses the ongoing efforts within the current U.S. administration to revoke the "endangerment finding," a 2009 EPA determination under the Obama administration that recognized greenhouse gases as pollutants contributing to climate change and thus subject to regulation under the Clean Air Act. This finding originated from the Supreme Court’s 2007 decision in Massachusetts v. EPA, which mandated the EPA to regulate greenhouse gases that endanger public health and welfare. The endangerment finding underpins federal climate regulations targeting emissions from vehicles, power plants, and other industries. Key figures driving the push to dismantle these climate protections include Mandy Gunasekara, Jonathan Brightbill, Russell Vought, and Jeffrey Clark. Gunasekara, formerly an EPA chief of staff under Trump and a staffer for climate skeptic Senator James Inhofe, authored parts of the Project 2025 playbook that informs the current administration’s climate policies. Brightbill is a legal strategist who has spent years opposing climate regulations in
energyclimate-changeEPA-regulationsgreenhouse-gasesClean-Air-Actenvironmental-policycarbon-emissionsUS plans 500kW lunar nuclear reactor in bold 2030 space power push
The US plans to develop and deploy a powerful 500-kilowatt-electric (kWe) nuclear reactor on the Moon by 2030, marking a significant advancement in space power technology. Led by NASA’s Fission Surface Power Initiative and supported by the Idaho National Laboratory (INL), this reactor aims to provide continuous, high-capacity energy to support lunar habitats, industrial operations, communication systems, and resource extraction. This initiative represents a major leap beyond the smaller radioisotope generators traditionally used in space missions, offering a substantial increase in available power to enable more ambitious and sustained human activities on the Moon. A recent INL-funded report outlines three strategic options for US space nuclear leadership: the most ambitious “Go Big or Go Home” approach advocates for a 100–500 kWe reactor program with a 10-year operational lifespan without maintenance; a mid-level “Chessmaster’s Gambit” suggests developing two smaller sub-100 kWe reactors through public-private partnerships; and a cautious alternative focuses
energynuclear-reactorlunar-powerspace-energyNASAfission-surface-powerspace-missionsBYD Launches RWD & AWD Atto 3 EVO In Europe First - CleanTechnica
BYD has launched the revised Atto 3 EVO electric vehicle in Europe ahead of its official release in China, marking a shift in the company’s typical launch strategy. Key upgrades include a switch from a 400 V to an 800 V electrical architecture, boosting charging speed from 88 kW to 220 kW, and an increase in battery capacity from 60.5 kWh to 74.8 kWh. These enhancements extend the WLTP range from 260 miles to 317 miles. The drivetrain update also increases cargo space and adds a 110-liter front trunk (frunk). Interior changes include a more subdued design and relocating the shifter to the column, freeing up central console space, though some features common in China, such as an onboard refrigerator and the “God’s Eye” Intelligent Driving system, are absent in the European model. This launch highlights BYD’s growing focus on the European market, potentially tailoring the Atto 3 EVO to sportier preferences compared
energybattery-technologyelectric-vehiclesEV-chargingautomotive-materialsvehicle-rangeclean-energyLucid Is Finishing A Greenfield EV Plant For The Next Phase Of Global Manufacturing - CleanTechnica
Lucid Motors has been developing its first international manufacturing facility in King Abdullah Economic City (KAEC), Saudi Arabia, marking the kingdom’s inaugural car factory and a key element in its economic diversification away from oil. Opened in September 2023, the plant initially assembled Lucid Air vehicles from semi-knocked-down kits shipped from the U.S., with a capacity of about 5,000 vehicles per year. This facility, known as Lucid’s Advanced Manufacturing Plant 2 (AMP-2), served as a greenfield project designed to implement a digitally driven, human-centered manufacturing model from the ground up. As of early November 2025, Lucid is transforming the Saudi plant from an assembly site into a full-scale “Complete Build Unit” (CBU) capable of handling all production stages, including stamping, body construction, and powertrain assembly. This transition involves integrating advanced digital twin technology and manufacturing software through partnerships like Rockwell Automation. The facility is being positioned as the primary global
energyelectric-vehiclesmanufacturingdigital-twinautomationadvanced-manufacturingautomotive-industryPhotos: Mammoth 1,100-ton, 900-ton steel domes installed at Chinese nuclear reactors
This week, China achieved significant progress in its nuclear energy infrastructure with the successful installation of massive steel domes at two separate nuclear power plants. At the Haiyang plant in Shandong province, the State Power Investment Corporation (SPIC) completed the hoisting of the nearly 1,000-ton outer steel dome for Unit 4, a conical structure measuring 41 meters in diameter and 11 meters in height. This dome supports the passive containment cooling water storage tank, a critical component for the plant’s safety systems. Meanwhile, at the Xudabao plant in Liaoning province, the China National Nuclear Corporation (CNNC) hoisted the 820-ton inner containment dome for Unit 1, a semi-ellipsoidal structure made of 64 curved steel plates with a diameter of nearly 40 meters. Notably, fire sprinklers and ventilation systems were pre-installed on the dome before hoisting to enhance construction efficiency and safety. Both plants utilize the CAP1000 reactor design,
energynuclear-energysteel-domesmodular-constructionpower-plantsChina-nuclear-reactorsinfrastructureTwilio co-founder’s fusion power startup raises $450M from Bessemer and Alphabet’s GV
Inertia Enterprises, a fusion power startup co-founded by Twilio’s Jeff Lawson, has raised $450 million in a Series A funding round led by Bessemer Venture Partners with participation from GV (Alphabet’s venture arm) and others. The company aims to build one of the world’s most powerful lasers as the foundation for a grid-scale fusion power plant targeted for construction by 2030. Inertia’s technology builds on the Lawrence Livermore National Laboratory’s National Ignition Facility (NIF), which has achieved controlled fusion reactions that release more energy than consumed. The startup’s approach uses inertial confinement fusion, where lasers compress fuel targets to trigger fusion, leveraging NIF’s design principles but focusing on commercial scalability and cost reduction. Inertia plans to develop a laser system capable of delivering 10 kilojoules of energy ten times per second, requiring 1,000 lasers firing on small, inexpensive fuel targets—significantly more efficient and cost-effective than NIF’s current setup
energyfusion-powerinertial-confinement-fusionlaser-technologyclean-energypower-plantenergy-startupXPENG Isn’t Just Entering ASEAN—It’s Assembling an Operating System - CleanTechnica
XPENG has significantly revamped its Southeast Asian strategy in early 2026, evolving from a niche EV importer into a regional leader with localized manufacturing and a comprehensive infrastructure network. The company’s approach centers on Indonesia, where it partnered with Voltron to launch the country’s first 480 kW ultra-fast charging station, enabling its G6 SUV to charge from 10% to 80% in under 12 minutes. This infrastructure model, emphasizing co-investment in high-performance charging stations rather than relying on public infrastructure, is being expanded across Malaysia, Singapore, and Thailand. Through collaboration with Charge+, XPENG has integrated over 3,800 public charging points into a regional network spanning 5,000 kilometers of highways, facilitating seamless cross-border EV travel and embedding these services into its mobile app for a smooth user experience. In Malaysia, XPENG has established a local manufacturing hub in Malacca through a partnership with EP Manufacturing Berhad, producing right-hand-drive vehicles like the G6 SUV and X
energyelectric-vehiclesultra-fast-chargingEV-infrastructureSoutheast-AsiaXPENGsmart-charging-networkLunar Cold War: Musk puts SpaceX in direct race with China’s moon base
Elon Musk’s SpaceX has dramatically shifted its focus from Mars to the Moon, announcing plans to build a “self-growing city” on the lunar surface within the next decade. Musk justifies this pivot by emphasizing the Moon’s proximity to Earth, which offers a safer and more practical environment for establishing a permanent human presence compared to the distant and logistically challenging Mars. The Moon could serve as a critical outpost for humanity’s survival, providing a testing ground for technologies and resources such as Helium-3 for fusion energy and water ice for fuel, potentially transforming it into a key economic hub in space. This announcement intensifies the geopolitical competition in space, particularly between the U.S. and China. China’s “Tiangong Kaiwu” program, in collaboration with Russia and other nations, aims to establish an International Lunar Research Station by 2035, directly competing with SpaceX’s ambitions. However, experts caution that the concept of a “self-growing city” is highly ambitious, as
energyspace-explorationlunar-miningHelium-3nuclear-fusionSpaceXmoon-baseUS Navy's new facility to advance submarine-launched Trident II missiles
The US Navy has initiated construction of a new Engineering Test Facility (ETF) at Cape Canaveral Space Force Station to support the development and modernization of the submarine-launched Trident II D-5 Life Extension 2 (D5LE2) missile system. Awarded in November 2025 to Walsh Federal for $166 million, the 130,000-square-foot facility is slated for completion by January 2028. It will house multiple labs, heavy-lift cranes, and support spaces to enable prototyping, testing, and production of flight hardware and support equipment for the next-generation Trident II missiles. This development follows recent successful test flights of unarmed D5LE missiles from Ohio-class submarines, underscoring the system’s reliability and accuracy. The Trident II D5 missile system, originally developed in the 1980s and life-extended in 2017 to remain operational into the 2040s, is a critical component of the US nuclear triad’s
energydefense-technologymissile-systemssubmarine-technologystrategic-weaponsmilitary-infrastructurenuclear-deterrenceWorld’s 1st 3D-printed hypersonic platform clears key vibration trials
Queensland-based Hypersonix Launch Systems has successfully completed vibration testing on its DART AE hypersonic technology demonstrator, validating the vehicle’s structural reliability and component integrity ahead of planned flight tests. The DART AE is notable as the world’s first hypersonic launch platform with a fully 3D-printed airframe made from high-temperature alloys. Powered by a hydrogen-fueled scramjet, the single-use demonstrator can reach speeds up to Mach 7, has a length of approximately 3 meters, a mass near 300 kg, and a range of up to 1,000 km. The use of hydrogen fuel offers high thrust and clean-burning advantages, aligning with Hypersonix’s scramjet development efforts. The vibration tests simulated the intense mechanical stresses experienced during launch and high-speed flight, confirming that the DART AE’s materials and components can withstand these conditions. This milestone paves the way for the next phases of integration and pre-flight preparations. Hyperson
energymaterialsadditive-manufacturinghypersonic-technologyhydrogen-fuelhigh-temperature-alloysaerospace-engineeringVideo: Engineer turns energy from swinging pendulum into electricity
Engineer and YouTuber Tom Stanton has successfully converted the potential energy of a swinging pendulum into usable electrical energy, achieving a peak output of 80 volts. Stanton, an aerospace engineer with a passion for 3D printing, demonstrated this concept by initially swinging a magnet over a copper block to induce current, which generated heat due to opposing magnetic fields. He then replaced the copper block with wire coils to capture the current, adding a bridge rectifier and capacitor to convert and store the energy as direct current, allowing LEDs to remain lit between swings. Scaling up the setup, Stanton used a heavy pendulum bob, precision bearings, and powerful magnets arranged in a Halbach array to optimize the magnetic field direction. He 3D-printed custom components to create six pickup coils connected to rectifiers and a large capacitor for energy storage. The system generates about 51 joules (0.014 watt-hours) per swing from a seven-inch lift, enough to power six LEDs for three minutes or run
energyenergy-harvestingpendulum-energyelectricity-generation3D-printingmagnetic-inductionrenewable-energyNew nickel-iron battery charges in seconds, survives 12,000 cycles
An international research team co-led by UCLA has developed a nickel-iron battery prototype that can fully recharge in seconds and sustain over 12,000 charge cycles, equating to more than 30 years of daily use. This breakthrough is achieved by using nickel and iron nanoclusters smaller than 5 nanometers embedded in a graphene aerogel structure, which significantly increases the electrode surface area and allows nearly every atom to participate in the chemical reaction. The battery’s rapid charging and long lifespan make it well-suited for applications such as storing excess solar energy for nighttime grid use and providing backup power for data centers. However, its energy density still falls short compared to lithium-ion batteries. The innovation builds on early 20th-century nickel-iron battery concepts, overcoming previous conductivity limitations through the use of 2D graphene combined with proteins derived from beef production as biological templates. These proteins, mixed with graphene oxide and processed under heat, form a porous aerogel that is 99% air by volume,
energybattery-technologynickel-iron-batteryfast-chargingrenewable-energy-storagegraphene-aerogelnanomaterialsFaraday Future Follows Tesla's EV Playbook, Only Better
The article discusses Faraday Future's strategic approach to entering the electric vehicle (EV) market by following and improving upon Tesla's business model. Like Tesla, Faraday Future began by developing a high-end, luxury EV to establish brand credibility and generate interest before planning to expand into more affordable, mass-market vehicles. Since its founding in 2014 by YT Jia, the company has quietly advanced through financial challenges and product development, unveiling the FF 91 2.0 Futurist Alliance as a luxury EV and securing $30 million in funding to develop a broader lineup, including models targeted at the $20,000–$80,000 price segment. Faraday Future is now focusing on its flagship model, the Super One, which emphasizes AI-forward technology and aims to offer greater product diversity in the U.S. high-end business and family mobility market, traditionally dominated by limited choices like the Cadillac Escalade. The company highlights its U.S.-based research, development, and manufacturing capabilities as
energyelectric-vehiclesFaraday-Futurebattery-technologyAI-in-automotiveEV-marketsustainable-transportationUS firm’s mile-deep underground nuclear reactor gets funding boost -
Deep Fission, a US startup innovating nuclear power by situating reactors a mile underground, has secured $80 million in new funding from major alternative asset managers, reflecting growing private sector interest in advanced nuclear technology. The company also formed a strategic partnership with Blue Owl Capital’s Real Assets platform to deploy its Small Modular Reactors (SMRs) for powering AI-driven data centers, aiming to deliver continuous clean energy to US electricity grids. Deep Fission’s core technology is a 15-megawatt pressurized water reactor installed at the bottom of a deep borehole, leveraging natural geological pressure and rock formations for safety and cost reduction. By using Earth’s natural pressure at one mile depth, Deep Fission eliminates the need for expensive surface pressure vessels, while the surrounding rock provides passive containment against disasters and threats. This design is estimated to reduce construction costs by up to 80% compared to traditional nuclear plants. The modular reactors can be scaled by co-locating multiple units to serve large industrial
energynuclear-powersmall-modular-reactorsclean-energyunderground-reactoradvanced-nuclear-technologyscalable-energy-solutions'Industry first' semi-solid-state EV battery installed by Chinese firm
China’s state-owned FAW Group announced a significant advancement in electric vehicle (EV) battery technology by installing what it calls the “industry’s first” lithium-rich manganese semi-solid-state battery in a vehicle. Developed in collaboration with China Automotive New Energy Battery Technology Co Ltd and Nankai University, this battery achieves an energy density exceeding 500 watt-hours per kilogram and a total pack capacity of 142 kilowatt-hours. This enables a CLTC-rated driving range of over 1,000 kilometers (about 620 miles), marking a notable improvement over conventional lithium-ion batteries in terms of range, energy density, and safety. Solid-state batteries, which replace the liquid electrolyte in traditional lithium-ion cells with a solid or semi-solid material, are considered a breakthrough for EVs because they promise faster charging, enhanced safety, and longer driving ranges. Despite challenges in scaling production and material stability, recent progress by Chinese automakers like FAW, SAIC Motor, and Dongfeng Motor indicates accelerating commercialization efforts.
energyelectric-vehiclessolid-state-batterieslithium-ion-batteriesbattery-technologyenergy-densityEV-rangeOp-Ed: VinFast is Refocusing on Asia, Planning to Sell 300,000 Vehicles - CleanTechnica
Vietnamese automaker VinFast is refocusing its strategy toward Asia, specifically targeting India and Southeast Asia as core growth markets, with an ambitious goal of selling 300,000 vehicles annually. This figure represents a critical breakeven point where fixed costs in manufacturing, R&D, and retail begin to be meaningfully diluted. Despite this pivot, VinFast insists it will not abandon the North American market but will instead restructure its operations there. The company initially prioritized North America due to its purchasing power and market volume, followed by Europe for its sustainability appeal, and lastly Asia, which was considered easier to penetrate. However, after investing billions in establishing itself in the U.S. and Canadian EV markets, VinFast faced significant challenges, including annual net losses exceeding $3 billion and U.S. sales never rising beyond low four-figure annual volumes. Key obstacles included the lack of eligibility for the $7,500 federal EV tax credit, which placed VinFast vehicles at a price disadvantage compared to domestic and
energyelectric-vehiclesVinFastautomotive-industrymarket-strategyAsiaelectric-mobilityEscaped pigs speed wild boar breeding after Fukushima nuclear disaster
Following the 2011 Fukushima nuclear disaster, thousands of domestic pigs escaped into nearby forests and began interbreeding with local wild boar populations. Researchers from Fukushima University and Hirosaki University studied this unplanned hybridization and discovered a unique genetic mechanism driving rapid population changes. Specifically, the fast-breeding trait of domestic pigs—characterized by year-round reproduction—is inherited maternally. When female domestic pigs bred with wild boars, their hybrid daughters inherited this accelerated reproductive cycle, causing a rapid turnover in the hybrid population. However, rather than permanently introducing domestic pig genes into the wild boar gene pool, this maternal-driven rapid breeding paradoxically accelerated the dilution of domestic DNA. Because these hybrids bred so frequently, their descendants repeatedly backcrossed with the larger wild boar population, quickly filtering out domestic nuclear genes within just a few generations. As a result, the population physically resembled wild boars but retained the high reproductive rate of domestic pigs. The study, published in the Journal of
energynuclear-disasterFukushima-Daiichigenetic-hybridizationwildlife-ecologybiological-researchenvironmental-impactWhy Have Automakers Written Off $55 Billion In EV Investments? - CleanTechnica
The article from CleanTechnica discusses why automakers have written off $55 billion in electric vehicle (EV) investments, highlighting several key factors behind this significant financial retreat. A primary reason is the dramatic shift in U.S. policy under the Trump administration, which dismantled many incentives and regulations that previously encouraged EV production and adoption. The elimination of subsidies, opposition to EV charging infrastructure projects, and the rollback of fuel efficiency standards removed critical motivations for automakers to continue investing heavily in EVs. Beyond policy changes, the article points to challenges in consumer demand and marketing. Automakers have struggled to effectively communicate the benefits of EVs to potential buyers, and auto dealers—who play a crucial role in vehicle sales—often show little enthusiasm for promoting EVs, focusing instead on gasoline vehicles that generate more immediate revenue through sales and maintenance. This lack of dealer support, combined with possibly overestimated consumer interest and insufficient scaling efforts by automakers to reduce costs, has further hindered EV adoption in the U
energyelectric-vehiclesEV-investmentsautomotive-industryclean-energygovernment-policyclimate-changePremiere of 3-Row Highlander BEV in North America - CleanTechnica
Toyota Motor Corporation announced the North American premiere of a new battery electric vehicle (BEV) version of its three-row SUV, the Highlander, as part of its multi-pathway strategy to achieve carbon neutrality. The unveiling took place on February 10, 2024, in Ojai, California, with sales expected to begin in late 2026. This BEV Highlander will be produced at Toyota Motor Manufacturing Kentucky and will join Toyota’s existing North American BEV lineup, which includes the bZ4X, Toyota C-HR, and bZ Woodland models. The Highlander, a popular family SUV with over 3.6 million units sold in the U.S. since 2001, is being electrified to meet diverse customer needs while advancing Toyota’s carbon-neutral goals. The Highlander BEV will offer two lithium-ion battery options: a 76.96 kWh battery designed for urban driving and a 95.82 kWh battery aimed at enhancing range for long
energybattery-electric-vehicleBEVlithium-ion-batteryelectric-SUVcarbon-neutralityToyota2026 Nissan Rogue Plug-in Hybrid Pricing Starts at $45,990 - CleanTechnica
The 2026 Nissan Rogue Plug-in Hybrid, Nissan’s first plug-in hybrid in the U.S., will arrive at dealerships in February with a starting Manufacturer’s Suggested Retail Price (MSRP) of $45,990 for the SL trim. It offers an estimated 38 miles of all-electric driving on a full charge, complemented by a total driving range of up to 420 miles, combining electric convenience for daily commutes with gasoline flexibility for longer trips. The vehicle delivers an EPA fuel economy estimate of 64 MPGe and features standard Intelligent All-Wheel Drive, with a total system output of 248 horsepower and 322 lb-ft of torque, enabling quicker acceleration than the conventional gas-engine Rogue. The Rogue Plug-in Hybrid is available in two trims: SL and Platinum. Both trims include a 12.3-inch driver display, a 9-inch touchscreen infotainment system with wireless Apple CarPlay and wired Android Auto, multiple USB ports, LED fog lights, heated front seats, a leather
energyplug-in-hybridelectric-vehicleNissan-Roguehybrid-technologyfuel-economyautomotive-innovationWith co-founders leaving and an IPO looming, Elon Musk turns talk to the moon
Elon Musk recently held an all-hands meeting with employees of his AI company xAI, where he outlined a bold vision involving the construction of a lunar manufacturing facility. This moon-based factory would produce AI satellites and launch them into space using a giant catapult, aiming to harness unprecedented computing power. Musk emphasized that xAI is moving faster than any competitor and suggested that different personnel may be suited to different stages of the company’s growth, amid ongoing organizational changes. The meeting came shortly after the departure of two xAI co-founders, Tony Wu and Jimmy Ba, both leaving amicably as the company prepares for a potential IPO targeting a $1.5 trillion valuation. Musk’s lunar ambitions mark a significant strategic shift from SpaceX’s long-held focus on Mars colonization to building a self-sustaining city on the Moon, which he argues could be achieved in half the time. This pivot aligns with a broader vision, as explained by a venture capitalist familiar with Musk’s plans, to
energyspace-explorationlunar-manufacturingAI-satellitesElon-MuskxAIcomputing-powerTrump Administration’s 100% “Buy America” EV Charging Requirement Is Anti-EV Policy - CleanTechnica
The article discusses the Trump administration’s efforts to undermine the National Electric Vehicle Infrastructure (NEVI) program, a $5 billion federal initiative established under the 2021 Bipartisan Infrastructure Law to develop reliable, high-speed electric vehicle (EV) charging stations along U.S. highways. The administration imposed a 100% “Buy America” requirement on EV charging infrastructure, which critics argue is counterproductive to EV adoption. Legal challenges ensued after the Trump administration abruptly froze the NEVI program in February 2025, delaying its implementation. On January 23, 2026, U.S. District Court Judge Tana Lin ruled that the Trump administration violated federal law by freezing the NEVI program, permanently barring the Department of Transportation from withdrawing funds, canceling or revising state implementation plans, or interfering with the program. The lawsuit was initiated by 17 states and supported by a coalition of environmental organizations, including the Sierra Club, NRDC, and others, who played a crucial role in
energyelectric-vehiclesEV-charging-infrastructureNEVI-programclean-energy-policyinfrastructure-lawsustainable-transportationSierra Club Appeals EPA Approval of South Carolina’s Do-Nothing Pollution Plan - CleanTechnica
The Sierra Club has appealed the EPA’s approval of South Carolina’s regional haze pollution plan, criticizing it as a "do-nothing" approach that fails to reduce air pollution affecting visibility in national parks and wilderness areas. Under the Clean Air Act’s Regional Haze program, states are required to implement pollution controls to improve visibility impaired by sources such as coal plants. However, South Carolina’s plan, approved by the EPA, determined that no pollution controls were necessary at any of the state’s coal plants, including Santee Cooper’s Winyah plant, despite evidence that these facilities contribute to visibility degradation at 22 national parks and wilderness areas, including the Cape Romain National Wildlife Refuge. The Sierra Club argues that both South Carolina and the EPA violated the rules established by the Regional Haze Rule and Clean Air Act by failing to require pollution controls. This legal challenge follows a similar appeal the Sierra Club filed against West Virginia’s regional haze plan last year. Paul Black, Sierra Club’s Senior Campaign Organizer in
energypollution-controlEPAclean-air-actcoal-plantsenvironmental-activismregional-haze-programTennessee Valley Authority Goes Back on Commitment to Retire Dirty Coal Plants - CleanTechnica
The Tennessee Valley Authority (TVA) has reversed its previous commitment to retire its Kingston and Cumberland coal plants, deciding instead to keep these highly polluting facilities operational for the foreseeable future. This reversal undermines TVA’s earlier plans, which justified multi-billion-dollar investments in new methane gas power plants at the same sites based on the promise of closing the coal plants. Environmental advocates criticize the decision as a “bait and switch” that will increase pollution, exacerbate climate change impacts, raise power bills, and reduce grid reliability for communities in the Tennessee Valley. Notably, TVA made this decision without consulting the affected communities, raising concerns about transparency and public involvement in what is supposed to be a public utility. Coal plants like Kingston and Cumberland emit large quantities of harmful pollutants such as sulfur dioxide, arsenic, mercury, and carbon dioxide, contributing to respiratory illnesses, neurological problems, cancer, and climate change. These two plants are among Tennessee’s top three carbon dioxide emitters. Despite TVA acknowledging that these plants
energycoal-powerTennessee-Valley-Authoritypollutionclimate-changepower-gridfossil-fuelsTrump Admin To Make Climate Denialism US National Policy - CleanTechnica
The article reports that the Trump administration is set to finalize a rule revoking the Environmental Protection Agency’s (EPA) 2009 greenhouse gas endangerment finding under the Clean Air Act. This finding, based on extensive scientific evidence and upheld unanimously in federal court, established that greenhouse gases like carbon dioxide and methane pose significant risks to public health, the economy, and the environment by driving climate change. The revocation would eliminate the EPA’s authority to regulate emissions from major sources such as motor vehicles and power plants, effectively making climate change denialism official U.S. policy. The move is criticized as anti-science and legally dubious, attempting to overturn the Supreme Court’s 2007 Massachusetts v. EPA decision that affirmed the Clean Air Act’s applicability to greenhouse gases. Environmental groups like the Sierra Club, which has long fought for federal climate standards, warn that this rollback endangers public health and could expose automobile manufacturers and fossil fuel companies to increased litigation. The Sierra Club and its partners are considering legal
energyclimate-changegreenhouse-gas-emissionsenvironmental-policyEPA-regulationsfossil-fuelsclean-air-actBYD Challenges EV Range Assumptions With 1000 km Denza Z9 - CleanTechnica
The article discusses BYD’s Denza Z9, a new electric vehicle (EV) model that challenges common assumptions about EV range by offering over 1000 km (approximately 664 miles) of driving range on a single charge. The Denza Z9, roughly the size of a Mercedes S-Class, comes with two battery options: a 102.3 kWh pack providing up to 906 km range in sedan form, and a larger 122.5 kWh pack delivering up to 1068 km. The vehicle features advanced technology including a LiDAR-based ADAS system, and offers powerful motor configurations, including a three-motor variant producing 860 kW (1140 hp) while maintaining a curb weight similar to previous models. These range figures are based on the CLTC standard and may be somewhat lower in highway conditions but still surpass many internal combustion engine (ICE) vehicles and other EVs. The article highlights that the Denza Z9’s price starts at around $
energyelectric-vehiclesbattery-technologyBYDDenza-Z9electric-car-rangeEV-chargingCoal waste may help US secure rare earth supply for clean energy and defense
Researchers at the South Dakota School of Mines and Technology have developed a novel method to extract rare earth elements (REEs) from coal mine waste, including overburden rock and coal ash, which are typically discarded or stored long-term. Led by Professors Venkataramana Gadhamshetty and Purushotham Tukkaraja, the team focused on coal mines in Wyoming and identified valuable REEs such as yttrium, dysprosium, erbium, ytterbium, and gadolinium—critical components for clean energy technologies, electronics, and national defense. Their three-stage extraction process integrates physical crushing, environmentally friendly chemical leaching, and a biological step where microorganisms absorb and concentrate the dissolved REEs, enhancing recovery efficiency and sustainability. Beyond solid waste, the researchers are also applying this approach to coal mine wastewater, aiming to recover REEs from contaminated water streams. Supported initially by the National Science Foundation and later by the U.S. Department of the Interior and the Office of
energyrare-earth-elementsclean-energymaterials-extractioncoal-waste-recyclingsustainable-technologyresource-recoveryQuilt's Paul Lambert on Making Heat Pumps Cool (and Smart) - CleanTechnica
The article highlights an interview with Paul Lambert, CEO of Quilt, featured on CleanTechnica’s CleanTech Talk podcast. Lambert discusses Quilt’s innovative approach to making heat pumps more appealing and efficient, aiming to significantly accelerate their adoption in U.S. single-family homes. Quilt’s heat pumps boast sleek designs, over 25 SEER2 efficiency, and smart software that improves system performance over time. Lambert emphasizes the environmental impact potential, noting that widespread heat pump adoption could be equivalent to removing 32 million cars from the road, but stresses the need to increase the current adoption rate tenfold by 2030. Additionally, the article covers Quilt’s rapid growth strategy, including a recent $20 million Series B funding round and the introduction of a new 3-zone heat pump system. The conversation between Lambert and CleanTechnica’s Scott Cooney delves into the intersection of technology innovation and clean energy solutions, underscoring Quilt’s mission to make heat pumps both “cool” and smart. The article
energyheat-pumpsenergy-efficiencysmart-technologyHVACrenewable-energyclean-technologyParked German Hydrogen Garbage Trucks Show The Limits Of Pilot-Driven Infrastructure - CleanTechnica
The article highlights a significant structural issue revealed by the case of seven hydrogen-powered garbage trucks in Bielefeld, Germany, which remain idle because they cannot legally refuel at a nearby hydrogen station designated exclusively for public passenger buses. Both the trucks and the station were funded with public money to reduce municipal emissions, yet legal restrictions tied to the funding prevent cross-use. Alternative hydrogen stations are either too far away or have closed due to low demand, rendering the trucks effectively non-operational. This situation is not due to poor local management but stems from how hydrogen infrastructure funding and regulations are structured, with strict legal earmarks limiting infrastructure use to specific vehicle categories. The problem is widespread across Europe, where hydrogen fleet pilots face similar challenges: high capital costs for vehicles and refueling stations, narrow funding conditions, and fragile operational assumptions. Unlike battery electric fleets, which scale more flexibly and tolerate imperfect conditions, hydrogen systems tend to fail outright when assumptions about usage or access are unmet. The root cause lies in public
energyhydrogen-fuelhydrogen-infrastructureclean-energyhydrogen-truckspublic-transport-fundingsustainable-transportationJapan restarts 1,356MW reactor at world's largest nuclear power plant
Japan has restarted Unit 6 at the Kashiwazaki-Kariwa Nuclear Power Plant, marking a significant milestone in the country’s nuclear recovery nearly 14 years after the Fukushima disaster. This 1,356-megawatt advanced boiling water reactor (ABWR), operated by Tokyo Electric Power Company (Tepco), is part of the world’s largest nuclear power station by installed capacity. The reactor, which had been offline since the 2011 Fukushima accident, was brought back online on February 9, with criticality achieved shortly after restart. Tepco plans to gradually raise reactor pressure, resume power generation by February 16, and begin commercial operation on March 18, pending final inspections by the Nuclear Regulation Authority (NRA). The restart is Tepco’s first since the Fukushima Daiichi disaster, which led to the shutdown of Japan’s entire nuclear fleet and extensive regulatory reforms. Although the Kashiwazaki-Kariwa plant was undamaged by the 2011 earthquake and
energynuclear-powerreactor-restartFukushima-disasteradvanced-boiling-water-reactorTokyo-Electric-Power-CompanyKashiwazaki-KariwaTrump EPA reportedly seeks to revoke landmark air pollution rule
The Trump administration’s EPA, led by Lee Zeldin, is reportedly preparing to repeal the 2009 “endangerment finding” that established greenhouse gases as a threat to human health and welfare. This finding underpins federal regulations on six key greenhouse gases, including carbon dioxide and methane, and has faced legal challenges since its inception. The repeal, expected imminently, would initially target vehicle tailpipe emissions but is anticipated to pave the way for rolling back regulations in other sectors like power plants and industry. This move is likely to trigger numerous lawsuits and could take years to resolve. Automakers have shown mixed reactions: legacy manufacturers have not actively supported the repeal, while Tesla has defended the scientific basis of the endangerment finding. If successful, the U.S. would diverge from other advanced economies’ climate policies, complicating compliance for multinational companies and increasing costs. The domestic auto industry, heavily reliant on fossil fuel-powered trucks, faces challenges from regulatory uncertainty and growing competition from China. The
energyenvironmental-regulationgreenhouse-gasesclimate-changeEPAcarbon-emissionsfossil-fuelsGeneral Galactic to test satellite powered only by water in space
General Galactic, a space startup led by former SpaceX and Varda Space engineers Halen Mattison and Luke Neise, plans to launch a 1,100-pound satellite later this year to demonstrate propulsion powered solely by water. The mission, named Trinity, will test two water-based propulsion methods: chemical propulsion by electrolysis splitting water into hydrogen and oxygen for combustion, and electrical propulsion by converting oxygen into plasma guided magnetically out of a thruster. This approach offers advantages over traditional fuels like liquid methane, including easier storage without extreme cooling, reduced risk of explosions, and potential cost savings. The company aims to validate water propulsion as a versatile and efficient technology for rapid satellite maneuvering and deep space travel, potentially delivering 5-10 times the Delta-V (velocity change) of conventional systems. General Galactic envisions this technology enabling future infrastructure such as propellant stations on Mars to support interplanetary missions. While other organizations, including NASA and Japanese firm Pale Blue, have explored water-based propulsion
energysatellite-propulsionwater-propulsionspace-technologyelectrolysiselectric-propulsionspace-explorationScientists use supercomputer to understand 'extreme' turbulent events
US researchers at Georgia Tech have performed the largest-ever 3D direct numerical simulation of turbulence using the Frontier supercomputer, mapping fluid chaos across 35 trillion grid points. This unprecedented computational effort allowed them to reach a Reynolds number of 2,500, achieving a level of physical fidelity comparable to real-world laboratory experiments. The study decodes the core mechanics of turbulent fluctuations, offering new insights into phenomena ranging from global ocean circulation to jet engine environments. These findings have practical implications for improving weather forecasts and designing more efficient vehicles and airfoils. A key focus of the research is on “extreme events”—rare, intense fluctuations that classical turbulence theories often fail to predict but are responsible for high-impact occurrences like Category 5 tornadoes and engine auto-extinction. By shifting from deterministic predictions to stochastic statistical models, the team better characterizes the probability distributions of these events, enhancing preparedness for their real-world effects. The study also distinguishes between energy dissipation and enstrophy (localized swirling intensity),
energysupercomputerturbulence-simulationfluid-dynamicsaerospace-engineeringcomputational-modelingextreme-eventsItalian startup secures parts to build tiny nuclear reactors by 2028
Terra Innovatum Global N.V., an Italian startup specializing in micro-modular nuclear reactors, has achieved a significant milestone by securing its supply chain for both critical and non-critical components needed to build its SOLO reactor. The SOLO reactor, conceptualized in 2018, is designed as a tiny nuclear fission unit with a maximum capacity of 1 MWe, scalable up to 1 GW through modular deployment. Its unique features include the use of off-the-shelf components for cost-effectiveness and rapid deployment, as well as fuel flexibility supporting both LEU+ and HALEU fuels. These reactors are intended to replace fossil-fuel-powered thermal plants and can provide electricity and heat for industrial processes, especially in off-grid or mini-grid settings. The secured supply chain covers nuclear-grade critical components such as the pressure vessel, cooling tubes, control mechanisms, instrumentation, and reactor fuel, which represent the highest barriers to nuclear reactor construction. Additionally, non-nuclear grade yet mission-critical components like helium circul
energynuclear-reactorsmicro-modular-reactorssmall-modular-reactorsclean-energypower-generationsupply-chainRolls-Royce's modular hydrogen-ready plants to support clean power
Rolls-Royce has introduced a new range of modular, hydrogen-ready gas engine power plants aimed at enhancing energy security and supporting Germany’s Power Plant Strategy. These turnkey, preconfigured systems can be deployed within 12 to 18 months and provide flexible, decentralized power generation ranging from 5 to several hundred megawatts. Designed to bridge gaps in renewable energy supply caused by fluctuations in wind and solar output, the plants can supply power for hours to weeks, ensuring grid stability until alternative sources like nuclear power come online. The modular design allows individual units to be started or stopped to match demand, optimizing efficiency and reducing costs and emissions. The engines are hydrogen-ready, enabling future use of low-carbon fuels such as biomethane and biogas. Rolls-Royce’s modular engine power plants (MEPP) integrate power units, electrical systems, grid connections, and central control into a single solution, facilitating rapid deployment in regions with slow grid expansion and increasing renewable variability. The company also offers
energyrenewable-energyhydrogen-powermodular-power-plantsgas-enginesdecentralized-power-generationclean-energyTesla Buyer Loyalty Drops a Ton, But Still 3rd in USA - CleanTechnica
Tesla’s brand loyalty in the United States has significantly declined in recent years, dropping from its previous dominant position to third place among automakers with a loyalty rate of 55.9%. This means that just over half of Tesla owners intend to purchase another Tesla for their next vehicle. Among those planning to buy another electric vehicle (EV), 78% remain loyal to Tesla, but notably, over 20% of these buyers are considering non-Tesla EVs. This decline challenges the perception that Tesla owners are unwaveringly committed to the brand regardless of competitors or company leadership. Several factors appear to contribute to this drop in loyalty, including backlash against Elon Musk’s political activities, such as his support for Donald Trump and controversial decisions affecting cleantech policies. These political stances have coincided with reductions in federal support for EV incentives and cleantech adoption, which have slowed the overall transition to electric vehicles in the U.S. The article also notes a temporary resurgence in gasoline vehicle preference following the
energyelectric-vehiclesTeslabrand-loyaltyclean-technologyEV-marketfederal-subsidies200 Electric Trucks Can Be Charged At One Depot In A Day? - CleanTechnica
The article highlights significant progress in electric vehicle (EV) charging infrastructure, focusing on a key metric: the capacity to charge 200 electric trucks per day at the San Bernardino truck charging depot. This volume matches the throughput of a traditional diesel truck stop, indicating that charging parity between electric and diesel trucks has been achieved at this site. The depot offers megawatt charging capabilities compatible with the Megawatt Charging System (MCS) standards, supporting the growing demand for electric freight operations in a region with heavy shipping activity. WattEV, the company operating the San Bernardino depot, attributes its success to a vertically integrated approach in charging and fleet electrification, which has driven strong utilization—averaging about 700 MWh per month—and necessitated plans to more than double the site's capacity. WattEV aims to deploy 12,000 electric heavy-duty trucks in California by 2030 and currently runs five charging depots, with 15 more in development and a goal of 100 operational depots
energyelectric-vehiclesEV-charging-infrastructureelectric-trucksfleet-electrificationclean-energysustainable-transportationUS picks 5 firms to advance recycling of used nuclear reactor fuel
The U.S. Department of Energy’s Office of Nuclear Energy has awarded $19 million to five companies to advance technologies for recycling spent nuclear reactor fuel. This initiative aims to tackle the economic and technological challenges of nuclear fuel recycling in the U.S., which currently generates significant nuclear waste—approximately 90,000 metric tons managed mostly in temporary storage due to the absence of a permanent disposal facility. Despite the U.S. being the world’s largest producer of nuclear energy, less than 5 percent of the potential energy in nuclear fuel is extracted, highlighting the opportunity for recycling to reduce nuclear waste by up to 90 percent. Notably, recycling commercial nuclear fuel has been prohibited since 1977, though military programs have recycled nuclear waste for decades. The selected companies, which meet strict non-proliferation and security standards, will focus on diverse aspects of nuclear fuel recycling over projects lasting up to three years. For example, Alpha Nur Inc. will develop processes to recover highly enriched uranium for use in
energynuclear-energynuclear-fuel-recyclingnuclear-waste-managementDepartment-of-Energysmall-modular-reactorsuranium-enrichmentElectric semi-trucks could serve as mobile AI data centers, Belgian startup proposes
Belgian startup Windrose Electric has proposed an innovative concept to use electric semi-trucks as mobile, containerized AI data centers. The company’s founder and CEO, Wen Han, introduced the idea on LinkedIn, describing the vehicle as “AI in a box.” This design involves housing a 4 MWh battery system capable of megawatt-level DC fast charging in one container, while a separate container holds a modular AI inference unit delivering up to 0.5 MW of computing power. Utilizing standard 20-foot or 40-foot ISO shipping containers, the system aims to enhance flexibility, scalability, and energy efficiency compared to traditional data centers. The containerized data center approach offers several advantages, including rapid scalability, reduced operational costs, and easier relocation without the need for expensive land acquisition. By integrating advanced AI, the system can perform predictive maintenance and real-time performance monitoring, improving reliability and efficiency. Windrose’s R700 electric semi-truck, typically available in a 6×2 configuration
energyelectric-vehiclesdata-centersAImodular-systemsbattery-storagecontainerizationNew sun-powered device extracts lithium while desalinating seawater
Researchers at Zhejiang University in China have developed a novel solar-powered seesaw extractor (SPSE) designed to efficiently extract lithium from seawater while simultaneously desalinating it. This innovation addresses the growing global demand for lithium, a critical element for batteries in smartphones and electric vehicles, amid the environmental challenges posed by traditional land-based lithium mining. The oceans hold an estimated 230 billion tons of lithium, but its extraction is complicated by lithium's extreme dilution and the overwhelming presence of sodium—seawater contains 60,000 times more sodium than lithium. Conventional evaporation methods lead to salt scaling that clogs equipment, halting production. The SPSE device features a sandwich-like structure with a lithium-adsorbing core between two sun-absorbing layers. Solar energy induces evaporation, concentrating lithium ions while a unique 30-degree tilt causes the device to rock like a seesaw. This motion submerges salt crusts formed on one end, allowing natural seawater to wash them away and preventing clogging
energysolar-powerlithium-extractionseawater-desalinationphotothermal-evaporationsustainable-technologyrenewable-energy-materialsCanada Blows A Big, Fat Offshore Wind Raspberry At Trump
The article discusses the ongoing development of offshore wind energy projects along the U.S. Atlantic coast despite former President Donald Trump’s efforts to halt them. Trump attempted to stop the domestic offshore wind industry by revoking federal leases and issuing stop-work orders in 2025, but legal challenges and court rulings allowed construction on five major projects—Vineyard Wind (Massachusetts), Revolution Wind (Rhode Island and Connecticut), Sunrise Wind and Empire Wind (New York), and Coastal Virginia Offshore Wind—to continue. These projects are progressing toward completion, signaling strong momentum for offshore wind energy in the region. Adding to this momentum, Canada is collaborating with Massachusetts to develop offshore wind power from Nova Scotia to New England. A Memorandum of Understanding was signed between Massachusetts Governor Maura Healey and Nova Scotia Premier Tim Houston to strengthen offshore wind development in the North Atlantic. This partnership aims to lower energy costs, create jobs, and boost economic investment in both regions. Massachusetts officials emphasize the importance of offshore wind for energy
energyoffshore-windclean-energyrenewable-energywind-farmsenergy-policyUS-Canada-energy-collaborationElectric Cars Are Simply Better — Subsidies Or Not - CleanTechnica
The article from CleanTechnica argues that electric vehicles (EVs) are inherently superior to gasoline-powered cars, regardless of government subsidies. It highlights that despite recent fluctuations in U.S. EV sales linked to the expiration of a $7,500 subsidy, the fundamental advantages of EVs remain compelling. These advantages include greater convenience—since EV owners can charge at home without frequent trips to gas stations—and a smoother, more powerful driving experience due to instant torque. The article emphasizes that many people have yet to experience driving an EV firsthand, which limits broader adoption. Furthermore, the article points out that the U.S. lags significantly behind other countries in EV market share. While the U.S. EV share was only 7.9% in 2025, countries like Nepal, Vietnam, Singapore, Thailand, and Indonesia have much higher adoption rates, with some exceeding 40-50%. Even smaller markets like Uruguay and Costa Rica show substantial EV penetration. The article suggests that the superior qualities of
energyelectric-vehiclesEV-adoptionclean-energysustainable-transportationelectric-car-chargingautomotive-technologyTem raises $75M to remake electricity markets using AI
London-based startup Tem has raised $75 million in an oversubscribed Series B funding round led by Lightspeed Venture Partners, valuing the company at over $300 million. Tem uses AI-driven technology to create an energy transaction engine called Rosso, which matches electricity generators—primarily renewable energy producers—with business consumers. By leveraging machine learning and large language models to predict supply and demand, Tem aims to reduce energy costs by cutting out multiple intermediaries in traditional energy markets, thereby bringing prices closer to wholesale rates. The company currently serves over 2,600 UK businesses, including Boohoo Group, Fever-Tree, and Newcastle United FC, promising up to 30% savings on energy bills. Tem operates two main businesses: Rosso, the AI-powered transaction platform, and RED, a "neo-utility" that uses Rosso’s infrastructure to demonstrate its value. While Tem initially attempted to license Rosso to other utilities, it now prioritizes growing RED, which is currently the sole utility
energyAIelectricity-marketsrenewable-energyenergy-tradingmachine-learningenergy-startupLiquid gallium turns sunlight and seawater into clean hydrogen
Researchers at the University of Sydney have developed an innovative, sunlight-powered method to produce clean hydrogen from both freshwater and seawater using liquid gallium. This approach overcomes key challenges in green hydrogen production, such as the need for purified water and high energy consumption. The process involves suspending liquid gallium— a metal that melts slightly above room temperature—in water and exposing it to light, which triggers a surface reaction that releases hydrogen while forming gallium oxyhydroxide. Importantly, the method requires no external electricity or complex infrastructure, making it efficient and potentially scalable, with a reported maximum efficiency of 12.9 percent. Unlike traditional electrolysis, this gallium-based technique can utilize abundant water sources, including seawater, reducing costs and complexity, which is especially advantageous for coastal or water-scarce regions. The process is also circular: the gallium oxyhydroxide produced can be chemically converted back into gallium and reused for further hydrogen generation. The research team is now working to
energygreen-hydrogenliquid-galliumclean-energyhydrogen-productionrenewable-energysustainable-technologyWhat Elon Musk's 'sentient sun' claim reveals about the SpaceX–xAI merger
The article discusses Elon Musk’s recent announcement of the merger between SpaceX and his artificial intelligence startup, xAI, highlighting a shift in SpaceX’s strategic focus from Mars colonization to lunar bases and orbital data centers. Musk envisions this merger as the creation of a "vertically-integrated innovation engine" combining AI, rockets, space-based internet, and real-time information platforms. Central to this vision is the ambitious and metaphorical concept of building a "sentient sun"—a vast, solar-powered AI system in space designed to harness the Sun’s energy to power intelligence at a stellar scale, effectively creating a distributed, space-based "brain" through a constellation of AI data centers and compute satellites. This vision ties into Musk’s recent plans to deploy data centers in Earth’s orbit, which would continuously harvest sunlight and benefit from the cold space environment to reduce cooling costs. Musk frames this initiative within the context of the Kardashev scale, aiming for humanity to progress toward a Type II civilization
energyartificial-intelligencespace-technologydata-centerssolar-powerSpaceXAI-satellitesAltitude Partners With Alcom For +360.000t Carbon Removals - CleanTechnica
Altitude has secured a major carbon removal procurement deal, acquiring over 360,000 tonnes of CO₂ Removal Certificates (CORCs) from Alcom’s biochar-based carbon removal projects located in the Philippines and India. This agreement represents one of the largest individual off-take contracts in the carbon removal sector to date. The credits will be issued through Puro.earth, a platform that provides independent verification, traceability, and ensures the long-term permanence of the carbon removals. Alcom is recognized as a leading developer in biochar projects, with a strong track record of delivering on its growth targets. This partnership with Altitude significantly advances the scaling of large-scale carbon dioxide removal (CDR) efforts. Overall, the deal highlights the growing market for verified carbon removal certificates and the increasing role of biochar technology in global carbon mitigation strategies.
energycarbon-removalbiocharcarbon-creditsclimate-changesustainabilityclean-technologySyncraft Builds 2nd Climate-Positive Power Plant For PurEnergy In Austria - CleanTechnica
Syncraft is set to build its second climate-positive power plant for PurEnergy in Bruck an der Leitha, Austria, following the successful operation of their first plant in Gänserndorf. This new facility will generate 1 MW of base load green electricity and 1.4 MW of base load green heat, while producing 1,000 tonnes of biochar annually, which equates to a carbon removal of over 2,500 tonnes. The plant’s design not only replaces fossil fuel-based energy but also creates a durable carbon sink through high-quality biochar, categorizing it as climate-positive infrastructure. The decision to commission a second plant underscores confidence in the technical reliability and economic viability of Syncraft’s solution. PurEnergy’s Managing Director Alfred Körner highlights the integration of efficient electricity and heat generation with green carbon production as a critical need. Syncraft’s strategy focuses on compact, high-efficiency power plants located near energy consumers to minimize transport and maximize regional benefits. This project marks
energyrenewable-energyclimate-positive-power-plantcarbon-removalbiocharclean-energysustainable-infrastructureGAC Takes Over Philippine Operations, Will Add 8 New Models This Year - CleanTechnica
Chinese automaker GAC has consolidated its Philippine operations under a single, factory-owned entity called GAC International Philippines, as part of its global ONE GAC framework. This unification, completed in early 2026, brings together the company’s internal combustion vehicles, AION electric range, and Hyptec sub-brand under one organization responsible for sales, dealer operations, and aftersales support. The restructuring aligns dealer standards, pricing, and warranty coverage across all brands, streamlining previously fragmented operations that had separate channels for electric and hybrid models. The company formally opened its unified offices in February 2026 to support this integrated approach. GAC’s current electric vehicle lineup in the Philippines includes three battery-electric models introduced in late 2025: the AION V compact SUV targeting mainstream buyers, the smaller AION UT for entry-level EV customers, and the premium Hyptec HT SUV. These models cover mass-market, compact, and higher-end segments. The brand’s presence in the Philippines began in
energyelectric-vehiclesEV-marketautomotive-industrybattery-electric-vehicleselectric-SUVsvehicle-electrificationEVs Lower Nitrous Oxide Levels In California - CleanTechnica
A recent study published in January 2026 demonstrates a clear link between the rise of electric vehicle (EV) adoption in California and a significant reduction in nitrous oxide (NO2) pollution. Nitrous oxide, a harmful byproduct of burning gasoline or diesel fuel in internal combustion engines, poses serious health risks including dizziness, headaches, impaired motor control, and increased accident risk. Using data from the Tropospheric Monitoring Instrument (TROPOMI) satellite, which measures NO2 concentrations from low Earth orbit, researchers analyzed changes in NO2 levels across 1,692 Zip Code Tabulation Areas (ZCTAs) in California from 2019 to 2023, correlating these with zero-emission vehicle (ZEV) registrations. The study excluded 2020 due to pandemic-related data anomalies. The findings conclusively show that areas with increased EV registrations experienced measurable decreases in NO2 pollution, confirmed by both satellite and ground-level monitoring. This research is the first to definitively connect
energyelectric-vehiclesnitrous-oxide-reductionair-qualitysatellite-monitoringzero-emissions-vehiclesCalifornia-environmental-impactPhilippines Hands Over Strategic Hydropower Complex to Private Consortium - CleanTechnica
The Philippine government has officially transferred operations of the Caliraya–Botocan–Kalayaan (CBK) Hydroelectric Power Plant complex in Laguna to the Thunder Consortium, led by Aboitiz Power Corp. This marks a significant privatization in the country’s power sector, with the consortium winning the asset through a P36.27-billion bid under the Power Sector Assets and Liabilities Management Corp. (PSALM) program. The CBK complex, with an installed capacity of about 797 megawatts, is one of the largest and most strategically important hydropower assets in the Philippines due to its pumped-storage facilities. These facilities provide critical grid-scale energy storage, enabling the grid to manage demand peaks, maintain reserves, and integrate variable renewable energy sources like solar and wind without compromising reliability. The CBK complex comprises four plants: the Caliraya Hydroelectric Power Plant (39.37 MW), Botocan plant (22.91 MW), and the Kal
energyhydropowerrenewable-energypumped-storagegrid-flexibilityenergy-storageclean-energyVinFast Accelerates Indonesia Green Transition With E-Scooter Launch - CleanTechnica
VinFast is making a significant strategic entry into Indonesia’s electric scooter market by partnering with seven established national dealers, signaling a large-scale commitment rather than a tentative market test. With its manufacturing facility in West Java operational, VinFast is positioning Indonesia as a central hub for its ASEAN growth. This move challenges the entrenched dominance of Japanese incumbents like Honda, which controls about 70-75% of Indonesia’s motorcycle market through extensive dealer networks, financing, and supply chains. The Indonesian government’s target of 13 million electric motorcycles by 2030 creates a substantial demand that smaller local EV manufacturers cannot meet alone, making VinFast’s industrial scale, capital resources, and integrated energy strategy particularly impactful. VinFast’s vertically integrated approach encompasses manufacturing, vehicle production, batteries, charging infrastructure, financing, and after-sales service, distinguishing it from domestic competitors constrained by limited capacity and fragmented supply chains. The company has secured partnerships with experienced automotive retailers to leverage existing dealer networks, enabling a rapid national rollout starting in
energyelectric-scootersVinFastelectric-vehiclesmanufacturing-scaleIndonesiagreen-transitionLeading US Utility Goes Rogue, Offers More EV Rebates
The article highlights how Exelon’s ComEd utility in Illinois is actively advancing electric vehicle (EV) adoption despite federal setbacks under former President Donald Trump’s administration. ComEd recently announced a new $70 million funding round to support EV uptake, adding to an initial $160 million investment that helped install over 10,000 EV chargers statewide. This initiative offers rebates ranging from $7,500 to $240,000 for new or used EVs, including heavy-duty trucks, with a strong focus on business and public sector fleets. Additional funds support home Level 2 charger rebates and the development of public and private charging infrastructure. ComEd’s program emphasizes equity by reserving over half of the funds for low-income customers and communities designated as Equity Investment Eligible Communities (EIECs), ensuring that the EV transition benefits underserved populations. The utility’s commitment signals that the EV movement has momentum independent of federal policy fluctuations, countering the anti-EV stance and rhetoric associated with Trump’s presidency. Despite political challenges
energyelectric-vehiclesEV-rebatesutility-companiesclean-energyEV-chargerssustainabilityElectric Motorcycles Reach 15.3% Market Share Of New Registrations In Kenya In 2025 - CleanTechnica
Electric motorcycles in Kenya have experienced rapid growth, reaching a 15.3% market share of new motorcycle registrations in 2025, up from 7.1% in 2024 and just 3.6% in 2023. This surge follows a steady increase over recent years, starting from a mere 0.5% in 2021. The overall motorcycle market in Kenya also expanded significantly, with total new registrations rising 145% from 68,804 in 2024 to 168,286 in 2025. Of these, 25,277 were electric motorcycles, highlighting a strong shift toward electrification in a sector dominated by internal combustion engine (ICE) motorcycles, of which over 2 million are currently registered in the country. The growth in electric motorcycles is part of a broader trend across Africa, where electric vehicle adoption is gaining momentum due to factors like government policies (e.g., Ethiopia’s ban on fully built ICE cars), private sector innovation, and
energyelectric-motorcycleselectric-vehicleselectric-mobilitymarket-shareKenyaclean-transportationReal-World RV Towing With The Silverado EV - CleanTechnica
The article from CleanTechnica details a real-world towing experience with the Chevrolet Silverado EV, focusing on the practical considerations and performance of towing a medium-sized travel trailer. The author emphasizes that towing with an electric vehicle (EV) requires careful preparation beyond simply hooking up the trailer, including ensuring proper hitch setup to manage trailer "squat" and verifying weight distribution. Without the Silverado EV’s optional self-leveling air suspension, the author measured the necessary hitch drop and found a standard 2-inch drop was sufficient. Weighing the loaded trailer and truck at a CAT scale confirmed that all weights were within the vehicle’s safety limits, aided by the EV’s heavy, low-mounted battery pack that maintained good traction and stability. In real-world testing on a 130-mile round trip in New Mexico, the Silverado EV demonstrated excellent stability and towing capability. The truck’s substantial weight relative to the trailer and low center of gravity contributed to a smooth, stable ride, even when passing large semi-trucks or climbing
energyelectric-vehiclestowingSilverado-EVbattery-technologyvehicle-safetyautomotive-materialsVon Optionalität zu Ergebnissen: Wie Deutschland Wasserstoff neu ausrichten kann, ohne das Gesicht zu verlieren - CleanTechnica
The article from CleanTechnica critically examines Germany's current hydrogen strategy, highlighting a significant disconnect between infrastructure readiness and actual operational use. Despite having a physically completed hydrogen backbone—comprising pipelines, compressors, and pressurized lines—Germany faces a situation where no suppliers feed hydrogen into the system, no contractual buyers withdraw it, and no credible short-term plans exist to change this status. Industrial stakeholders have indicated that hydrogen use in sectors like transport and heating has already failed at the planning stage. Consequently, the debate has shifted from whether hydrogen can theoretically aid decarbonization to what practical steps Germany should take now to protect households, maintain industrial competitiveness, and achieve emissions reductions at the lowest system cost. The article stresses that this challenge must be addressed domestically, as energy infrastructure, industrial policy, and regulated networks fall under national jurisdiction. While external analysts can offer perspectives, the responsibility lies with Germany’s strong institutions, technical expertise, and clear climate ambitions. The piece advocates for a strategic communication approach that moves
energyhydrogendecarbonizationGermanyenergy-infrastructureclimate-policyelectrification10,000 New EV Chargers Planned For UK - CleanTechnica
The UK county of Kent is set to significantly expand its electric vehicle (EV) charging infrastructure with the installation of 10,000 new public EV chargers, increasing the total from just over 1,000 to approximately 11,000. This initiative, funded by the Department for Transport’s Local Electric Vehicle Infrastructure (LEVI) Capital Fund and supported by Kent County Council, aims to provide reliable and affordable EV charging within walking distance of residents’ homes, particularly benefiting those without off-road parking. The expansion is intended to prepare Kent for a future with greater EV adoption without increasing council tax costs. This large-scale increase in charging points addresses a key barrier to EV adoption known as “range anxiety,” where potential EV users worry about limited driving range. By ensuring widespread availability of chargers, the need for EVs with very large batteries diminishes, making EV ownership more practical and accessible. The southeast region of England, which includes Kent, has already seen a 29% growth in public EV chargers over the
energyelectric-vehiclesEV-chargerscharging-infrastructuresustainable-transportationclean-energyUK-energy-policy3D-printed nuclear batteries could power long-duration space, defense missions
South Australian engineering firm entX, in collaboration with the University of Adelaide, is developing GenX, a 3D-printed nuclear battery designed to provide long-duration, maintenance-free power for space, defense, and remote missions. Unlike traditional bulky nuclear generators that use heat from plutonium decay, GenX employs betavoltaics—ultra-thin, additively manufactured devices that stack nanoscale layers of metals and semiconductors to achieve unprecedented power densities in a compact, durable form. This innovative approach represents a significant advancement over conventional batteries, enabling energy solutions where solar power and refueling are impractical, such as deep ocean drones or remote sensors. The project, supported by a $1.8 million investment and the Additive Manufacturing Cooperative Research Centre, aims to transition GenX from a laboratory prototype to commercial production within 14 months. Custom 3D-printed radiation shields will ensure safe deployment in satellites, submersibles, and other platforms. The technology promises to unlock new
energynuclear-batteries3D-printingadditive-manufacturingbetavoltaicsspace-technologylong-duration-power-sourcesHow diesel submarines run underwater without engines needing air
Diesel-powered submarines face the fundamental challenge that their engines require oxygen to operate, yet they routinely travel underwater where air is unavailable. Naval engineers resolved this over a century ago by developing the diesel-electric propulsion system. In this setup, diesel engines run only when the submarine is surfaced or near the surface using a snorkel mast, powering generators that charge large onboard batteries. Once submerged, the diesel engines are shut down, and the submarine moves silently using electric motors powered by the stored battery energy. This separation of power generation and propulsion allows underwater operation while enhancing stealth, as electric motors produce far less noise than combustion engines. While diesel-electric submarines can operate underwater quietly, their endurance is limited by battery capacity. To recharge, they must surface or snorkel, which risks detection due to visible masts and exhaust. To address this, many modern diesel submarines incorporate air-independent propulsion (AIP) systems that generate electrical power without atmospheric oxygen, extending underwater endurance from about two days to several weeks at
energydiesel-electric-propulsionsubmarine-technologybattery-storageelectric-motorsunderwater-engineeringnaval-engineeringNew extraction tech puts focus on Petalite for future lithium supply
Petalite, a lesser-known lithium aluminum phyllosilicate mineral, is gaining attention as a strategic alternative source of lithium to meet the rapidly growing global demand driven by electrification and renewable energy expansion. While spodumene currently dominates lithium supply due to its high concentration and established processing methods, petalite offers unique industrial advantages such as hardness and heat resistance, making it valuable for heat- and scratch-resistant glass and ceramics. Significant petalite deposits exist in regions including Africa, the Americas, and Western Australia. However, extracting lithium from petalite is more complex, requiring higher heat and pressure to access the lithium content. Australian researchers at CSIRO have developed a novel extraction technology called LithSonic, funded by Australia’s Critical Minerals R&D Hub, which builds on earlier MagSonic technology. LithSonic addresses the key challenge of lithium’s extreme reactivity at high temperatures by employing supersonic flow and shock quenching to rapidly cool lithium vapor, stabilizing lithium metal before it can revert to
energylithium-extractionpetaliterenewable-energyelectric-vehiclesbattery-materialsenergy-transitionMercedes-AMG confirms powerful electric SUV coupe as EV push grows
Mercedes-AMG has confirmed plans to expand its electric vehicle (EV) lineup with a high-performance electric SUV and a dramatic coupe-style variant, targeting a 2027 launch. This move aligns with the brand’s strategy to capitalize on the global popularity of SUVs, which now constitute over half of Mercedes-Benz’s sales. The upcoming electric SUVs will be built on the dedicated AMG.EA platform, designed specifically for high-performance EVs, supporting high power output, rapid charging, and consistent performance. Powertrains are expected to feature a tri-motor setup with an 800-volt architecture and cylindrical battery cells, aiming for power outputs in the four-figure horsepower range, placing these models among the most powerful electric SUVs on the market. The electric SUV coupe will be the third model in AMG’s EV family, complementing a Porsche Cayenne-sized electric SUV and a production version of the GT XX concept, which will serve as AMG’s first fully electric car. The GT XX prototype demonstrated up to
energyelectric-vehiclesMercedes-AMGelectric-SUVbattery-technologyhigh-performance-EVelectric-mobilityThis Startup Thinks It Can Make Rocket Fuel From Water. Stop Laughing
The article discusses a startup called General Galactic, founded by two young engineers, that aims to revolutionize space propulsion by using water as rocket fuel—a concept long theorized but never successfully demonstrated at scale. Their upcoming Trinity mission plans to launch an 1,100-pound satellite that will use water as its sole propellant, employing two propulsion methods: chemical propulsion via electrolysis to split water into hydrogen and oxygen for combustion, and electric propulsion using a Hall thruster that ionizes water-derived plasma for efficient thrust. This dual approach aims to combine the high thrust of chemical rockets with the efficiency and longevity of electric propulsion. General Galactic’s innovation addresses a critical challenge in space exploration: creating a sustainable refueling infrastructure to enable deeper space missions, such as establishing a gas station on Mars and building a network of in-space refueling points. Beyond exploration, their technology could enhance satellite maneuverability amid rising geopolitical tensions in orbit, providing rapid response capabilities to avoid close encounters with rival satellites. The founders, who met
energyrocket-fuelspace-propulsionelectric-propulsionchemical-propulsionsatellite-technologywater-based-fuelElon Musk prioritizes Moon base development over near-term Mars goals
Elon Musk has announced that SpaceX is shifting its primary focus from Mars to the Moon, aiming to establish a "self-growing city" on the lunar surface within the next decade. This pivot is driven by the goal of creating a faster and more practical "backup" for human civilization. SpaceX plans an uncrewed lunar landing as early as March 2027, capitalizing on the Moon’s logistical advantages—such as more frequent launch windows (every 10 days) and shorter travel times (two days)—compared to Mars, which has a launch window every 26 months and a six-month transit. Despite this shift, Musk still envisions breaking ground on a Martian city within five to seven years, but the Moon is now the near-term priority. This strategic change aligns with recent investor briefings and reflects a broader ambition to reclaim the lunar surface amid growing competition, notably from China’s accelerating lunar program. NASA’s Artemis II mission, planned to send astronauts to the Moon’s
space-explorationlunar-baseSpaceXenergyAI-satellitesorbital-data-centerssolar-powerWhy China’s Aluminum Industry May Have Reached Peak CO2 - CleanTechnica
China’s aluminum industry is likely to have reached its peak CO2 emissions in 2024, not due to a sudden drop in production or a single policy change, but because of a structural transformation in the geography and methods of aluminum production. China produces about 44 million tons of primary aluminum annually, accounting for nearly 60% of global output. Historically, aluminum smelting was concentrated in coal-heavy provinces, where electricity generation was highly carbon-intensive, resulting in sector emissions exceeding 400 million tons of CO2 per year. From the early 2000s to around 2014, aluminum output and coal power generation grew in tandem, driving up emissions. Starting in the mid-2010s, environmental pressures, coal overcapacity concerns, and the completion of large hydroelectric projects in southwestern China prompted a major geographic shift in aluminum production. Smelters were relocated from coal-dependent regions to hydro-rich provinces like Yunnan and Sichuan, where electricity emissions per ton of aluminum dropped dramatically—from roughly
energyaluminum-industryCO2-emissionsChinaelectricity-demandhydro-powerindustrial-emissionsWhich of the 132 Chinese EV Automakers Will Enter Canada? - CleanTechnica
The article from CleanTechnica discusses the potential entry of Chinese electric vehicle (EV) manufacturers into the Canadian market as a strategic gateway to North America. Canada is seen as an attractive entry point due to its stringent safety and environmental standards, a consumer base receptive to EVs, and comparatively more regulatory flexibility than the United States. While an initial quota of 49,000 Chinese EV units is set for Canada, this represents only about 3.77% of the Canadian light vehicle market, which is dominated by domestic assembly from major automakers like Ford, GM, Honda, Stellantis, and Toyota. The article emphasizes that the question is less about whether Chinese EV brands can succeed in Canada—BYD, for example, already holds about 18% of the global EV market and sold over 4 million new energy vehicles in 2024—but rather which other Chinese manufacturers have the institutional capacity and readiness to follow BYD’s lead. The analysis, based on insider industry sources and vetted by experienced
energyelectric-vehiclesEV-marketChinese-automakersautomotive-industryclean-technologyNorth-America-marketA New Energy Storage Startup Challenges Tesla In US Market
The article discusses Lunar Energy, a new startup challenging Tesla in the U.S. residential energy storage market. Lunar recently raised $232 million in Series C and D funding rounds, led by Activate Capital, B Capital, and Prelude Ventures, with participation from investors including Sunrun, DCVC, and SK Group. Lunar’s AI-powered energy storage system learns individual household electricity consumption patterns to optimize solar energy use and reduce electricity costs. The company claims its customers save an average of $464 annually through virtual power plant programs, outperforming standard home battery savings of $338. Lunar’s CEO, Kunal Girotra, a former Tesla Energy team member, aims to scale the company’s model to help homes become active participants in a smarter, more resilient grid. Notably, Sunrun, a major solar installer and Tesla partner, is investing in Lunar Energy, signaling a potential shift in the residential energy storage landscape. Despite this investment, Sunrun maintained its collaboration with Tesla through a joint home energy plan launched in
energyenergy-storagerenewable-energyAIhome-batteryvirtual-power-plantclean-energyDeutschlands Rechnungshof erklärt die vermeintliche Unvermeidlichkeit von Wasserstoff für beendet - CleanTechnica
Der Sonderbericht des Bundesrechnungshofs vom Oktober 2025 zur deutschen Wasserstoffstrategie zieht eine kritische Bilanz: Trotz erheblicher finanzieller Mittel – über 7 Milliarden Euro in 2024 und 2025 sowie mehrjährige Zusagen in Milliardenhöhe – erfüllt die Strategie die gesetzlich geforderten Kriterien wie Versorgungssicherheit, Bezahlbarkeit, Umweltverträglichkeit und Klimaneutralität nicht. Die ursprünglich geplante Elektrolysekapazität von 10 GW bis 2030 wird voraussichtlich nicht erreicht, mit weniger als 0,2 GW in Betrieb bis 2025 und einer erwarteten Kapazität von unter 5 GW bis 2030. Auch die Importprognosen sind unrealistisch, da Deutschland allein eine Nachfrage von bis zu 91 TWh erwartet, während weltweit nur 63 TWh grüne Wasserstoffproduktion mit finalen Investitionsentscheidungen bestehen. Programme wie H2Global und der Green Hydrogen Fund konnten bislang keine entscheid
energyhydrogenenergy-policyrenewable-energygreen-hydrogenenergy-strategyGermany-energyAI Startup That Does EV-Related Materials Science Discovery Raises $8M - CleanTechnica
UK-based AI startup Polaron, specializing in materials science discovery for electric vehicle (EV) batteries, has raised $8 million in funding led by Racine2, with co-investments from Speedinvest and Futurepresent. Polaron focuses on improving battery performance not by changing chemistry but by optimizing manufacturing processes. By analyzing microscopy images of battery electrodes at the microstructural level—examining particles, grains, pores, and fibers formed during production—Polaron helps redesign manufacturing recipes to enhance energy density. Early deployments have achieved over 10% improvement in energy density by refining how electrodes are processed, such as mixing, drying, and compression, rather than altering the materials themselves. Polaron’s AI-driven platform enables EV makers and battery manufacturers to automate the interpretation of thousands of microscopy images, reducing subjectivity and accelerating research and development. It allows engineers to digitally explore a wide range of manufacturing parameters and predict their impact on battery performance, facilitating advancements in fast charging, energy density, and battery lifetime. The
energymaterials-sciencebattery-technologyelectric-vehiclesmaterials-discoveryenergy-densitymanufacturing-optimizationWenn Europas wirtschaftspolitische Institutionen sich vom Wasserstoff abwenden - CleanTechnica
The article discusses a significant shift in the stance of key European economic policy institutions regarding hydrogen as a broad energy carrier. The German Council of Economic Experts and the French Conseil d’analyse économique have jointly moved away from promoting hydrogen for widespread use, particularly in heavy road freight transport—a sector previously seen as a major hydrogen demand driver. Their analysis found that battery-electric trucks, combined with high-performance charging infrastructure, are more efficient, cost-effective, quicker to implement, and easier to integrate into the expanding electricity grid than hydrogen fuel cell trucks. The councils highlighted that hydrogen systems suffer from higher costs, complexity, and energy losses, with fuel cell trucks converting only about a quarter of the original electricity into motion compared to roughly 75% for battery-electric trucks. Based on a comprehensive system comparison, the councils recommended prioritizing public investments in electricity grids and charging infrastructure, while restricting hydrogen use to applications where electrification is impractical. They also advised canceling plans and budgets for hydrogen refueling stations and removing synthetic fuels from
energyhydrogenfuel-cellselectric-trucksenergy-infrastructureenergy-policysustainable-transportationChery to launch world’s first mass-produced pure electronic brakes
Chinese automaker Chery Automobile is set to become the first in the automotive industry to mass-produce pure electronic mechanical braking (EMB) systems. This breakthrough technology, developed over three years, replaces traditional hydraulic brake components with fully electronic controls, enabling millisecond-level response times and ultra-precise actuation critical for vehicle safety. The EMB system will debut commercially in the Exeed EX7, launching in the first quarter of the year, and uses electrical signals to directly control braking at each wheel, eliminating hydraulic lines and improving braking speed, precision, and integration with advanced driver-assistance and autonomous driving systems. Chery’s EMB technology, combined with its Flying Fish Chassis 3.0 platform, enhances vehicle stability and control by allowing the car to better sense and respond to road conditions. Additionally, filings for the Exeed EX7 reveal battery options for both range-extended and fully electric versions: the range-extended models feature 39.8 kWh and 39.9 k
energyelectric-vehicleselectronic-braking-systemautomotive-technologybattery-technologyregenerative-brakingautonomous-driving85% hydrogen fuel efficiency: New catalyst solves decades-old issue
Researchers at Washington University in St. Louis have developed a novel method to stabilize iron catalysts for hydrogen fuel cells, aiming to reduce the high manufacturing costs of fuel-cell vehicles. Currently, platinum catalysts, which account for about 45% of a fuel cell stack’s cost, are prohibitively expensive due to platinum’s rarity and rising demand. By replacing platinum with abundant and low-cost iron, the researchers seek to make fuel-cell vehicles more cost-competitive with battery-electric and internal combustion engine vehicles. Their approach involves creating a chemical vapor environment during thermal activation to stabilize iron catalysts, enabling them to maintain sufficient activity and durability in the acidic conditions of proton exchange membrane fuel cells (PEMFCs). The research focuses on PEMFCs because of their suitability for heavy-duty vehicles such as trucks, buses, and construction equipment, which often operate from centralized refueling stations, simplifying hydrogen infrastructure challenges. Hydrogen fuel cells offer high energy efficiency—over 60% energy extraction from fuel, potentially reaching 85% when
energyhydrogen-fuel-cellscatalystsiron-catalystfuel-cell-vehiclesPEMFCrenewable-energyWie frühe Klimaführerschaft Deutschland auf die falsche Wasserstoffwette festlegte - CleanTechnica
The article from CleanTechnica discusses how Germany’s early commitment to hydrogen as a climate solution shaped its energy strategy, ultimately leading to what the author terms a “wrong hydrogen bet.” In the 1990s and early 2000s, climate risks were recognized but practical decarbonization options were limited. Renewable energies like wind and solar were costly and technically constrained, while batteries were expensive, heavy, and short-lived. Hydrogen, by contrast, was already widely produced and used industrially, transported via pipelines, and demonstrated in fuel cell vehicles. It appeared to offer multiple advantages: storing excess renewable energy, seasonal storage, transport through existing pipelines, and clean vehicle fuel with only water as a byproduct. Thus, hydrogen quickly evolved from a technological option into a strategic cornerstone, supported by national roadmaps, research, regulation, industry coalitions, and workforce training. This institutional embedding of hydrogen created a strong path dependency that made later course corrections difficult, as budgets, careers, regulations, and
energyhydrogenrenewable-energyenergy-storagedecarbonizationfuel-cellsenergy-policyCanada’s EV Policy Shift Is About Credits, Not Mandates - CleanTechnica
Canada has shifted its electric vehicle (EV) policy from explicit sales quotas to a system focused on tightening fleet average greenhouse gas emissions standards, combined with open credit trading and a trade policy that permits significant imports of low-cost EVs. Rather than mandating fixed EV sales percentages, the government now requires manufacturers and importers to meet progressively stricter average emissions targets across all vehicles sold each year. EVs count as zero emissions, while internal combustion vehicles are assessed by their certified CO2 output. The standards are set to tighten annually by about 10%, aiming to reduce fleet average emissions from around 170 gCO2/km in 2027 to near 100 g by 2032. Compliance is measured over a vehicle’s lifetime emissions, with credits generated by selling low- or zero-emission vehicles that can be traded among companies. This approach creates a market-driven system where manufacturers must increase EV sales rapidly or face rising costs from purchasing emissions credits. For example, General Motors, which currently sells mostly
energyelectric-vehiclesemissions-standardsgreenhouse-gascarbon-creditsautomotive-policyclean-energyNew study aims to create real blueprint of Petra's amazing water system
A recent archaeological study has revealed new insights into the advanced water management system of the ancient city of Petra, uncovering a 380-foot-long rare lead pipe within the ‘Ain Barq aqueduct. This discovery challenges previous assumptions that the aqueduct had a single channel, showing instead it had two main conduits, including one made of lead—a material choice reflecting Hellenistic engineering influences. The study highlights Petra’s sophisticated infrastructure, which included nine conduits, a large reservoir sealed by a dam, cisterns, basins, and runoff channels carved into rock, all designed to support the city’s water needs in an arid environment. The research, part of the Urban Development of Ancient Petra Project launched in 2023, emphasizes Petra’s technical prowess in overcoming the challenges posed by its rugged terrain. The lead pipe system was particularly suited to managing pressurized water across steep elevations, while later phases utilized terracotta pipes and open channels for distribution throughout the city. This engineering feat enabled Petra
energywater-managementancient-engineeringlead-pipesaqueductsarchaeological-technologyinfrastructure-materialsChina sends Shenlong spaceplane on its fourth orbital mission
China has advanced its development of reusable orbital spacecraft with the recent launch of its fourth experimental spaceplane mission, commonly referred to as Shenlong or "Divine Dragon." Since 2020, China has conducted four such missions, all launched from the Jiuquan Satellite Launch Centre using Long March-2F rockets, indicating a standardized and mature launch system. Official details remain scarce, but Chinese media describe the latest flight as a technology verification mission aimed at improving on-orbit systems and supporting the peaceful use of outer space. Previous Shenlong missions have demonstrated increasing capabilities, including long-duration orbital stays of over 260 days and advancements in thermal protection and power systems. Independent US tracking has raised suspicions that Shenlong may have dual-use military applications, particularly signals intelligence, after detecting radio signals over North America during the third mission. While China maintains a neutral public narrative focused on peaceful purposes, these observations suggest a strategic dimension to the program. Despite China’s progress, the US continues to lead in reusable space
energyreusable-spacecraftspaceplanethermal-protectionpower-systemsorbital-missionspace-technologyChina sends Shenlong spaceplane on its fourth orbital mission
China has advanced its development of reusable orbital spacecraft with the launch of its fourth experimental spaceplane mission since 2020. The vehicle, commonly referred to as Shenlong ("Divine Dragon") by space enthusiasts due to official secrecy, was launched from the Jiuquan Satellite Launch Centre aboard a Long March-2F rocket. Chinese authorities describe the mission as a technology verification effort aimed at improving reusable spacecraft systems for peaceful space applications, though details remain limited. Previous Shenlong missions have demonstrated increasing capabilities, including long-duration flights of up to 276 and 268 days, highlighting progress in thermal protection and power systems. Independent US tracking networks have observed signals from the Shenlong spacecraft over North America during its third mission, suggesting potential dual-use military functions such as signals intelligence, despite China's civilian framing. While China’s program is rapidly maturing, the US maintains a lead in reusable orbital spaceplanes with its X-37B, which recently began its eighth mission. The X-37B has incorporated advanced
energyspaceflightreusable-spacecraftthermal-protectionpower-systemssatellite-technologyorbital-missionsStellantis Stumbles In A Staggering EV Retreat - CleanTechnica
Stellantis has announced a significant retreat from electric vehicle (EV) production, primarily in North America, where it is effectively abandoning plug-in vehicles in favor of internal combustion engine (ICE) powertrains, including a return of the “Hemi” engine. This strategic reversal includes selling its stake in the NextStar battery joint venture to LG and has resulted in a massive financial loss estimated at $26 billion. This loss surpasses Stellantis’s own market capitalization and follows similar costly EV pullbacks by Ford and General Motors, although unlike those companies, Stellantis expects to continue losing substantial money on EVs into 2025. Consequently, Stellantis’s stock dropped about 24% following the announcement. The retreat also raises concerns about the use of billions in U.S. taxpayer subsidies initially intended to support EV manufacturing capacity, which will now be redirected to produce more polluting ICE vehicles, especially large pickups and SUVs. This shift highlights a broader policy challenge as Detroit automakers receive continued support despite
energyelectric-vehiclesStellantisautomotive-industryEV-subsidiesbattery-technologyinternal-combustion-engineWhich of the 132 Chinese EV Automakers Will Enter Canada? - CleanTechnica
The article from CleanTechnica explores which of the 132 Chinese electric vehicle (EV) manufacturers are likely to enter the Canadian market as China seeks to expand its EV presence beyond Europe and Southeast Asia. Canada is emerging as a strategic entry point into North America due to its stringent safety and environmental standards, a consumer base receptive to electrification, and comparatively greater regulatory flexibility than the United States. Although the initial quota for Chinese EVs entering Canada is limited to 49,000 units annually—about 3.77% of Canada’s light vehicle market—this controlled approach serves as a proving ground for Chinese automakers aiming for broader North American ambitions. BYD is identified as the dominant player likely to command roughly 40% of this quota (around 19,600 vehicles per year), leveraging its scale, vertical integration (including battery production and materials processing), and pricing power to compete effectively without subsidies. BYD’s proven global success and ability to meet Canada’s demanding cold-weather and long-distance driving
energyelectric-vehiclesEV-marketbattery-technologyautomotive-industryChina-automakersclean-energyNew York lawmakers propose a three-year pause on new data centers
New York state lawmakers have proposed a bill to impose a moratorium of at least three years on permits for constructing and operating new data centers. This move reflects growing bipartisan concerns about the environmental and community impacts of data centers, especially as tech companies expand AI infrastructure. New York joins at least five other states considering similar pauses, with both progressive and conservative figures, including Senator Bernie Sanders and Florida Governor Ron DeSantis, voicing criticism over data centers’ energy consumption and associated costs. The bill, sponsored by Democratic state senator Liz Krueger and assemblymember Anna Kelles, aims to give New York time to develop stronger policies to manage the rapid growth of data centers and avoid potential negative consequences such as increased utility bills for residents. Over 230 environmental groups, including Food & Water Watch and Greenpeace, support a national moratorium on new data center construction, with Food & Water Watch crediting the New York proposal as their initiative. Governor Kathy Hochul recently announced Energize NY Development, a program intended
energydata-centersenergy-policyinfrastructureenvironmental-impactenergy-consumptionrenewable-energyTesla Doesn't Really Care About Energy Storage, Do You?
The article critiques Tesla's shifting focus under CEO Elon Musk, highlighting concerns about the company's commitment to energy storage amid other distractions. While Tesla’s Powerwall home energy storage system has achieved significant milestones—surpassing one million sales across 30 countries since its 2015 launch—the product appears to be losing market traction. Investment bank ROTH Capital Partners reports a sharp decline in Tesla’s share of battery sales, with installers expressing negative feedback and removing Powerwall references from marketing materials. This downturn contrasts with Tesla’s previously dominant position, as indicated by Energy Sage’s 2024 data showing a 63% share of Powerwall quote requests, suggesting a potential market shift away from Tesla’s integrated energy solutions. Beyond Tesla’s core business, the article touches on Elon Musk’s controversial roles in other ventures. It notes the problematic use of SpaceX’s Starlink terminals by Russian forces in Ukraine, raising questions about delayed responses to unauthorized use. Additionally, Musk’s transformation of Twitter into the platform “X” is
energyenergy-storageTesla-Powerwallsolar-panelsclean-energyhome-energy-systemsrenewable-energyYou Can't Just Walk Out On Climate Frameworks! - CleanTechnica
The article discusses the controversial U.S. withdrawal from the Paris global climate frameworks under the United Nations Framework Convention on Climate Change (UNFCCC). Former Senator Russ Feingold criticizes this move as unconstitutional and a dangerous overreach of executive power, noting that the original treaty was unanimously ratified by the Senate in 1992. Feingold argues that no president has the unilateral authority to exit such treaties, as this power contradicts Article VI of the U.S. Constitution and undermines the Senate’s coequal role in treaty ratification. He calls for congressional action to invalidate the withdrawal and suggests a constitutional amendment to require joint executive and Senate approval for treaty withdrawals, emphasizing that unilateral executive decisions threaten the credibility of U.S. treaty commitments internationally. The article also explains the importance of climate action frameworks, which are structured plans that set measurable targets for reducing greenhouse gas emissions and adapting to climate change. These frameworks provide transparency and help governments at all levels prepare for and mitigate the impacts of climate change
energyclimate-changeParis-Agreementgreenhouse-gas-emissionsenvironmental-policyinternational-treatiessustainabilityChina's 'artificial photosynthesis' method converts CO2 into petrol
Chinese scientists from the Chinese Academy of Sciences and the Hong Kong University of Science and Technology have developed an innovative artificial photosynthesis method that converts carbon dioxide (CO2) and water into valuable chemicals, including key petrol components, using sunlight. Their breakthrough involves a specially engineered silver-modified tungsten trioxide material capable of storing electrical energy generated by light exposure and releasing it as needed. This charge storage mechanism, inspired by natural photosynthesis, enhances the efficiency of solar-driven chemical reactions that reduce CO2 into useful intermediates like carbon monoxide, which can subsequently be transformed into liquid hydrocarbons and synthetic fuels compatible with existing fuel infrastructure. Published in Nature Communications, the research highlights a bioinspired charge reservoir strategy that addresses the challenge of coupling complex reactions such as water oxidation and CO2 reduction without relying on sacrificial agents. The system’s universal applicability with various catalysts offers a promising pathway for sustainable solar fuel production, potentially benefiting hard-to-electrify sectors like aviation and shipping. This approach not only advances efforts to
energyartificial-photosynthesissolar-fuelscarbon-dioxide-reductionphotocatalysisrenewable-energysustainable-fuel-alternativesChina conducted secret nuclear test, US claims a day after arms proposal
The United States has accused China of conducting secret low-yield nuclear explosive tests in 2020, allegedly attempting to conceal them by detonating devices in large underground cavities to muffle seismic signals—a technique known as “decoupling.” This method can make nuclear tests difficult to detect through global seismic monitoring, which is crucial for verifying compliance with nuclear test bans. The alleged test reportedly occurred just one day after the expiration of the New START treaty, coinciding with a new arms control proposal by the US. China has neither confirmed nor denied these allegations, and no definitive proof has been publicly presented. These accusations come amid broader tensions over nuclear arms control, with Russia offering a temporary extension to the New START treaty, which the US declined, citing concerns about the treaty’s terms and compliance. The US claims China’s nuclear arsenal, officially estimated at around 600 warheads, is growing and that Beijing has little incentive to join non-proliferation agreements while lagging behind the US and Russia, each
energynuclear-testingarms-controlseismic-sensorsnuclear-treatyexplosive-yieldinternational-securityGeely pairs 93 kW methanol engine with electric motor in new hybrid EV
Geely is expanding its Galaxy Starshine 6 lineup with a new methanol plug-in hybrid powertrain, combining a 1.5-liter methanol engine producing up to 93 kW with an electric motor and a lithium-iron-phosphate (LFP) battery. This hybrid system aims to offer improved efficiency, extended driving range, and quick refueling with methanol, providing a versatile alternative to conventional gasoline or fully electric vehicles. The methanol hybrid retains the same dimensions as the standard Galaxy Starshine 6 sedan, indicating it fits seamlessly into the existing model lineup. This development underscores Geely’s long-term commitment to alternative fuels, particularly methanol technology, which the company has been researching and testing for over a decade. Notably, in 2022, Geely demonstrated the Methanol Hybrid Emgrand’s capability in extreme cold conditions, highlighting the practical potential of methanol hybrids. While specific performance figures such as total system output and electric-only range for the new methanol hybrid
energyhybrid-vehiclesmethanol-enginelithium-iron-phosphate-batteryalternative-fuelelectric-motorautomotive-technologyWill Water-Powered Microgrids Work in the Real World? - CleanTechnica
The article from CleanTechnica explores the potential and challenges of deploying water-powered microgrids—specifically those harnessing wave, tidal, and river-current energy—in remote communities where traditional electricity access is limited. It highlights the significant resource potential of marine energy across U.S. coastlines and rivers, as characterized by a 2021 National Laboratory of the Rockies (NLR) report. Remote areas like Alaska, with over 250 isolated microgrids, stand to benefit from these technologies, which could provide reliable and affordable power by leveraging local water resources. However, the article emphasizes the risks involved in integrating early-stage marine energy technologies into existing microgrids, particularly due to potential instability and economic challenges. To address this, NLR is conducting a four-part webinar series focused on testing and de-risking these technologies through advanced lab simulations and power-hardware-in-the-loop (PHIL) testing. This approach allows researchers to validate system performance and reliability without subjecting communities to experimental risks. The
energymicrogridsmarine-energyrenewable-energywave-energytidal-energyenergy-technologyCould Light Be Used To Drive Enzymes for Efficient Ammonia Production? - CleanTechnica
The article discusses innovative research into using light-driven processes to enhance ammonia production, a critical component of global agriculture and energy systems. Ammonia production currently consumes about 2% of the world's energy, with half produced industrially via the energy-intensive Haber-Bosch process and the other half through biological nitrogen fixation using nitrogenase enzymes. Biological fixation is more energy-efficient but geographically dispersed, limiting its industrial application. The research team from the National Laboratory of the Rockies and collaborating universities explored how to harness light energy to drive the nitrogenase enzyme, specifically focusing on the molybdenum-iron (MoFe) protein involved in nitrogen reduction. Their approach involves using cadmium sulfide (CdS) nanocrystals as catalytic mediators that convert light into high-energy electrons, which then fuel the MoFe protein to reduce nitrogen gas (N₂) into ammonia. This light-driven electron delivery bypasses the natural Fe protein electron donor, potentially enabling more efficient and localized ammonia synthesis under milder conditions.
energyammonia-productionnitrogenase-enzymesbiological-nitrogen-fixationnanocrystalsphotoexcited-electronssustainable-agricultureFrom Airports to Elementary Schools, New Examples of Geothermal Heating & Cooling Sites Emerge - CleanTechnica
The U.S. Department of Energy (DOE) Office of Geothermal has expanded its Geothermal Heat Pump (GHP) Case Study Yearbook with five new examples of geothermal heating and cooling systems across the United States. These case studies, developed by the National Laboratory of the Rockies in collaboration with the respective sites, highlight diverse applications of GHP technology in residential communities, schools, airports, colleges, and grocery stores. The updated database now features over 20 documented locations demonstrating the effectiveness of GHPs in leveraging stable subsurface temperatures to reduce energy consumption for heating and cooling. Key new case studies include The Town at Trilith in Georgia, one of the largest geothermal residential communities with 750 homes using individual GHP systems, and Spring Mills Primary School in West Virginia, part of a district-wide upgrade that cut energy use by 75%. At Louisville Muhammad Ali International Airport, geothermal wells beneath the airfield support heating and cooling for the terminal, projected to save $400,000 annually. Central
energygeothermal-heatinggeothermal-coolingenergy-efficiencyrenewable-energyheat-pumpssustainable-buildingsHow Flexibility, Not Nuclear, Can Secure Ontario’s Electricity Future - CleanTechnica
The article discusses Ontario’s current electricity planning approach, which heavily favors expanding nuclear power to secure future reliability amid rising demand. Ontario already relies on nuclear for about 55% of its electricity, supplemented by hydro at 25%, while renewables like wind and solar remain a small fraction due to political decisions that curtailed renewable contracts in 2018. The province plans a new nuclear site in Port Hope to meet projected winter peak demands expected to rise by 65–75% by 2050, with winter peaks around 36–37 GW. The Independent Electricity System Operator (IESO) focuses on ensuring firm, always-available capacity during peak hours, particularly cold winter evenings, rather than on total annual energy supply. Nuclear plants, which run continuously and are not dispatchable, are counted as fully available capacity during peaks despite maintenance downtime, reflecting a conservative reliability approach that prioritizes avoiding blackouts. However, the article highlights a critical distinction between total energy demand growth and peak demand growth. While
energyelectricitynuclear-powerrenewable-energygrid-reliabilityenergy-demandOntario-energy-policyDonald Trump Forgoes Enforcement of Toxic Coal Ash - CleanTechnica
The article reports that under Donald Trump’s administration, the Environmental Protection Agency (EPA) granted polluters a 33-month extension—double the previously proposed duration—to clean up coal ash dump sites. This decision delays enforcement of coal ash cleanup standards designed to prevent toxic substances like mercury, lead, and arsenic from contaminating water sources. The Sierra Club strongly criticized this move, condemning it as prioritizing polluters’ interests over public health and environmental safety. Laurie Williams, Director of the Sierra Club Beyond Coal Campaign, emphasized that the extension allows companies to "cut corners" and postpone compliance with commonsense regulations, thereby endangering communities. The Sierra Club, as the largest grassroots environmental organization in the U.S., continues to advocate for clean energy, public health, and environmental protection through activism and legal efforts. The article highlights the ongoing tension between environmental advocacy groups and regulatory decisions under the Trump administration regarding toxic coal ash management.
energycoal-ashenvironmental-protectionpollutionEPAclean-energypublic-healthEngineered biochar turns sunlight into a powerful cleanup tool
Researchers have developed engineered biochar combined with artificial humic substances that significantly enhance sunlight-driven chemical reactions, presenting a novel solar-powered approach to environmental pollution cleanup. By synthesizing humic substances from pine sawdust through controlled hydrothermal treatment, the team created hybrid materials with tunable molecular structures that exhibit much stronger electron-donating properties under sunlight compared to conventional biochar. This engineering enables the biochar to actively drive reduction reactions critical to metal cycling and contaminant transformation in natural settings. Testing with silver ion reduction demonstrated that materials treated at higher temperatures (notably 340°C) achieved reduction efficiencies over nineteen times greater than those treated at lower temperatures. This improvement is attributed to increased phenolic functional groups that generate reactive superoxide radicals under sunlight, facilitating ligand-to-metal charge transfer. Additionally, the biochar dynamically releases dissolved organic molecules when exposed to light, further amplifying photochemical activity and indicating that biochar is an active participant in environmental redox processes rather than a passive sorbent. This
energymaterialsbiocharsunlight-driven-reactionsenvironmental-cleanupphotochemical-activityartificial-humic-substancesOur New Combo Washer/Heat Pump Dryer Uses Less Than 1 kWh of Electricity Per Load - CleanTechnica
The article discusses the author's positive experience with a new combination washer and heat pump dryer that uses less than 1 kWh of electricity per load, highlighting its energy efficiency and convenience. The machine integrates washing and drying in one unit, completing both processes in about two hours while consuming significantly less energy than traditional dryers. This technology represents a significant advancement in heat pump drying, combining innovative design with practical energy savings. The author recounts their journey toward more efficient laundry methods, starting with hang drying clothes outdoors, which is energy-free and imparts a fresh scent but is seasonal and not always practical. In 2022, they upgraded from an old, inefficient dryer to a compact heat pump dryer from Insignia, which uses about 0.5 kWh per load—far less than standard electric dryers that consume 3-4 kWh. While efficient, the compact dryer had limitations such as smaller drum size requiring load splitting and longer drying times. In 2023, the introduction of combo washer
energyheat-pump-dryerenergy-efficiencyhome-applianceslaundry-technologyelectric-appliancesenergy-savingPrince Andrew advisor pitched Jeffrey Epstein on investing in EV startups like Lucid Motors
The article reveals that David Stern, a little-known businessman and close advisor to former Prince Andrew, attempted to involve convicted sex offender Jeffrey Epstein in investing in electric vehicle (EV) startups during the late 2010s. Stern saw an opportunity amid Lucid Motors’ 2017 Series D funding round, where Ford was a potential lead investor but was blocked by Jia Yueting, founder of rival Faraday Future. Stern pitched Epstein on investing in Lucid, Faraday Future, and another EV startup, Canoo, highlighting Jia’s financial struggles and the growing EV market driven by Tesla and other innovators. However, there is no evidence Epstein actually invested in these companies. Lucid eventually raised over $1 billion from Saudi Arabia’s sovereign wealth fund in late 2018, while Faraday secured funding from Chinese conglomerate Evergrande. The documents, part of a Department of Justice disclosure of Epstein-related files, shed light on Epstein’s extensive, previously underreported ties to Silicon Valley and startup ecosystems
energyelectric-vehiclesEV-startupsLucid-MotorsFaraday-Futureautonomous-vehiclesinvestmentWorld's biggest 20-MW offshore wind turbine now powers China's grid
China has successfully connected the world’s first 20-megawatt (MW) offshore wind turbine to its power grid, marking a significant milestone in renewable energy. Developed by China Three Gorges Corporation (CTGC) in partnership with Beijing-based Goldwind, the turbine is installed off the southeastern coast of Fujian Province at the Zhangpu Liuao Phase 2 offshore wind farm. This turbine, the largest single offshore unit globally, features a hub height of 174 meters and rotor diameter of 300 meters, with blades each measuring 147 meters. Its design incorporates advanced materials and digital integration to enhance efficiency while reducing weight and installation costs. The turbine is capable of generating over 80 million kilowatt-hours annually, enough to power approximately 44,000 households and displace around 22,000 tons of coal each year. Its deployment in waters over 40 meters deep demonstrates China’s technical progress in offshore wind technology and supports ambitions for next-generation wind power in deeper waters. This achievement
energyoffshore-wind-turbinerenewable-energywind-powerChina-energy-gridclean-energyGoldwindGoogle and Microsoft-backed Terradot acquires carbon removal competitor
Terradot, a carbon removal startup backed by major investors including Google, Microsoft, Kleiner Perkins, and Gigascale Capital, has acquired its competitor Eion, another company specializing in enhanced rock weathering (EWR). Both companies focus on spreading pulverized rocks on farmland to accelerate the natural process of carbon dioxide absorption from the atmosphere, a method known as enhanced rock weathering. Terradot primarily operates in Brazil using basalt as its mineral of choice, while Eion's operations and specifics were not detailed in the article. EWR has significant potential as a carbon removal strategy but requires large-scale and geographically distributed operations to be effective. A key challenge highlighted is the pricing gap between what EWR companies aim to charge for their carbon removal services and what buyers are willing to pay, as noted in a survey by CDR.fyi. The acquisition likely aims to consolidate resources and expertise to scale operations and address market challenges in the carbon removal sector.
energycarbon-removalenhanced-rock-weatheringclimate-technologysustainable-agriculturecarbon-captureenvironmental-innovationNew York Is the Latest State to Consider a Data Center Pause
New York lawmakers have introduced a bill proposing a three-year moratorium on new data center development, making the state the sixth in recent weeks to consider such a pause amid growing bipartisan concern. The bill, presented by Democrats Senator Liz Krueger and Assemblymember Anna Kelles, aims to address the rapid expansion of data centers, which has raised issues related to electric grid strain, environmental impact, and consumer energy costs. New York currently hosts over 130 data centers, with projects demanding significant electricity—tripling grid demand in one year—and prompting Governor Kathy Hochul to launch initiatives requiring data centers to contribute fairly to grid upgrades. This legislative move aligns with a broader national trend of opposition to data center growth, highlighted by Senator Bernie Sanders’ call for a national moratorium and Florida Governor Ron DeSantis’ criticism of data centers’ energy consumption. Environmental groups, including Food and Water Watch, have been instrumental in pushing for these moratoriums, citing data center expansion and the AI boom as major environmental
energydata-centerselectric-gridenergy-demandenvironmental-impactlegislationmoratoriumNew coil manufacturing machine brings limitless fusion energy a step closer
Japan’s Helical Fusion, in partnership with Sugino Machine Limited, has developed a unique coil manufacturing machine designed to produce high-temperature superconducting (HTS) spiral-shaped coils—critical components for its nuclear fusion reactor concept. These coils are essential for stably confining plasma, a key requirement for generating fusion energy. This advancement addresses a major manufacturing challenge in Helical’s Helix Program, which aims to deliver commercially viable nuclear fusion energy by around 2030. The Helix Program focuses on achieving three core requirements for commercial fusion power plants: net electricity generation, continuous steady operation, and maintainability, using current technologies. Helical plans to demonstrate these capabilities with its Integrated Demonstration Device, Helix HARUKA, followed by operating the Helix KANATA reactor to produce the first commercially viable fusion power. The newly completed coil manufacturing machine will enable efficient production of these high-performance HTS coils and is expected to play a critical role in assembling Helix HARUKA, with on
energynuclear-fusionhigh-temperature-superconducting-coilscoil-manufacturingfusion-reactorHelical-Fusionfusion-energy-technologyKia EV4 sets record with 250 mile range in extreme -24°F temperatures
The Kia EV4 electric hatchback demonstrated exceptional winter performance by achieving a driving range of 242 miles (390 kilometers) in the rigorous El Prix Winter Test Drive, conducted in Norway under extreme cold conditions as low as -24°F (-31°C). This test, regarded as the world’s largest and most demanding EV range challenge, involves driving from Oslo across varied terrain without recharging. The EV4 retained over 65% of its WLTP-rated range of 369 miles (594 kilometers), placing it among the top performers in both absolute range and efficiency for the event, and making it the best in its segment and price range. Additionally, the EV4 recharged from 10% to 80% in just 33 minutes, only slightly slower than its official rating, showcasing impressive fast-charging capability even in sub-zero temperatures. Kia attributes this winter-proof performance to the EV4’s advanced Gen4 battery system, which includes sophisticated thermal management and optimized coolant distribution to maintain stable cell temperatures
energyelectric-vehiclesbattery-technologythermal-managementelectric-car-rangeEV-chargingcold-weather-performanceUS to resurrect Cold War-era nuclear plant after 30-year dormancy
The US Department of Energy (DOE) has signed a lease with General Matter to repurpose the Cold War-era Fuels and Materials Examination Facility (FMEF) at the Hanford Site in Washington state. The 190,000-square-foot facility, completed in 1984 but unused since 1993, will be transformed into a center for advanced nuclear fuel cycle technologies. This initiative is part of a broader federal strategy to secure reliable, domestic baseload power to support the growing artificial intelligence (AI) sector, which demands continuous and substantial energy supplies. General Matter is also advancing a related project in Paducah, Kentucky, where it recently secured a $900 million contract to accelerate production of specialized nuclear fuel for next-generation reactors. The revival of these dormant nuclear sites reflects a strategic shift to treat nuclear fuel production as a national security priority and reduce dependence on foreign energy providers. Work has already begun at the Paducah site, with land clearing underway for a new enrichment plant, and construction
energynuclear-energynuclear-fuel-cycleenergy-infrastructureclean-energyenergy-securityadvanced-reactorsWhat’s Going On With BYD January Sales? - CleanTechnica
The article from CleanTechnica analyzes the factors behind BYD’s January sales performance, noting that while sales in China declined, export sales increased significantly by 43% year-over-year, totaling 100,009 units. The slowdown in China is largely attributed to seasonal effects, particularly the Lunar New Year holiday, which traditionally causes a dip in first-quarter sales as the country shuts down and consumer spending patterns shift. This seasonal trend is common across Chinese automakers, who often use this period for retooling and launching new models. BYD is currently undergoing substantial product updates, moving beyond last year’s software-focused Intelligent Driving Edition to introduce major mechanical upgrades such as new batteries, motors, powertrains, and platforms. These changes, including the rollout of the 1000V Super E platform and an anticipated next-generation PHEV platform with longer range and flash charging, require production interruptions and plant retooling, contributing to the temporary sales dip. Additionally, the reduction in China’s EV purchase
energyelectric-vehiclesbatteriespowertrainsEV-platformBYDautomotive-technologyEV News From Foxconn, BYD, & Nigeria - CleanTechnica
The article highlights contrasting trajectories in the electric vehicle (EV) industry between the United States and China. In the U.S., the EV revolution appears to be stalling, exemplified by General Motors’ decision to cease production of the next-generation Chevy Bolt and revert to gasoline-powered vehicles on that assembly line. Additionally, battery factories are being repurposed for energy storage rather than EV batteries, signaling a decline in American EV manufacturing. This shift risks rendering the U.S. irrelevant in the global EV market, as other countries advance rapidly. In contrast, China is accelerating its EV development with remarkable speed, often bringing new models to market in half the time typical elsewhere. The article focuses on Foxconn’s new facility in Zhengzhou, Henan province, which aims to produce next-generation EVs, electric architectures, and intelligent driving technologies. Foxconn, known for manufacturing Apple iPhones, is leveraging its contract manufacturing expertise to become a key player in the EV sector, similar to Magna International in Canada.
energyelectric-vehiclesbattery-technologyFoxconnmanufacturingautomotive-industryroboticsAnother Tesla Miss: Sodium-Ion Batteries (And Battery Swapping)
The article discusses the emerging prominence of sodium-ion batteries in the electric vehicle (EV) market, highlighting how Tesla has fallen behind in this area despite its early leadership in EV innovation. Sodium-ion batteries, while heavier than lithium-ion counterparts, offer advantages such as a less costly supply chain, longer range, faster charging, and superior cold-weather performance. Chinese battery manufacturer CATL has pioneered this technology, supplying sodium-ion batteries to automaker CHANGAN Automobile, which plans to mass-produce EVs featuring CATL’s Naxtra sodium-ion batteries later this year. CHANGAN emphasizes the batteries’ safety, reliability, and environmental benefits, including abundant raw materials and improved recycling. CHANGAN projects that sodium-ion battery ranges will soon reach 500–600 km for pure electric vehicles and 300–400 km for range-extended or hybrid models, potentially covering over half of the new energy vehicle market’s range requirements. The article also notes a renewed interest in range-extended EVs, which
energybatteriessodium-ionelectric-vehiclesCATLCHANGANbattery-technologyFree Bidirectional EV Chargers Provided For Massachusetts Program - CleanTechnica
The Massachusetts Clean Energy Center (MassCEC) has launched a pioneering program to provide free bidirectional electric vehicle (EV) chargers to selected participants, including school districts, municipal projects, and residents. This initiative aims to accelerate the adoption of Vehicle-to-Everything (V2X) technologies, which enable EVs to not only draw power from the grid but also supply stored electricity back to it. By doing so, these EVs can help reduce energy demand during peak periods, lower energy bills, and decrease reliance on new grid infrastructure. The program includes four municipal projects, five school districts, and 30 residences, collectively expected to deliver over one megawatt of power back to the grid during demand response events—enough to power approximately 300 average American homes for an hour. Bidirectional charging technology leverages the large battery packs of EVs as mobile energy storage assets, allowing them to function as "virtual power plants" (VPPs) when aggregated. This capability can enhance grid
energyelectric-vehiclesbidirectional-chargingvehicle-to-gridvirtual-power-plantsenergy-storageclean-energy-programsXiaomi EV battery holds 94.5% capacity even after 165,000 miles
A Xiaomi SU7 Pro electric vehicle (EV) has impressively retained 94.5% of its battery capacity after driving 165,000 miles (265,000 km) over 18 months, averaging about 373 miles daily. This level of battery health significantly exceeds typical expectations, as most EV manufacturers, including Tesla, predict around 20-30% battery degradation after similar mileage and timeframes. Tesla estimates its Model 3 or Y batteries retain about 70% capacity after 100,000 miles, making the Xiaomi SU7 Pro’s performance notably superior. The SU7 Pro’s 94.3 kWh battery pack has likely undergone over 500 full charge-discharge cycles, yet it remains in excellent condition, highlighting Xiaomi’s capability in producing durable EV batteries. This milestone has garnered attention on Chinese social media and from Xiaomi’s CEO Lei Jun. The owner, Mr. Feng, has saved approximately $14,300 in fuel costs and aims to reach 370,000 miles
energyelectric-vehiclesbattery-technologyXiaomi-SU7battery-capacityEV-battery-degradationsustainable-transportationOp-Ed: E-Trike Safety Is Real — But the Failure Runs Deeper than the Vehicles - CleanTechnica
The article from CleanTechnica highlights that while safety concerns around electric tricycles (e-trikes) and e-bikes in Philippine cities are valid, the root cause extends beyond rider behavior to deeper systemic issues. Observed problems such as poor lane discipline and unpredictable maneuvers reflect not just reckless driving but a broader governance failure. This includes regulatory gaps, weak enforcement of product standards, fragmented public education, and the lack of a cohesive long-term vision for electric mobility. The rapid influx of e-trikes occurred without a coordinated national plan, leading to a regulatory vacuum where overlapping responsibilities among the Department of Transportation (DoTr), Department of Trade and Industry (DTI), and Land Transportation Office (LTO) resulted in unclear classifications and enforcement delays. The article further explains that product safety standards for e-trikes are inconsistently applied, with many vehicles lacking basic safety features like properly positioned side mirrors, reliable lighting, and adequate battery protection. Although the DTI has a product standards framework, enforcement
energyelectric-vehiclese-trikestransportation-safetyregulatory-challengeselectric-mobilityproduct-standardsWhy energy use limits the sustainability of desalination
The article discusses the critical role and limitations of desalination as a response to global water scarcity, which affects nearly four billion people annually. Despite Earth being predominantly covered by water, less than one percent is accessible freshwater, driving increased reliance on desalination, especially in drought-prone coastal regions. Desalination, the process of removing salts and contaminants from seawater to produce freshwater, serves as a necessary but costly and energy-intensive solution. Approximately 350 million people depend on desalinated water, highlighting its importance despite environmental and economic drawbacks. Two primary desalination methods dominate: membrane-based reverse osmosis (RO) and thermal desalination. RO forces seawater through semipermeable membranes under high pressure to separate salts, requiring significant energy—up to 10 kWh per cubic meter for seawater—due to the need to overcome osmotic pressure and mechanical membrane limits. Thermal methods, such as multi-stage flash and multi-effect distillation, evaporate water to separate salts but consume even more energy
energydesalinationreverse-osmosiswater-scarcitysustainabilitymembrane-technologythermal-desalinationFusion ‘breakthrough’ achieved with pulse shot million times faster than blink of an eye
US-based Pacific Fusion has achieved a significant breakthrough in fusion research through four successful tests at Sandia National Laboratories’ Z Pulsed Power Facility. The team delivered an extraordinary 22-million-amp pulse in just 120 nanoseconds—about a million times faster than a blink—using a simplified target design consisting of a plastic core wrapped in aluminum. By precisely tuning the aluminum layer’s thickness, researchers enabled magnetic fields to diffuse into the fusion fuel, effectively “pre-magnetizing” it. This pre-magnetization traps heat more efficiently, facilitating fuel ignition during the main compression pulse and eliminating the need for large, expensive magnetic coils previously required. This advance simplifies the fusion system and supports Pacific Fusion’s goal of achieving net facility gain by 2030. The experiments also directly inform the design of Pacific Fusion’s planned Demonstration System to be built in New Mexico and validate their advanced simulation tools developed with the University of Rochester’s Flash Center. By replacing complex, costly external hardware with a simple aluminum-and
energyfusion-energymagnetic-confinementinertial-confinement-fusionfusion-researchenergy-breakthroughfusion-technologyToyota & Daihatsu Roll Out Shared Electric Kei Vans for Japan’s Last-Mile Logistics - CleanTechnica
Toyota and Daihatsu have jointly launched battery-electric kei commercial vans in Japan aimed at accelerating electrification in last-mile logistics. The vehicles share a common platform and powertrain but are marketed under different names: Toyota’s Pixis Van BEV and Daihatsu’s e-Hijet Cargo and e-Atrai, with nationwide sales beginning February 2. Developed in collaboration with Suzuki and Commercial Japan Partnership Technologies Corporation, these vans leverage Suzuki’s and Daihatsu’s kei-vehicle packaging expertise and Toyota’s electrification technology. Powered by Daihatsu’s e-SMART ELECTRIC system, the vans feature a 36.6 kWh lithium-ion battery, rear-wheel-drive e-axle, and deliver 47 kW power with 126 Nm torque. They offer a WLTC range of 257 km, the longest among electric kei commercial vans in Japan, suitable for a full day of urban deliveries. The kei vans maintain a payload capacity of 350 kg, matching their gasoline counterparts
energyelectric-vehiclesbattery-technologylast-mile-logisticsToyotaDaihatsuelectrificationScientists identify ‘space battery’ powering Earth’s auroras display
Scientists have identified Alfvén waves as the key “space battery” powering Earth’s auroras, solving a longstanding mystery about how charged particles are accelerated to create the spectacular light displays. These plasma waves travel along Earth’s magnetic field lines and continuously recharge the electric fields that drive high-energy particles into the atmosphere, sustaining the aurora rather than allowing it to fade quickly. The discovery was made by an international team led by researchers from The University of Hong Kong and UCLA, who applied insights from the magnetospheres of Jupiter and Saturn to Earth’s auroral processes. The team validated their findings using satellite data from NASA’s Van Allen Probes and the THEMIS mission, which confirmed that Alfvén waves actively replenish energy in the auroral acceleration region. This continuous energy supply prevents the electric fields from collapsing and maintains the aurora’s glow. Beyond explaining Earth’s aurora, the study offers a universal model for auroral phenomena across the solar system and potentially other galaxies, as Alfvén waves
energyspace-batteryaurora-borealisAlfvén-wavesplasma-physicsparticle-accelerationEarth's-magnetosphereFirst US solid-state EV battery to power 1,000+ hp Karma electric car
Factorial Energy has launched its first commercial solid-state battery program in the US, partnering with Karma Automotive to integrate its FEST (Factorial Electrolyte System Technology) batteries into Karma’s ultra-luxury electric vehicles. The collaboration will debut with the Karma Kaveya, an all-electric super-coupe boasting over 1,000 horsepower, 1,270 lb-ft of torque, a range exceeding 250 miles, and a 0-60 mph time under 3 seconds. Scheduled for a late 2027 US launch, this program aims to validate solid-state battery technology in real-world passenger vehicles while advancing domestic EV battery innovation. The FEST batteries offer significant advantages, including 500 to 600+ miles of range, approximately 40% weight reduction compared to traditional lithium-ion cells, and compatibility with up to 80% of existing lithium-ion manufacturing equipment. This compatibility facilitates faster scaling and production without the need for entirely new manufacturing lines. Karma’s president emphasized that the partnership enables delivering
energyelectric-vehiclessolid-state-batterybattery-technologyEV-innovationautomotive-materialsenergy-storageNew solar cell design cuts 90% defects, sets 2D/3D perovskite record
Researchers at the Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, have developed a novel buried-interface engineering strategy that significantly enhances the efficiency and durability of perovskite solar cells. By modifying tin dioxide (SnO₂) nanoparticles with thioglycolic acid (TGA) and oleylamine (OAm), they created a multifunctional electron transport layer (SnO₂-TGA-OAm) that triggers the formation of an ultra-thin two-dimensional (2D) perovskite layer exclusively at the buried interface during thermal annealing. This targeted approach suppresses interfacial defects by over 90% without affecting the bulk crystal structure, overcoming limitations of previous methods that indiscriminately formed 2D phases throughout the film. The new design achieved record power conversion efficiencies of 26.19% in small-area devices (0.09 cm²) and maintained high efficiencies in larger modules—23.44% for 21.54 cm
energysolar-cellsperovskiteinterface-engineeringdefect-reductionSnO2-nanoparticlesphotovoltaicsCATL unveil world's first sodium-ion EV with about 248-mile range
Chinese battery manufacturer CATL and automaker Changan have unveiled the world’s first passenger electric vehicle (EV) powered by sodium-ion batteries, marking a significant advancement in EV energy storage technology. The debut model, the Changan Nevo A06 (Qiyuan A06), features CATL’s Naxtra sodium-ion battery and offers an estimated driving range of about 248 miles (400 kilometers) on China’s standard test cycle (CLTC). This battery technology is notable for its enhanced safety profile, reduced fire risk, and improved performance in extreme temperatures compared to traditional lithium-ion batteries. CATL plans to begin mass production of the Naxtra batteries in June 2025, with the technology expected to be integrated across multiple Changan sub-brands and vehicle segments, potentially signaling a shift away from lithium-dependent batteries. The Naxtra sodium-ion battery achieves an energy density of up to 175 Wh/kg, comparable to lithium iron phosphate (LFP) batteries, and employs a cell
energyelectric-vehiclessodium-ion-batterybattery-technologyCATLEV-rangeenergy-storageNew Nissan LEAF Wins 3 More Awards! - CleanTechnica
The 2026 Nissan LEAF has garnered significant acclaim, winning three major awards that highlight its value, performance, and innovation in the electric vehicle (EV) market. It was named Best EV in the 2026 MotorWeek Drivers’ Choice Awards, which evaluates vehicles based on driving performance, technology, practicality, fuel efficiency, and value. MotorWeek praised the LEAF for its transformation and affordability, noting its continued appeal since its initial launch in 2011. Additionally, The Drive awarded the LEAF Best EV of 2026, recognizing its strong value proposition, driving experience, and an EPA-estimated range of up to 303 miles per charge, with a starting price lower than the original model. Cars.com also honored the new Nissan LEAF as Best Car of 2026, selecting it from over 40 new or redesigned models based on quality, innovation, and value. The publication emphasized the LEAF’s role in redefining affordable EV ownership through its range, smart technology,
energyelectric-vehiclesNissan-LEAFEV-awardsclean-energyautomotive-technologysustainable-transportationNIO Scores A Profit! - CleanTechnica
NIO, the Chinese electric vehicle (EV) manufacturer known for its innovative battery swapping technology and competitive EV designs, is on the verge of a significant financial milestone. After years of growth and overcoming challenges, the company is expected to report its first adjusted profit from operations (non-GAAP) for the fourth quarter of 2025, with estimates ranging from RMB 700 million to RMB 1.2 billion (approximately US$100 million to US$172 million). This marks a dramatic turnaround from the adjusted loss of RMB 5.54 billion recorded in the same quarter of 2024. The profitability is attributed to sustained sales growth, improved vehicle margins due to a favorable product mix, and ongoing cost reduction and operational efficiency efforts. Under GAAP measures, NIO is also expected to post a profit from operations between RMB 200 million and RMB 700 million (about US$29 million to US$100 million) for Q4 2025. However, these figures are preliminary,
energyelectric-vehiclesbattery-swappingEV-technologyclean-energyautomotive-industryprofitabilityCourt Says Texas Cannot Punish Investors for Taking Climate Change into Consideration - CleanTechnica
A U.S. District Court has ruled that Texas cannot enforce its 2021 "anti-ESG" law (Senate Bill 13), which sought to prohibit pension funds and other public entities from considering environmental, social, and governance (ESG) factors—such as climate change—in their investment decisions. The court found the law unconstitutional, violating the First and Fourteenth Amendments by imposing vague and overly broad restrictions that penalized protected speech and association. The law also conditioned access to public investments and contracts on compliance with these restrictions, effectively blacklisting financial firms that avoided fossil fuel investments. This ruling challenges similar laws enacted or proposed in other states that aim to restrict how public funds address climate-related risks. Advocates, including Ben Cushing of the Sierra Club, emphasized that managing financial risks related to climate change is a crucial part of responsible investing and fiduciary duty. They argue that political interference should not distort financial markets or punish firms for their investment choices. The decision is seen as a
energyclimate-changeESG-investingfossil-fuelssustainable-financeinvestment-lawpublic-pension-fundsTrump Tries to Cancel Millions More for EV Charging — Illegally, Of Course - CleanTechnica
The article discusses former President Donald Trump’s repeated attempts to cancel or withhold federally mandated funding for electric vehicle (EV) charging infrastructure, actions described as illegal and contrary to congressional authority. Initially, during his second term, Trump sought to stop funding and development of clean technology, including EV charging stations, even trying to rescind funds already approved and granted. Courts eventually ruled these attempts unlawful, mandating that the funds continue to be disbursed. However, Trump and his administration reportedly persisted in efforts to block clean energy infrastructure funding, defying legal rulings and the balance of powers established by the U.S. Constitution. The article highlights that the Bipartisan Infrastructure Law, signed by President Biden, allocates $2.5 billion over five years through the Charging and Fueling Infrastructure (CFI) grant program to support EV charging development. Since Congress controls federal spending, the president cannot unilaterally cancel or retract these funds. Environmental advocates, such as Sierra Club’s Clean Transportation for All
energyelectric-vehiclesEV-charging-infrastructureclean-energyrenewable-energy-policygovernment-fundingsustainable-transportationNew Sierra Club Map Shows Expensive U.S. Gas Buildout - CleanTechnica
The Sierra Club has released a new map highlighting the extensive planned buildout of natural gas power plants across several U.S. states, including Texas, Georgia, Indiana, Virginia, Missouri, and Arizona. This expansion comes amid a nearly 50 percent nationwide increase in electricity prices over the past year. Despite natural gas currently being the largest source of electricity generation, renewable energy continues to outperform gas in terms of new generation capacity. The Sierra Club criticizes utility companies for investing in costly and polluting gas infrastructure, particularly to power data centers for large technology firms, rather than transitioning to cheaper and cleaner renewable energy sources. Laurie Williams, Director of the Sierra Club Beyond Coal Campaign, condemned the continued reliance on fossil fuels, warning that it will lead to higher electricity bills and adverse health impacts such as asthma, heart and lung disease, and cancer for American families. She emphasized that renewable energy is not only cleaner but also more affordable and quicker to deploy. The Sierra Club, as the largest grassroots environmental organization in
energyrenewable-energygas-power-plantselectricity-pricesfossil-fuelsclean-energySierra-ClubWhy Sodium-Ion Batteries Are Happening Now - CleanTechnica
The article from CleanTechnica highlights the growing significance of sodium-ion batteries, driven largely by market dynamics and material cost pressures. CATL, the world’s largest battery producer, has been advancing sodium-ion battery production, signaling a strategic shift amid rising lithium prices and supply volatility. While lithium-ion batteries, particularly NMC and LFP chemistries, have dominated electric vehicle (EV) and energy storage markets, lithium carbonate prices surged sharply in 2025, increasing battery costs and prompting manufacturers to seek alternatives. Sodium-ion batteries offer a compelling solution due to sodium’s abundance, lower cost, and more stable supply compared to lithium, nickel, and cobalt. Sodium-ion battery technology leverages abundant elements such as sodium, iron, manganese, and nitrogen, with cathodes like Prussian blue analogs and layered oxides, and uses hard carbon anodes and aluminum current collectors, which are cheaper than graphite and copper used in lithium-ion batteries. This results in significantly lower material costs and reduced exposure to
energybatteriessodium-ion-batterieslithium-ion-batterieselectric-vehiclesenergy-storagebattery-technologyZinc–air battery offers 310 mW power, stable operation for 1,100 hours
Researchers from Donghua University and collaborators in China have developed advanced zinc–air batteries (ZABs) featuring a novel p–n heterojunction catalyst that integrates graphitic carbon nitride nanosheets with a carbon nanofiber network containing dual cobalt active sites. This catalyst significantly enhances oxygen reduction and evolution reactions under light irradiation, resulting in a peak power density of 310 mW/cm² and stable charge–discharge cycling for over 1,100 hours. The batteries also demonstrate strong mechanical flexibility, maintaining performance under repeated bending, with flexible prototypes achieving a peak power density of 96 mW/cm². The key innovation lies in combining photoactivity and electrocatalysis within a single air-electrode architecture, where photogenerated electrons and holes are spatially separated to suppress charge recombination and lower reaction energy barriers. This leads to a notably low oxygen reaction overpotential gap of 0.684 V under illumination, outperforming many existing bifunctional catalysts. The approach leverages light
energyzinc-air-batteryenergy-storageflexible-electronicselectrocatalysisphotoactivitybattery-technologyWorld's first five-ton eVTOL flies full transition with 932-mile range
AutoFlight has introduced Matrix, a groundbreaking five-ton electric vertical takeoff and landing (eVTOL) aircraft, which recently completed the world’s first public full-transition flight in its weight class. This milestone flight demonstrated Matrix’s ability to seamlessly transition from vertical takeoff to forward wing-borne cruise and back to vertical landing in a single sequence, validating the company’s advancements in aerodynamics, high-power electric propulsion, and flight control software. The aircraft, designed for both passenger and cargo missions, features flexible seating configurations for up to ten business-class or six VIP seats, and a cargo variant capable of carrying up to 1,500 kg with a large door accommodating standard air freight containers. Matrix employs a lift-and-cruise compound wing with a triplane layout and six-arm structure to ensure aerodynamic stability across all flight phases. The pure electric version offers a maximum range of 250 km (155 miles), while a hybrid-electric variant extends this to an impressive 1,500 km (932
energyelectric-propulsioneVTOLhybrid-power-systemaviation-technologyelectric-aircraftsustainable-transportMichigan Sues Big Oil For Antitrust Violations - CleanTechnica
On January 30, 2026, Michigan filed a lawsuit against major fossil fuel companies—including ExxonMobil, BP, Chevron, and Shell—and the American Petroleum Institute, accusing them of antitrust violations. Unlike previous climate-related lawsuits focused on environmental harm, Michigan’s suit alleges these companies conspired as a cartel to suppress renewable energy production and electric vehicle adoption. The complaint details coordinated actions such as abandoning renewable projects, using patent litigation to hinder competitors, suppressing information about fossil fuel costs and alternatives, and manipulating market investments to maintain fossil fuel dominance and inflate prices. Michigan Attorney General Dana Nessel framed the lawsuit as a response to an energy affordability crisis, blaming these corporations for prioritizing profits over consumer savings and competition. The suit argues that inflated prices for electric vehicles and renewable energy options result from this collusion, rather than natural economic factors. Fossil fuel companies have dismissed the allegations as baseless and legally incoherent, noting similar lawsuits have been rejected in other states and emphasizing Michigan’s economic reliance
energyrenewable-energyfossil-fuelselectric-vehiclesantitrustenergy-affordabilityclean-energyBYD Sales Down 30.7% in January — Can It Revive Sales Growth? - CleanTechnica
In January 2026, BYD experienced a significant decline in sales, with total new energy vehicle (NEV) deliveries dropping 30.7% year-over-year and 50.5% month-over-month. This downturn affected both battery electric vehicles (BEVs) and plug-in hybrids (PHEVs), with BEV deliveries falling 33.6% compared to January 2025 and 56.3% compared to December 2025, marking the second worst monthly performance for BYD BEVs in three years. PHEV sales similarly declined by 28.5% year-over-year and 45.4% month-over-month. The decrease is attributed to intensified competition in the Chinese EV market, the end of NEV purchase tax exemptions, and typical market softness following the Chinese New Year. Despite stronger sales at the end of 2025 compared to 2023, BYD’s performance in late 2025 was weaker than in 2024, raising questions
energyelectric-vehiclesBYDnew-energy-vehiclesbattery-electric-vehiclesplug-in-hybridsautomotive-industryAWS revenue continues to soar as cloud demand remains high
Amazon Web Services (AWS) closed 2025 with its strongest quarterly growth in over three years, reporting a 24% year-over-year revenue increase in Q4, the highest growth rate in 13 quarters. AWS’s annual revenue run rate reached $142 billion, with operating income rising from $10.6 billion in Q4 2024 to $12.5 billion in Q4 2025. CEO Andy Jassy emphasized the significance of achieving this growth on such a large revenue base, highlighting AWS’s expanding market leadership fueled by new contracts with major clients like Salesforce, BlackRock, Perplexity, and the U.S. Air Force. AWS also expanded its data center capacity by adding over a gigawatt of power in the quarter. The company continues to benefit from enterprises migrating infrastructure to the cloud and the growing demand driven by the AI boom, leveraging its comprehensive AI stack to attract customers running large AI workloads. AWS accounted for 16.6% of Amazon’s total $
energycloud-computingdata-centersAI-workloadsAmazon-Web-Servicesinfrastructurepower-consumptionSweden's Journey to Producing 100% Fossil-Free Steel for Volvo & Beyond - CleanTechnica
The article from CleanTechnica highlights Sweden's pioneering efforts to produce 100% fossil-free steel, a critical advancement given steel production's significant contribution to global CO2 emissions—accounting for 7 to 8% worldwide. Steel is a foundational material in clean technologies, used extensively in electric vehicles, wind turbines, and electric motors. Volvo, through its automotive and heavy vehicle divisions, is actively sourcing this fossil-free steel, underscoring the industry's commitment to sustainability. The breakthrough stems from a collaboration among Swedish companies LKAB (mining), SSAB (steel production), and Vattenfall (energy). They developed the HYBRIT (HYdrogen BReakthrough Ironmaking Technology) process, which replaces traditional coal- or natural gas-based iron ore reduction with hydrogen gas produced using fossil-free electricity from Vattenfall’s hydroelectric plants. This hydrogen-based reduction emits only water vapor instead of CO2, significantly lowering the carbon footprint of steel production. The sponge iron produced through this
energyfossil-free-steelgreen-hydrogenHYBRIT-technologyclean-energysteel-productionsustainable-materialsElon Musk is getting serious about orbital data centers
Elon Musk is advancing plans to develop orbital data centers—networks of AI computing infrastructure operating in space—by formally merging SpaceX with his AI company xAI and filing proposals with the FCC. This merger signals a strategic alignment of Musk’s space and AI ventures, suggesting a joint infrastructure project aimed at leveraging the unique advantages of space-based data centers. The FCC has accepted the filing and opened it for public comment, with chairman Brendan Carr showing support, indicating regulatory approval is likely. Musk argues that orbital data centers will be more economically viable by 2028 due to the higher solar power generation in space, which could significantly reduce energy costs compared to terrestrial data centers. He predicts that within five years, more AI computing power will be launched and operated in space annually than the cumulative total on Earth. However, some experts note gaps in this logic, pointing out that power is only one of many costs in running data centers and that maintenance challenges, such as servicing GPUs in orbit, remain unresolved.
energyorbital-data-centersSpaceXsolar-powerAI-computingspace-technologydata-infrastructureThe 2026 Winter Olympics Will Have a Major Impact on the Region’s Snow
The 2026 Winter Olympics are projected to significantly impact the region’s snowpack and glacial ice, with an estimated loss of 5.5 square kilometers of snowpack and 34 million metric tons of glacial ice. A report from the New Weather Institute, in collaboration with Scientists for Global Responsibility and Champions for Earth, highlights that while the Games themselves generate considerable carbon emissions (about 930,000 metric tons), the emissions linked to three main sponsors—Italian energy company Eni, automaker Stellantis, and ITA Airways—could increase the overall footprint substantially. The sponsors’ involvement is estimated to cause an additional 1.3 million metric tons of CO2 equivalent emissions, leading to further loss of 3.2 square kilometers of snowpack and over 20 million metric tons of glacial ice. This suggests that the Olympics may be accelerating the decline of winter sports by contributing to climate change. The report specifically points to Eni as responsible for over half of the emissions from
energycarbon-emissionsrenewable-energyclimate-changesustainabilityWinter-Olympicsenvironmental-impactChina's 20 GW microwave weapon could fry satellites in seconds
Chinese researchers at the Northwest Institute of Nuclear Technology (NINT) in Xian have developed a groundbreaking compact high-power microwave (HPM) weapon system, designated TPG1000Cs, capable of delivering 20 gigawatts of power continuously for up to one minute. This represents a significant advancement over previous systems, which could only sustain firing for about three seconds. The TPG1000Cs is notably compact—just four meters long and weighing five tons—due to its aluminum alloy construction and innovative dual-U-shaped design that efficiently recycles energy. This compactness allows it to be mounted on various platforms, including trucks, aircraft, and potentially satellites, enabling rapid targeting of enemy satellites from the ground or space. The system can emit up to 3,000 high-energy pulses in a single session, far surpassing the pulse capacity of comparable devices like Russia’s Sinus7, which delivers roughly 100 pulses per burst and weighs about 10 tons. The TPG1000Cs has
energyhigh-power-microwavesatellite-weaponmicrowave-weaponenergy-storagealuminum-alloycompact-energy-systemPacific Fusion finds a cheaper way to make its fusion reactor work
Pacific Fusion is advancing a more cost-effective approach to fusion power by refining its pulser-driven inertial confinement fusion (ICF) technology. Unlike traditional ICF methods that use lasers to initiate fuel pellet compression, Pacific Fusion employs massive electrical pulses to generate a magnetic field that rapidly compresses the fuel pellet, heating it sufficiently for fusion. A key challenge has been the need for a preliminary "kickstart" using lasers and magnets to preheat the fuel, which adds complexity, cost, and maintenance burdens. In recent experiments at Sandia National Laboratory, Pacific Fusion demonstrated that subtle design changes to the aluminum casing around the fuel pellet allow a small amount of magnetic field to leak into the fuel before compression, effectively preheating it without lasers. This innovation significantly reduces the system's complexity and cost by potentially eliminating the need for expensive laser preheating, which can exceed $100 million. The adjustments involve varying the thickness of the aluminum casing, a manufacturing process comparable in precision to producing .22 caliber bullet
energyfusion-powerfusion-reactorinertial-confinement-fusionmagnetic-fieldpulser-driven-fusionenergy-innovationTrump’s critical mineral reserve is an admission that the future is electric
The Trump administration announced the creation of an $11.7 billion stockpile of critical minerals, known as Project Vault, aimed at securing essential materials for U.S. manufacturers and preventing supply shortages. This initiative follows recent government investments in rare earth producers and reflects a strategic response to China’s dominance in critical mineral exports, which became evident during trade tensions when China restricted exports of rare earth metals and lithium battery materials. The stockpile is intended to serve a similar role to the Strategic Petroleum Reserve, ensuring U.S. industry resilience amid global supply vulnerabilities. The move signals an acknowledgment that the future economy will increasingly depend on electric technologies such as electric vehicles (EVs) and wind turbines, which require these critical minerals. While the exact composition of the reserve remains unclear, reports suggest it will include minerals like gallium and cobalt, with possible additions such as copper and nickel. The U.S. Export-Import Bank is providing a $10 billion loan to support the initiative, highlighting the administration’s expectation of significant
energycritical-mineralselectric-vehiclesrare-earth-metalsbattery-materialsrenewable-energystrategic-reserveKIA PV5 Pickup Launched In South Korea, Van Spied Testing In US - CleanTechnica
The Kia PV5 is a versatile electric pickup truck recently launched in South Korea, starting at around $30,000, with local incentives potentially reducing the price to just over $20,000. Designed as a multifunctional vehicle akin to the classic Volkswagen Kombi, the PV5 can serve as a cargo van, camper, or people mover. The pickup version, called the PV5 Open Bed, features a 5,040 mm length and a loading box comparable in size to typical US 4-door pickups. It is offered in four trims and two battery options: a 51.5 kWh battery providing a 250 km (155 miles) range, and a 71.2 kWh battery extending the range to 330 km (205 miles), which Kia claims is the longest in its class. The PV5 emphasizes practicality and ease of use, with fold-down sides on the cargo bed allowing access from multiple angles, a feature praised as highly functional compared to traditional US pickups. Its
energyelectric-vehiclesbattery-technologyelectric-truckscommercial-vehiclesKia-PV5electric-pickupNew auto strategy could be a serious solution to Canada’s stalled EV market and auto future - Clean Energy Canada
The article discusses Clean Energy Canada's response to the federal government's new electric vehicle (EV) policy package, which aims to address Canada's lagging EV market and uncertain auto industry future. Joanna Kyriazis, director of policy and strategy at Clean Energy Canada, praises the policy for prioritizing consumer affordability and long-term industry competitiveness. She emphasizes the importance of ensuring Canadians have access to a variety of affordable EV models, a predictable market trajectory to encourage private investment in charging infrastructure, and significant reductions in transportation emissions toward full decarbonization. Kyriazis highlights that Canada’s current tailpipe emission standards have been ineffective, partly due to loopholes allowing larger, more polluting vehicles, resulting in higher fleet emissions today than in 1990. She advocates for stronger, EU-aligned emission standards to achieve ambitious EV sales targets of 75% by 2035 and 90% by 2040, alongside closing regulatory loopholes and adhering to accelerated timelines. The article also notes the importance of reinst
energyelectric-vehiclesclean-energyemissions-standardstransportation-decarbonizationfederal-policyEV-marketBack To Nature: A Post-Hurricane Visit To Jamaica - CleanTechnica
The article "Back To Nature: A Post-Hurricane Visit To Jamaica" in CleanTechnica provides an observational account of Jamaica’s current state following Hurricane Melissa, highlighting the island’s abundant solar potential contrasted with its inadequate infrastructure and economic challenges. Despite Jamaica’s plentiful sunshine, the country struggles to transition from fossil fuels like diesel, coal, and natural gas to renewable energy due to fragile infrastructure and limited financial resources. The hurricane exacerbated these difficulties, damaging roads, buildings, and solar equipment, with visible debris and dilapidation along the northern coast. Solar technology is sparse, with only occasional solar panels and heat pumps seen, and no electric vehicles or charging stations observed during the visit. The article also touches on Jamaica’s colonial legacy, which continues to influence its social and economic conditions. The island’s British colonial past is evident in everyday details such as driving on the left side of the road and the presence of international corporations. The local culture, language, and entrepreneurial spirit remain vibrant despite these challenges.
energyrenewable-energysolar-powersolar-panelsclean-energyinfrastructureJamaicaGerman firm to build two-stage hypersonic plane with horizontal takeoff and landing
German company Polaris Spaceplanes has been awarded a contract by Germany’s Federal Office of Bundeswehr Equipment, Information Technology, and In-Service Support (BAAINBw) to develop and flight test a two-stage reusable hypersonic test vehicle under the Hypersonic Test and Experimentation Vehicle (HYTEV) program. Scheduled to be flight-ready by the end of 2027, the vehicle is designed with a main stage powered by two turbofan engines and an aerospike rocket engine, and an upper rocket-powered stage that accelerates the craft to hypersonic speeds before separation. The spaceplane, roughly the size and take-off mass of a fighter jet, aims to support military and scientific research and could also function as a reconnaissance platform in low Earth orbit, offering real-time intelligence while being resistant to anti-satellite weapons. Polaris Spaceplanes has been developing key propulsion technologies leading up to this contract, including the successful in-flight ignition test of its AS-1 linear aerospike rocket engine
energyaerospacehypersonic-technologyrocket-enginesspaceplanepropulsion-systemsmilitary-technologyUS firm pitches radical triple-body fighter concept for Navy program
Stavatti Aerospace, a relatively unknown company, has entered the US Navy’s F/A-XX Next Generation Air Dominance competition with its radical SM-39 Razor concept. This program aims to develop a sixth-generation carrier-based fighter to replace the F/A-18E/F Super Hornet and is distinct from the Air Force’s next-gen fighter by emphasizing multirole capabilities, carrier suitability, electronic warfare, and command-and-control functions for coordinating uncrewed combat aircraft. Traditionally dominated by defense giants Boeing and Northrop Grumman, Stavatti’s entry stands out due to its unconventional triple-fuselage design integrated into a blended-wing body, promising exceptional performance metrics including speeds up to Mach 4 and supercruise at Mach 2.5, along with superior range, payload, and climb rates. However, the SM-39 Razor’s ambitious specifications have sparked significant skepticism within the aerospace community. Experts question the feasibility of achieving Mach 4 speeds with turbofan engines on a carrier
robotenergymaterialsaerospace-technologystealth-aircraftadaptive-cycle-enginemilitary-technologyNew microchannel reactor turns organic waste gas into jet fuel
Korean researchers from the Korea Research Institute of Chemical Technology (KRICT), in partnership with EN2CORE Technology, have developed a novel method to produce sustainable aviation fuel (SAF) by converting landfill gas derived from food waste and manure into liquid jet fuel. Their pilot facility, located at a landfill site in Daegu, demonstrated the production of 100 kilograms (220 pounds) of SAF per day with over 75% liquid-fuel selectivity. This process involves collecting raw landfill gas, removing sulfur compounds and excess carbon dioxide, and then using a proprietary plasma reforming reactor to produce synthesis gas (syngas), a mixture of carbon monoxide and hydrogen tailored for fuel synthesis. The syngas is then converted into liquid aviation fuel via the Fischer–Tropsch process using a specialized zeolite- and cobalt-based catalyst system that enhances selectivity for desirable hydrocarbon chains while minimizing solid byproducts like wax. A key innovation is the microchannel reactor design, which enables rapid heat dissipation
energysustainable-aviation-fuelmicrochannel-reactorwaste-to-fuel-technologychemical-catalysissyngas-productiondecarbonizationWorld’s first hydrogen heating system warms buildings emissions-free
German startup HYTING has developed and installed the world’s first hydrogen-based heating system, marking a significant step toward carbon-free heating solutions. The 10-kilowatt catalytic hydrogen air-heating system, installed in Offenbach, heats a 1,000-cubic-meter space using hydrogen supplied locally. Unlike traditional combustion, HYTING’s patent-pending catalytic process burns hydrogen with oxygen without a flame, producing only heat and water vapor, and eliminating carbon, nitrogen, and particulate emissions. The system is designed with safety in mind, maintaining hydrogen concentrations below flammable levels. When combined with a heat pump, the hybrid system efficiently manages heating demand by using hydrogen during peak or cold periods while the heat pump handles the base load, offering both environmental and economic benefits. Prior to installation, HYTING validated its technology with a 2,500-hour durability test simulating 10 years of operation, passing without failures or safety issues, and obtained Gas Appliance Regulation certification. The first deployment was done in partnership with
energyhydrogen-heatingcarbon-free-technologyhybrid-heating-systemheat-pumpdecarbonizationclean-energyRussia's carbon composite nuclear reactor materials beat 2912°F test
Engineers at Rosatom’s machine-building division have successfully manufactured full-sized structural components for a high-temperature gas-cooled reactor (HTGR) using carbon-carbon composite materials. These components, including a 1650 mm core support element and a flexible control system, demonstrated physical stability at temperatures up to 2912°F (1600°C) during extreme testing. The carbon composite materials offer significant advantages over traditional metallic alloys, such as enhanced reliability, reduced mass and size of reactor plants, and high resistance to radiation and aggressive environments. This development supports the production of a 200 MW thermal power reactor within an Atomic Energy-Technological Station (AETS) that uses helium coolant to achieve outlet temperatures of 1562°F (850°C) and generate superheated steam at 1382°F (750°C). The use of carbon-carbon composites enables the reactor to meet the high-temperature requirements necessary for industrial chemical processes, including hydrogen and ammonia production. The manufacturing process was refined using existing industrial equipment, demonstrating the
energynuclear-reactorcarbon-composite-materialshigh-temperature-gas-cooled-reactorRosatomhydrogen-productionadvanced-materialsPerovskite solar cells boosted to 26% power with over 1,000 hour life
Researchers from China, Macau, and France have developed a chemical strategy that significantly enhances the durability and efficiency of perovskite solar cells, a promising low-cost photovoltaic technology previously limited by poor stability. By incorporating a hindered amine light stabilizer—commonly used in plastics to prevent sunlight damage—directly into inverted perovskite solar cells, the team neutralized harmful superoxide radicals generated under illumination. This radical-scavenging process is regenerative, continuously protecting the solar material from internal chemical degradation that typically damages the crystal structure and reduces device lifespan. Beyond chemical protection, the stabilizer also passivates defects at grain boundaries and surfaces within the perovskite films, reducing trap states that cause charge recombination and energy loss. This dual action results in larger crystal grains, smoother films, lower defect density, longer carrier lifetimes, and improved energy alignment, collectively boosting power conversion efficiency to a certified 26.74%. Notably, the unencapsulated cells maintained over
energyperovskite-solar-cellsphotovoltaic-technologysolar-energymaterials-sciencechemical-stabilizationrenewable-energyUS firm begins world's first field test of engineered mineral hydrogen
Vema Hydrogen, a Houston-based startup, has initiated the world’s first field test of its engineered mineral hydrogen (EMH) technology by drilling pilot wells in Quebec. EMH aims to produce clean hydrogen at a cost below $1 per kilogram by accelerating natural geochemical reactions in specific rock formations like ophiolites and Banded Iron Formations (BIFs). This approach leverages naturally occurring subsurface hydrogen generation, which is typically slow, by using catalysts to control and speed up the process. The targeted rock formations are abundant, potentially providing hydrogen supplies for thousands of years, and are often located near existing industrial centers, facilitating easier adoption. The pilot wells in Quebec represent a critical step from laboratory experiments to real-world application, allowing Vema to analyze subsurface fluid movement and hydrogen production to refine their models and plan commercialization. The company has also secured an agreement to supply clean hydrogen to California data centers, where large ophiolite formations exist, aiming to produce hydrogen at about 50
energyclean-hydrogenhydrogen-productionrenewable-energyengineered-mineral-hydrogencarbon-capturesustainable-energyWorld record-holding battery-only passenger train enters service in UK
Great Western Railway (GWR) in the UK has launched the nation's first battery-only passenger train, the GWR Class 230, operating on the five-mile Greenford branch line between West Ealing and Greenford. This battery-electric train replaces the previous diesel service and follows a 22-month trial of rapid charging technology. During testing, the train set a world record by traveling 200.5 miles on a single charge, surpassing the previous record of 139 miles held by Stadler Deutschland. The train recharges in just 3.5 minutes at West Ealing station using a 2,000 kW charger connected to a short section of rail that activates only when the train is stopped overhead. The trial, detailed in a July 2025 white paper by GWR, demonstrated that fast charging can enable battery trains to operate efficiently on routes without full overhead electrification. GWR’s engineering director highlighted the technology as a reliable alternative to traditional electrification, supporting the railway’s dec
energybattery-technologyelectric-trainsfast-chargingdecarbonizationrail-transportsustainable-transportationEuropean Investment Bank Gives Green Light to €3bn for Clean Transition - CleanTechnica
The European Investment Bank (EIB) board has approved a €3 billion Frontloading Facility to provide early revenues to EU countries, enabling them to prepare citizens for higher fuel costs associated with the upcoming EU carbon price on heating and fuel, known as ETS2. This facility aims to support governments in managing the social and economic impacts of ETS2, which is set to be introduced in 2028 after a one-year delay. An additional €3 billion could be made available next year. The funding is intended to help transition households away from imported fossil fuels by investing in greener alternatives and shielding vulnerable populations from increased costs. The delay of ETS2 reduces immediate revenues and thus limits resources for the Social Climate Fund (SCF), which supports vulnerable groups. The Frontloading Facility, alongside a forthcoming review of the Auctioning Regulation, is critical to ensuring early investment in green solutions such as electric vehicle social leasing and improved public transport. However, the facility is only accessible to member states that have incorporated ETS2 into
energyclean-energyEuropean-Investment-BankETS2green-transitioncarbon-pricingrenewable-energy-investmentsEurope Is Finally Admitting Electricity Is Overtaxed - CleanTechnica
The article from CleanTechnica highlights a significant shift in European energy policy regarding electricity taxation. A leaked European Commission recommendation acknowledges that electricity in Europe has long been overtaxed and burdened with levies as if it were a polluting end product, despite its growing role as a clean energy carrier essential for economic competitiveness, energy security, and decarbonization. The recommendation urges EU Member States to reduce VAT and excise duties on electricity, remove non-energy levies from electricity bills by funding them through general budgets, and ensure electricity is taxed less than fossil fuels. This marks a meaningful change in framing electricity not just as a consumer good subject to taxation, but as critical infrastructure underpinning Europe's economic future. A key concept discussed is the "spark gap," the ratio between retail electricity prices and retail gas prices, which currently ranges from about 2.5 to 3.5 across Europe. This gap discourages electrification because electricity prices include network charges, policy levies, and VAT that
energyelectricity-taxationEuropean-energy-policyclean-energyelectrificationenergy-affordabilitydecarbonisationHow Climate Economics Got the Risks Wrong - CleanTechnica
The article from CleanTechnica discusses a recent study by researchers from the University of Exeter and Carbon Tracker that challenges longstanding economic models used to assess climate change risks. These models, notably William Nordhaus’s Dynamic Integrated model of Climate and the Economy (DICE), have been influential in shaping climate policy by framing climate change as an intertemporal optimization problem. DICE links emissions, temperature increases, economic output, and policy decisions, suggesting that economic damages from warming are gradual, manageable, and can be offset by growth and adaptation. However, the new study argues that these models underestimate risks by smoothing impacts over time, relying on average temperature changes, and ignoring critical factors like shocks, tipping points, and cascading failures. Key critiques focus on the damage functions and discounting methods central to DICE. The damage functions, which relate temperature rise to GDP loss, are not based on historical data from comparable conditions but rather on limited studies and expert judgment, making them highly sensitive to assumptions. Small changes in these
energyclimate-changeeconomic-modelscarbon-emissionsclimate-risksustainabilityenvironmental-policyLatin America EV Sales Report: Over 100,000 Units Sold in Q4! - CleanTechnica
The Latin America EV market saw a significant surge in Q4, with over 100,000 electric vehicle units sold, marking a 24% increase over previous records from late 2024 and mid-2025. This growth was driven predominantly by battery electric vehicles (BEVs), which rose by 47%, while plug-in hybrid electric vehicles (PHEVs) experienced only a modest 5% increase. Despite a notable decline in PHEV sales in Mexico, the region overall saw EV sales surpass 350,000 units in 2025, with BEVs making up 54% and PHEVs 46%. Market share for EVs increased to 5.6% for the year, up from 4% in 2024, with Q4 alone reaching 6.6%. Sales were heavily concentrated in Brazil and Mexico, which together accounted for 80% of regional sales, though these markets are more PHEV-heavy. BEVs accounted for about 66
energyelectric-vehiclesLatin-AmericaBEVPHEVmarket-growthsustainable-transportationLNG Explosion in Louisiana - CleanTechnica
An explosion occurred along the Delfin LNG pipeline in Cameron Parish, Louisiana, near Holly Beach and Johnson Bayou, injuring one person and highlighting the risks associated with fossil fuel infrastructure. Environmental groups, including the Sierra Club and For a Better Bayou, condemned the incident, emphasizing the dangers such projects pose to community safety and health. They criticized the Trump administration for fast-tracking the Delfin LNG project without adequate environmental risk review, arguing that such projects increase energy costs and endanger local populations. Community organizers called for a thorough investigation into the explosion to assess safety protocols and emergency preparedness, urging state and local authorities to ensure transparency and prevent future incidents. The groups stressed the importance of strong oversight and a renewed commitment to coastal preservation to protect residents and the environment. The Sierra Club, a prominent environmental organization, continues to advocate for clean energy and community health through activism and education.
energyLNGfossil-fuelspipeline-safetyenvironmental-impactenergy-infrastructureexplosion-riskNHTSA Urged to Maintain Fuel Economy Standards - CleanTechnica
A coalition of health, consumer, and environmental groups has urged the National Highway Traffic Safety Administration (NHTSA) to withdraw its proposal to weaken Corporate Average Fuel Economy (CAFE) standards for cars, SUVs, and pickup trucks. The proposed rule would reduce the fleetwide average fuel economy target to 34.5 miles per gallon by 2031, which is below current fleet performance. Critics argue this rollback would increase lifetime fuel costs for drivers by approximately $1,400, outweighing any upfront vehicle savings, while making vehicles less affordable and less efficient overall. The groups contend that the weakened standards would harm American families by raising fuel expenses and worsening air pollution, thereby negatively impacting public health. Representatives from organizations including the Sierra Club, Natural Resources Defense Council (NRDC), Center for Biological Diversity, Public Citizen Litigation Group, and Environmental Defense Fund emphasize that the proposal prioritizes oil industry profits over consumer savings and environmental progress. They warn that the rollback reverses decades of advancements toward cleaner, more
energyfuel-economyvehicle-emissionsenvironmental-policyair-pollutiontransportation-energy-efficiencyclean-vehiclesAustralia EV Sales — January 2026 Update, Spotlight on the BYD Atto 1 - CleanTechnica
In January 2026, electric vehicle (EV) sales in Australia showed significant growth, with over 12,000 new EV buyers contributing to a 16% penetration rate among light vehicle sales. Out of 87,092 vehicles sold, 7,409 were battery electric vehicles (BEVs) and 5,161 were plug-in hybrids (PHEVs). Although this represented a slight decline from the previous month, it marked a substantial year-on-year increase from just 4% BEV sales in January 2025. The surge is largely attributed to the introduction of budget-friendly models like the BYD Atto 1 and Atto 2, which have quickly climbed the sales charts, with BYD dominating six of the top ten best-selling BEV models. Other notable brands in the top sellers include Tesla, Kia, and Geely, but Chinese manufacturers clearly lead the market. PHEV sales also showed strong growth, particularly from Chinese brands such as BYD and G
energyelectric-vehiclesbattery-electric-vehiclesplug-in-hybridsBYDEV-salesclean-energyWhich Automakers Are Electrifying Fastest In USA? - CleanTechnica
The article from CleanTechnica analyzes the pace at which various automakers in the United States are transitioning to electric vehicles (EVs) based on 2025 sales data. Among legacy automakers, Cadillac leads the electrification effort with over 28% of its sales being electric vehicles, followed by Audi (18.2%) and Porsche (18%). Premium brands such as BMW, Acura, and Volvo also show notable EV sales shares, while mass-market, lower-cost brands lag significantly behind. Japanese automakers, in particular, have been slow to embrace EV sales in the US market. Fiat is noted as an exception, having ceased sales of non-electric vehicles, though its overall sales volume remains very low. When grouped by auto alliances, Volkswagen Group tops the list with 12.7% of its sales being electric, largely due to the strong EV sales of its premium brands Audi and Porsche. BMW Group follows with 10.7%, while GM and Hyundai-Kia lead among mass-market groups
energyelectric-vehiclesautomakersEV-salesUSAclean-technologyautomotive-industryIndonesia Gets Its First 480 kW Charging Station — Thanks To XPENG - CleanTechnica
Indonesia has installed its first 480 kW ultra-fast electric vehicle (EV) charging station, marking a significant advancement in the country’s EV infrastructure. This development was made possible through a partnership between Chinese EV manufacturer XPENG and Indonesia’s largest charge point operator, Voltron. The new charging station, located at Living World Alam Sutera, supports XPENG’s G6 Pro model, which features advanced 800V, 5C battery technology capable of charging at up to 451 kW. This allows the vehicle to recharge from 10% to 80% in just 12 minutes, a charging speed unmatched by other EVs currently available in Indonesia, including Tesla models. The collaboration between XPENG and Voltron was formalized through a memorandum of understanding (MoU) to expand high-performance charging infrastructure across Indonesia. They plan to jointly identify premium locations for new ultra-fast charging sites, enhancing accessibility and supporting XPENG’s growth in the region. Additionally, Voltron’s network of over
energyelectric-vehiclesEV-chargingfast-charging-stationsXPENGIndonesiabattery-technologyWaste heat to be turned into electricity with thermoelectric material
Researchers from Japan have developed a new system using the mixed-semimetal molybdenum disilicide (MoSi2) to convert waste heat into electricity through thermoelectric conversion devices. These devices are promising for sustainable heat-to-energy conversion, particularly by recovering energy lost as waste heat—estimated at 20-50% of input energy in industries—thereby improving overall energy efficiency. MoSi2 was identified as an ideal transverse thermoelectric (TTE) material exhibiting axis-dependent conduction polarity (ADCP) without requiring a magnetic field, a property confirmed by both experimental measurements and first-principles calculations. The study, published in Communications Materials, highlights that MoSi2’s unique electronic band structure and mixed-dimensional Fermi surfaces enable its ADCP behavior in Seebeck and Hall coefficients, crucial for TTE generation. Unlike conventional thermoelectric devices that rely on longitudinal thermoelectric effects and require alternating layers of p- and n-type semiconductors—leading to increased electrical
energythermoelectric-materialswaste-heat-recoveryMoSi2sustainable-energythermoelectric-devicesenergy-efficiencyNew nuclear event detector cuts radiation response time by 50%
Micross has introduced the Standard-Performance Nuclear Event Detector (NED), a new radiation detection device designed to protect critical electronics in nuclear events, particularly for defense and aerospace platforms such as aircraft, military satellites, and unmanned systems. This detector offers significant improvements over legacy systems by delivering more than twice the radiation dose-rate sensitivity and reducing response times by over 50%, with detection speeds reaching 3 to 5 nanoseconds under high radiation conditions. Key to these advancements is a redesigned architecture that integrates differential drivers and receivers on-chip, eliminating external circuitry, reducing system latency, size, weight, power consumption, and shielding requirements. Manufactured in the U.S. with a custom ASIC produced by Jazz Semiconductor Trusted Foundry, the NED is a commercial off-the-shelf solution enabling faster integration without lengthy development cycles. It supports extreme operating conditions, including total radiation doses up to one million rads, dose rates in the billions of rads per second, high neutron exposure, and a wide temperature
energyradiation-detectionnuclear-event-detectordefense-technologysemiconductorASICaerospace-systemsMundi Ventures closes on €750M for Kembara, its largest deep tech and climate fund
Mundi Ventures has completed a €750 million first close for its Kembara Fund I, a deep tech and climate-focused growth fund based in Europe, with potential to raise up to €1.25 billion. The fund targets Series B and C rounds, planning to invest initial checks of €15 million to €40 million across about 20 companies, with follow-on investments possibly reaching €100 million per company. This scale is notable given the capital-intensive nature of climate and deep tech startups, which often struggle to secure sufficient growth capital in Europe. Kembara is managed by a specialized team within Mundi Ventures, including co-founders Yann de Vries and Javier Santiso, alongside partners with strong venture capital backgrounds such as Robert Trezona, Pierre Festal, and advisor Siraj Khaliq. The fund aims to address a critical "scale-up problem" in European deep tech and climate startups, a gap highlighted by de Vries’ experience with Lilium, a company that went
energyclimate-techdeep-techventure-capitalstartup-fundingscale-upEuropean-innovationOPINION: A Month After e-Trike Ban In Manila: Has It Made Manila's Streets Safer? - CleanTechnica
One month after the Philippines’ Land Transportation Office (LTO) enforced a ban on light electric vehicles (e-bikes and e-trikes) on major Metro Manila roads, officials claim it has improved traffic order by removing slower vehicles from fast-moving corridors. The rationale is that speed mismatch between slower electric vehicles (operating at 25-40 km/h) and faster cars increases rear-end collision risks, so banning these vehicles should reduce accidents and improve traffic flow. Early enforcement data shows a decline in apprehensions, which the LTO interprets as better compliance and safer roads. However, transport research challenges the assumption that speed variance alone determines safety, noting factors like vehicle mass, road design, and physical separation play crucial roles. Moreover, the LTO has not released comparative crash or injury data to substantiate claims that the ban has reduced accidents or improved overall safety. In practice, the ban appears to have displaced rather than reduced mobility demand. With over 1.5 million e-trikes and
energyelectric-vehiclesclean-mobilitytransportation-policytraffic-managementsafety-enforcementurban-transportScientists plan 50-mile wall to block warm seas melting the ‘Doomsday Glacier’
Scientists and engineers are proposing a bold intervention to slow the rapid melting of Thwaites Glacier in West Antarctica, often called the "Doomsday Glacier" due to its potential to raise global sea levels by about 65 centimeters if it collapses completely. The Seabed Anchored Curtain Project aims to install a flexible, seabed-anchored underwater barrier roughly 50 miles long and 152 meters tall in front of the glacier. This curtain would block warm ocean currents from reaching and melting the glacier’s underside, thereby slowing ice loss. The project involves a multi-institutional collaboration and plans a three-year research phase focused on material selection, mooring design, and prototype testing, with an initial fundraising goal of $10 million. While the curtain would not halt climate change, it is intended to buy time for global emissions reductions to take effect. Concurrently, UK and South Korean scientists have begun drilling nearly 1,000 meters beneath Thwaites Glacier’s main ice shelf to deploy
energymaterialsclimate-changeocean-engineeringenvironmental-technologyice-shelf-protectionseabed-barrierTesla Had 46% of US EV Market in 2025 (Down from 49% in 2024) — GM 13%, Ford 7% - CleanTechnica
In 2025, Tesla maintained a dominant position in the US electric vehicle (EV) market but saw its market share decline from 49% in 2024 to 46%, with sales dropping from approximately 634,000 to 589,000 units. Despite this decrease, Tesla remained the leading EV brand. Chevrolet, the second-ranked brand, experienced significant growth, increasing its sales from about 68,000 in 2024 to 92,000 in 2025 and raising its market share from 5.2% to 7.2%. Ford, in third place, saw a decline in both sales and market share, dropping from 98,000 to 84,000 units and from 7.5% to 6.6%, respectively. Hyundai and Cadillac also showed positive trends, with Hyundai’s market share rising slightly from 4.7% to 5.1%, and Cadillac nearly doubling its market share from 2.2% to 3
energyelectric-vehiclesEV-marketTeslaGMFordautomotive-industryThe Hidden Cost of Europe’s Hydrogen Bus Experiment - CleanTechnica
The article examines the economic and operational realities of hydrogen buses in Europe, focusing on Poland, the continent’s largest bus manufacturing hub and home to Solaris, a leading zero-emission bus supplier. Poland’s large-scale deployment of hydrogen buses in real urban settings with professional operators provides a critical test case. The experience in Poznań, where hydrogen and battery electric buses operate side-by-side under identical conditions, reveals that hydrogen buses face higher fuel costs, supply quality issues, and operational interruptions, resulting in lower availability compared to battery electric buses. This comparison is based on internal data rather than advocacy, highlighting the practical challenges of hydrogen technology in public transit. A detailed cost-benefit analysis from the Upper Silesian Zagłębie Metropolis further underscores these findings. Over a 10-year horizon, hydrogen buses have significantly higher purchase and energy costs (€750,000 and €0.74/km respectively) compared to battery electric buses (€610,000 and €0.21/km) and diesel (€235,
energyhydrogen-fuel-cellselectric-buseszero-emission-transportationpublic-transitrenewable-energyclean-technologyLunar Energy raises $232M to deploy home batteries that prop up the grid
Lunar Energy, a six-year-old startup specializing in home battery packs for homeowners in California, Georgia, and Washington, has raised a total of $232 million through two recent funding rounds: a previously undisclosed $130 million Series C led by Activate Capital and a $102 million Series D led by B Capital and Prelude Ventures. The company aims to scale its manufacturing capacity to 20,000 units by the end of 2024 and reach 100,000 units by 2028, contributing to the growing market for stationary energy storage in the U.S. Lunar’s batteries, available in 15 kWh and 30 kWh modules, support grid resiliency by delivering power when needed and are managed through virtual power plant (VPP) software that also controls EV chargers and appliances to balance supply and demand. The rise of stationary batteries like Lunar’s reflects a broader shift in the energy sector, driven by increasing grid strain from electrification and data center growth. These modular batteries offer a versatile
energybattery-storagegrid-resiliencevirtual-power-plantrenewable-energyhome-batteriesenergy-investmentGiant US particle detector fridge to hold 50,000 tons of liquid argon
The Deep Underground Neutrino Experiment (DUNE), led by the US Department of Energy’s Fermilab, is set to build the world’s largest cryogenic particle detector a mile underground at the Sanford Underground Research Facility in South Dakota. The DUNE far detector will consist of multiple enormous modules filled with liquid argon, with the first two modules each requiring about five Olympic swimming pools’ worth of liquid argon—approximately 17,000 metric tons per pool. Overall, the detector will hold over 50,000 tons of liquid argon, maintained at minus 303 degrees Fahrenheit using advanced cryostats designed to operate for around 20 years. The project involves significant logistical challenges, including worldwide coordination and safety considerations, with the first two modules expected to be operational by 2032. Once operational, the DUNE detector will use ultrasensitive components immersed in purified liquid argon to capture detailed 3D images of neutrino interactions. This will enable precise measurements of neutrino oscillations
energycryogenicsparticle-detectorliquid-argonneutrino-researchcryostatsFermilabThe US Solar Industry Is Quiet-Quitting Federal Energy Policy
The article discusses how the US solar industry is subtly distancing itself from federal energy policy challenges by focusing on domestic and global market expansion, a phenomenon described as "quiet quitting." While some companies, like First Solar, actively contest restrictive White House policies in court and public forums, much of the industry's significant progress is happening behind the scenes. A notable example is Voltage Energy Group, a lesser-known but influential player specializing in utility-scale solar projects. Voltage recently announced plans to establish a large manufacturing facility and global headquarters in Roxboro, North Carolina, signaling a commitment to growing from its American roots despite political headwinds. Voltage Energy Group exemplifies the industry's strategic pivot by leveraging advanced visualization technologies and customized solutions to streamline project development and performance. The company's expansion in North Carolina is particularly notable given the state's mixed political landscape, where local officials—regardless of party—welcome the economic benefits of new solar industry jobs. This local support contrasts with federal-level tensions, highlighting how solar companies are navigating complex political environments by building
energysolar-energyrenewable-energysolar-industryenergy-policyclean-energyenergy-manufacturing105 Fast EV Charging Stations Coming To Boston Public Schools - CleanTechnica
Orion Energy Systems has secured a $4 million contract to install 105 fast DC electric vehicle (EV) charging stations at the Freeport Bus Yard for Boston Public Schools (BPS). These chargers are intended to support the district’s ambitious plan to electrify its entire fleet of 750 school buses, making it the largest school bus electrification program in the Northeastern United States. The installation features an innovative above-ground mounting system with Jersey barriers, continuing Orion/Voltrek’s ongoing partnership with BPS. The shift to electric school buses offers significant health and environmental benefits. Unlike diesel buses, electric buses produce zero tailpipe emissions, reducing exposure to harmful pollutants such as particulate matter (PM) and nitrogen oxides (NOx), which are linked to respiratory problems, cancer, and brain development issues, especially in children. Additional advantages include lower greenhouse gas emissions, reduced maintenance costs, quieter operation, and potential fuel savings. The transition also aligns with broader efforts to reduce fossil fuel dependence, which
energyelectric-vehiclesEV-charging-stationselectric-busesclean-energysustainable-transportationzero-emissionsUS lab uses lasers, heat to map neptunium for deep-space nuclear fuel
Researchers at Oak Ridge National Laboratory (ORNL) are advancing the study of neptunium, a rare radioactive element crucial for producing plutonium-238 (Pu-238), which powers Radioisotope Thermoelectric Generators (RTGs) used in deep-space missions like NASA’s Perseverance Rover. Since conventional solar panels and batteries are inadequate for the harsh conditions of deep space, Pu-238-based RTGs remain the only reliable power source for long-range spacecraft instruments. To meet increasing demand for these nuclear fuels, the ORNL team is focusing on understanding the chemical and structural properties of neptunium through thermal decomposition, heating the element between 150°C and 600°C to identify its intermediate transformation phases. The researchers combined Raman spectroscopy—a laser-based technique that maps molecular vibrations—with computational modeling to create the first-ever “structural fingerprint” of a key neptunium oxide. This approach allowed them to observe how the material’s bonding environment changes under heat in real time,
energynuclear-fueldeep-space-explorationplutonium-238radioisotope-thermoelectric-generatorsmaterials-scienceneptuniumUS firm’s nuclear reactor to extract critical minerals, desaline oilfield wastewater
Natura Resources and NGL Energy have formed a strategic partnership to integrate Natura’s advanced 100-megawatt molten-salt nuclear reactor (MSR-100) with NGL’s large-scale water treatment operations in Texas’s Permian Basin. The collaboration aims to convert the vast volumes of "produced water"—a salty, oily byproduct of oil and gas extraction—into valuable resources by desalinating it for use in data centers, agriculture, and industry. This approach addresses the environmental and regulatory challenges of traditional produced water disposal methods, while generating clean electricity and utilizing waste heat from the nuclear reactors to power local grids and energy-intensive sectors like AI data centers. Natura’s Generation IV molten salt reactor technology operates at atmospheric pressure and high temperatures (over 600°C), enabling efficient thermal desalination and enhanced safety compared to conventional nuclear plants. The partnership also plans to extract critical minerals from the treated brine, potentially establishing a new domestic supply chain for battery materials. Natura is progressing toward
energynuclear-energymolten-salt-reactorwater-desalinationcritical-mineralsbattery-materialsclean-powerCATL unveils battery with 12-minute charging and 1.5 million mile life
CATL, the world’s largest battery manufacturer, has introduced a new 5C fast-charging electric vehicle battery platform capable of fully charging in about 12 minutes and lasting up to 1.5 million miles. This breakthrough addresses major barriers to EV adoption by combining gasoline-like refueling speed with exceptional durability. The battery retains at least 80% of its original capacity after 3,000 full charge-discharge cycles at moderate temperatures (68°F), which is roughly six times better than current industry averages. Even under extreme heat conditions (140°F), it maintains 80% capacity after 1,400 cycles, equating to about half a million miles, making it viable for hot climates where battery degradation has been a concern. The battery’s longevity and fast-charging capability stem from several material innovations: a protective cathode coating that prevents metal ion loss, an electrolyte additive that seals microscopic cracks, and a temperature-responsive separator coating that stabilizes ion movement and reduces the risk of thermal runaway
energybattery-technologyelectric-vehiclesfast-chargingCATLbattery-lifematerials-innovation2026 Nissan LEAF Named a 2026 Car and Driver Editors’ Choice Winner - CleanTechnica
The all-new 2026 Nissan LEAF has been named a Car and Driver Editors’ Choice winner, recognized for its range, performance, practicality, and value in the electric vehicle (EV) market. This accolade is part of Car and Driver’s annual list, which evaluates vehicles across 47 segments based on rigorous testing, editorial assessments, and comparisons with competitors. To earn this distinction, vehicles must score at least 9 out of 10 stars from reviewers. The 2026 LEAF, now in its third generation, continues to build on its reputation for reliable, affordable, and attractive EV ownership, boasting an EPA-estimated driving range of up to 303 miles per charge and a starting price of $32,000. The redesigned LEAF features a sleek, SUV-like profile and incorporates advanced technologies such as a built-in NACS port with Plug & Charge functionality, enabling access to over 27,500 Tesla Superchargers for convenient charging. Additional highlights include a segment-first dim
energyelectric-vehiclesNissan-LEAFEV-chargingbattery-technologysustainable-transportationautomotive-technologyExclusive: Positron raises $230M Series B to take on Nvidia’s AI chips
Positron, a semiconductor startup based in Reno, has raised $230 million in a Series B funding round led by investors including the Qatar Investment Authority (QIA), the country’s sovereign wealth fund. This funding comes amid growing efforts by hyperscalers and AI companies, such as OpenAI, to reduce dependence on Nvidia’s AI chips. Qatar’s investment aligns with its broader strategy to develop sovereign AI infrastructure and position itself as a leading AI services hub in the Middle East, supported by a $20 billion AI infrastructure initiative announced in September. Positron, founded three years ago, has now raised over $300 million in total capital, including a previous $75 million round last year. The company’s first-generation chip, Atlas, manufactured in Arizona, reportedly matches the performance of Nvidia’s H100 GPUs while consuming less than a third of the power. Positron focuses on AI inference hardware—used to run AI models in real-world applications—rather than training large language models, addressing the
energysemiconductorAI-chipsAI-infrastructurecomputing-powerinference-hardwaretechnology-startupsMEMO: Sierra Club & Partners Rally to Make Polluters Pay for Climate Disasters - CleanTechnica
The Sierra Club, alongside partner organizations nationwide, conducted a “Make Polluters Pay” Week of Action aimed at holding major oil and gas companies accountable for their role in the climate crisis. Activities included rallies, press conferences, petition deliveries, legislative meetings, and social media campaigns. The initiative highlights how communities disproportionately bear the financial and health burdens of pollution and climate disasters, while fossil fuel companies profit from high energy prices and government subsidies. Sierra Club’s Director of Beyond Fossil Fuels Policy, Mahyar Sorour, emphasized the need for these corporations to pay their fair share for the damage caused. The campaign underscores that fossil fuel companies have long been aware of their contribution to climate change but have actively misled the public and avoided financial responsibility. Meanwhile, taxpayers cover the escalating costs of climate-related disasters and rising energy prices, exacerbated by policies that hinder clean energy development. In response, several states, including Vermont and New York, have passed Climate Superfund laws requiring fossil fuel companies to fund recovery efforts
energyclimate-changefossil-fuelsclean-energyenvironmental-policypollution-accountabilityclimate-legislationZurich transit operator prepares fresh €150 million electric bus tender after supplier setbacks - CleanTechnica
Zurich’s public transport authority, Verkehrsbetriebe Zürich (VBZ), has launched a major new tender valued at approximately €150 million for battery-electric buses to replace aging diesel vehicles in its urban fleet. This fresh procurement, officially announced in January 2026 with bids due by March 17, marks a departure from relying on existing framework agreements with Swiss manufacturer HESS and MAN Truck & Bus. The decision to reset the process follows ongoing operational issues with current electric buses, including delays in deliveries and recurring faults in heating, ventilation, and climate control systems, which VBZ concluded had not been adequately resolved despite efforts by the suppliers. Both HESS and MAN have acknowledged the challenges inherent in transitioning to advanced electric bus technology, emphasizing ongoing optimization and long-term strategic commitments. By opening the tender to a broader field of competitors, VBZ is expected to attract global manufacturers, notably Chinese companies such as BYD and Yutong, which have been expanding their presence in European markets with buses emphasizing reliability
energyelectric-busesbattery-electric-vehiclespublic-transportationZurich-transitMAN-Truck-&-BusHess-AGThere Will Be More EVs (and NEVs) at the Chicago Auto Show 2026 - CleanTechnica
The Chicago Auto Show 2026, scheduled for February 7–16 at McCormick Place, will emphasize consumer-ready vehicles with a strong focus on electrification, reflecting a shift in the US auto market toward practical EV adoption rather than concept debuts. The show will feature a mix of pure electric vehicles (EVs), hybrids, and internal combustion engine models, with crossovers, SUVs, and pickups dominating to align with Midwest buyer preferences. Notably, many international brands from Japan, Korea, Germany, and Vietnam will present both EVs and hybrids, while American automakers, except for Chevrolet, are adopting more cautious EV strategies. The event continues to serve as a practical checkpoint for what automakers are prepared to sell and support in the near term. A highlight of the show is the expanded “Chicago Drives Electric” indoor test track, which offers visitors hands-on experiences with EVs and signals manufacturers’ confidence in their products. Confirmed participants for outdoor test drives include Alfa Romeo, Dodge
energyelectric-vehiclesEVsautomotive-technologyelectric-SUVsbattery-electric-vehiclesclean-energyToyota Uses bZ Time Attack Concept to Probe the Limits of EV Racing - CleanTechnica
At the 2025 SEMA Show, Toyota unveiled the bZ Time Attack Concept, a battery-electric vehicle (BEV) prototype designed to explore the limits of electric motorsport performance rather than serve as a styling exercise or competition entry. Built on the forthcoming 2026 all-wheel-drive bZ platform, the concept delivers over 400 horsepower through recalibrated dual motors, emphasizing short-duration power output for racing conditions like time attack and hill climbs. The vehicle features significant modifications from production EVs, including a lowered ride height by six inches, a widened track, a reinforced chassis with an FIA-spec roll cage, and adapted suspension and braking components from Toyota’s circuit racing programs. A key focus of the project was addressing the complex aerodynamic and thermal management challenges unique to EVs, balancing cooling requirements for batteries and motors with drag reduction. Toyota employed advanced techniques such as laser scanning, CAD modeling, and large-scale 3D printing to develop a bespoke widebody aero package, including fender extensions
energyelectric-vehiclesbattery-technologymotorsport-engineeringadditive-manufacturingaerodynamicsthermal-managementGlobal EV Sales Leaders — Top Selling Brands & OEMs in 2025 - CleanTechnica
The article from CleanTechnica reviews the global electric vehicle (EV) sales landscape in 2025, focusing on the leading automotive brands and original equipment manufacturers (OEMs). BYD maintained its position as the top-selling EV brand despite a year-over-year sales decline, raising questions about whether it has reached its peak market share, which currently exceeds 10%. Tesla held the second spot but experienced a 5% drop in sales, with its future growth prospects limited until new models arrive around 2027. Geely showed significant growth with six-digit sales figures, positioning itself as a strong contender to surpass Tesla for second place by 2026 or 2027. Several other manufacturers also achieved record monthly sales, including Chinese brands AITO, Fang Cheng Bao, NIO, and Zeekr, as well as Vietnamese newcomer Vinfast, which is gaining traction by adopting successful strategies from the Chinese market. European brands showed mixed results: Audi achieved record sales likely boosted by year-end promotions, Sk
energyelectric-vehiclesEV-salesautomotive-industryclean-energysustainable-transportationelectric-mobility20 Best Selling EV Models in the World in December — Tesla Makes an (Increasingly Rare) #1 + #2 Win - CleanTechnica
In December, Tesla reclaimed the top two spots in global electric vehicle (EV) sales, with the Model Y leading at 132,327 units and the Model 3 following at 54,745 units, despite both experiencing slight year-over-year declines. Tesla's recovery was largely driven by strong sales in China, offsetting weaker performance in the U.S. Following Tesla, BYD's Qin Plus and Song models ranked third and fourth, respectively, with the Qin Plus benefiting from steep discounts ahead of its 2026 refresh, while the Song SUV saw a significant 42% sales drop. The Xiaomi YU7 emerged as a new contender, securing fifth place and signaling its potential to become a regular top seller. The December rankings also highlighted the popularity of full-size SUVs, with BYD's premium arm FCB Tai 7 (#8), AITO M7 (#10), and NIO ES8 (#14) all making the list. NIO’s ES8 marked a milestone as the
energyelectric-vehiclesEV-salesTeslaBYDNIOautomotive-industrySulfur-modified electrolyte tackles solid-state battery limits
Researchers at Kennesaw State University, led by Assistant Professor Beibei Jiang, are developing a sulfur-modified composite solid electrolyte to enhance lithium-ion transport in solid-state batteries. These batteries replace the flammable liquid electrolytes found in conventional lithium-ion cells with solid materials, improving safety and thermal stability. However, slow lithium-ion movement through solids has limited charging speed and overall performance. Jiang’s team addresses this by incorporating sulfur-based chemical groups into a ceramic-polymer composite electrolyte, which reduces interfacial resistance and facilitates faster ion movement. This modification effectively “smooths the highway” for lithium ions, potentially enabling faster charging and better battery performance. A key discovery in their research is a previously undocumented strong interaction between sulfur and zirconium in the ceramic component, which significantly contributes to the improved ion transport. This finding emerged unexpectedly during early experiments and was harnessed to optimize the electrolyte design. The project, supported by a $200,000 National Science Foundation grant, is currently focused on validating the stability
energysolid-state-batterieselectrolytelithium-ionsulfur-modificationbattery-safetymaterials-scienceIndia’s Varaha bags $20M to scale carbon removal from the Global South
Varaha, an Indian climate tech startup founded in 2022, has secured $20 million in fresh funding as part of a planned $45 million Series B round led by WestBridge Capital, marking the venture firm’s first climate tech investment. The startup has raised about $33 million in equity, alongside $35 million in project financing and grants, to scale carbon removal projects across Asia and Africa. Varaha focuses on delivering verified carbon removal credits at lower costs by leveraging India’s advantages—such as lower operating expenses, extensive agricultural supply chains, and technical talent—targeting corporate demand for emissions reductions driven by sectors like data centers and AI workloads. Varaha develops carbon removal through four main pathways: regenerative agriculture, agroforestry, biochar, and enhanced rock weathering, working primarily with smallholder farmers and industrial partners in emerging markets. It has generated over 2 million tons of CO2 removal across 14 projects and issued around 150,000 carbon removal credits through international registries like
energycarbon-removalclimate-techregenerative-agriculturebiocharemissions-reductionsustainabilityGlobal EV Sales Leaders — 2025 Top Markets & Powertrains - CleanTechnica
The article from CleanTechnica highlights the significant growth and shifting dynamics in the global electric vehicle (EV) market in 2025. December 2025 was a record month with over 2.1 million plugin vehicle registrations worldwide, including a 13% year-over-year increase in battery electric vehicles (BEVs) and a 6% rise in plug-in hybrid electric vehicles (PHEVs). Overall, more than 20 million plugin vehicles were sold in 2025, up from 17 million in 2024, pushing BEVs to a 17% share of the global auto market and combined plugin vehicles (BEVs plus PHEVs) to 26%. Including hybrid electric vehicles (HEVs), nearly 39% of all cars sold in 2025 had some form of electrification, indicating a strong momentum toward electrification that is expected to dominate new car sales by 2035. Regionally, growth varied: North America experienced a 6% decline in plugin
energyelectric-vehiclesEV-salesbattery-electric-vehiclesplug-in-hybridsautomotive-marketclean-energyGradient’s heat pumps get new smarts to enable old building retrofits
Gradient is developing advanced heat pump technology designed to retrofit old multifamily buildings, particularly those with outdated boiler systems common in cities like New York. Their horseshoe-shaped window units provide both heating and cooling without obstructing views, offering a cost-effective HVAC upgrade that can be installed quickly without electrical system overhauls. Gradient has piloted these systems in public housing in New York City and affordable housing in California, and is engaging with colleges to improve dormitory comfort amid rising temperatures. A key innovation is Gradient’s Nexus system, which allows building managers to set usage limits on heating and cooling to prevent energy overconsumption by residents, leading to significant energy savings—one example showed a 25% reduction in energy use after imposing a 78˚F heating cap. Additionally, Nexus can manage electrical load by reducing power draw on outlets with limited capacity and supports demand response strategies by adjusting cooling based on building conditions and sensor data. This approach aims to ease strain on the electrical grid during peak demand, making widespread
energyheat-pumpsbuilding-retrofitsHVACenergy-efficiencydemand-responsesmart-gridPorsche Cayenne EV Production Begins As New Car Sales Tumble In Norway - CleanTechnica
Porsche has commenced production of its all-electric Cayenne EV at the Bratislava factory, which also manufactures gasoline and hybrid versions of the Cayenne along with similar Audi and Volkswagen models. This factory’s flexible production line allows Porsche to quickly adapt to changing demand. A significant development is Porsche bringing battery assembly in-house for the Cayenne EV, establishing the Porsche Smart Battery Shop in Horná Streda. Here, 150 employees assemble battery modules using LG Energy Solution pouch cells, producing enough modules daily for 352 vehicles. These modules, designed as structural components with 108 kWh usable capacity, support over 600 km range (WLTP) and 800-volt fast charging, and are integrated into battery frames by supplier Webasto before final assembly. The vehicle plant has also been extensively adapted, including a new “platform hall” for assembling the skateboard-like chassis and fitting body components produced locally. Porsche emphasizes that the Cayenne Electric embodies the brand’s DNA with in-house battery development, high manufacturing
energyelectric-vehiclesbattery-technologyPorschebattery-assemblyelectric-mobilityautomotive-manufacturing96 New Fast EV Chargers Planned For Washington State - CleanTechnica
Washington State plans to install 96 new fast electric vehicle (EV) charging ports across 14 locations along Interstate 90 and US routes 97, 195, and 395 within approximately two years. This initiative, funded by about $12 million from the National Electric Vehicle Infrastructure program, aims to fill critical gaps in the state's highway EV charging network, covering 528 miles of highway to facilitate long-distance EV travel. Key recipients of the funding include Electric Era, receiving around $4.2 million, and EVgo, with $650,531 allocated. The project faced challenges when the Trump administration attempted to freeze federal EV infrastructure funds, including $71 million earmarked for Washington. However, a January ruling by US District Court Judge Tana Lin unblocked the funding, allowing the Washington State Department of Transportation to proceed with the grant awards. The effort underscores that relatively modest infrastructure investments—such as 96 fast chargers—can significantly enhance EV accessibility over extensive highway distances, improving convenience for drivers across
energyelectric-vehiclesEV-chargingfast-chargersinfrastructureclean-energytransportationTesla Is Missing The Massless EV Battery Boat
The article discusses the emerging trend of cell-to-body battery architecture in electric vehicles (EVs), highlighting how companies like BYD and Volvo are pioneering this technology while Tesla lags behind. Cell-to-body design integrates battery cells directly into the vehicle’s chassis, eliminating the need for traditional battery packs. This innovation reduces vehicle weight, cuts costs, frees up space, and simplifies assembly, leading to improved EV performance and efficiency. BYD, a Chinese automaker, has been an early and rapid adopter of this approach, contributing to its rising EV sales in Europe. Academic research, particularly from Chalmers University in Sweden, has been advancing the concept of a "massless EV battery" by using carbon fiber as a structural material in battery cells. This multifunctional carbon fiber replaces conventional aluminum foil in electrodes, providing increased stiffness, energy density, and faster charging capabilities. Funded by Swedish agencies, this research aims to create lighter, more efficient batteries that serve both as energy storage and structural components, further
energyelectric-vehiclesbattery-technologycell-to-body-architecturecarbon-fiberlightweight-materialssustainable-energyAlternative Truths About Climate & Renewable Energy Hurt Us All - CleanTechnica
The article from CleanTechnica addresses the widespread dissemination of falsehoods and "alternative truths" about climate change and renewable energy, which hinder collective efforts to address the climate crisis. It emphasizes that the scientific consensus confirming global warming caused by burning fossil fuels is robust and supported by extensive evidence. However, many people reject this reality due to various factors, including cultural beliefs, social media algorithms, and a desire to maintain current lifestyles and perceived independence, particularly in the U.S. These alternative narratives often frame renewable energy as costly or a form of social control, contributing to public skepticism. The article also tackles common misconceptions, such as the claim that renewable energy increases utility bills or damages the electrical grid. It explains that political and economic interests often fuel these arguments, while research indicates that renewables provide a cleaner, more cost-effective long-term investment. Moreover, the complexity of the power grid means no single technology is to blame for its challenges, and the U.S. grid has seen declining coal use and emissions
energyrenewable-energyclimate-changefossil-fuelssustainabilityutility-billsmisinformationVinFast’s Green Strategy Comes Into Focus in the Philippines - CleanTechnica
VinFast’s expansion strategy in the Philippines focuses on fleet-led electrification rather than targeting individual retail EV buyers. The company is introducing a dedicated sub-brand called Green, which includes electric scooters and a range of commercial electric vehicles designed specifically for high-utilization fleet use such as taxis and commercial operators. These Green models share core components with VinFast’s retail vehicles but are modified for commercial durability and functionality, featuring simplified interiors and integrated systems like taxi meters, AI safety monitoring, and satellite positioning. This approach aims to normalize EV adoption in markets where private EV ownership is limited by infrastructure and economic factors. The Green lineup is structured as a tiered portfolio tailored to different commercial needs. At the entry level is the Minio Green, a compact urban EV designed as a four-wheeled alternative to motorcycles for dense city environments, emphasizing low operating costs and maneuverability. Above it is the Nerio Green, a subcompact crossover with a longer range and more space, serving as VinFast’s primary fleet vehicle
energyelectric-vehiclesfleet-electrificationVinFastsustainable-transportationelectric-mobilitySoutheast-AsiaNeutron scattering experiment sheds light on HALEU TRISO nuclear fuel
Researchers at Oak Ridge National Laboratory (ORNL) have, for the first time, used neutron scattering techniques to non-destructively probe the internal chemistry of tristructural isotropic (TRISO) nuclear fuel particles containing high-assay low-enriched uranium (HALEU). Conducted at ORNL’s Spallation Neutron Source using the Spallation Neutron and Pressure Diffractometer (SNAP), the experiment directed a focused neutron beam at unirradiated HALEU TRISO particles. By analyzing how neutrons scattered after interacting with the fuel, scientists gained critical insights into the internal structure and composition of these robust, ceramic- and carbon-coated uranium kernels, which are key to high-temperature gas reactors (HTGRs). The study specifically examined the balance between uranium carbide and uranium oxide within the fuel kernels, an important factor influencing fuel performance. Unlike traditional uranium oxide kernels, uranium carbide-based kernels can absorb oxygen released during fission and convert it into uranium oxide rather than
energynuclear-fuelTRISOHALEUneutron-scatteringOak-Ridge-National-Laboratoryadvanced-materialsNew wood-based material stores and releases heat without electricity
Researchers at the University of Texas have developed an innovative wood-based material that regulates building temperatures without electricity by using phase-change technology (PCM). This material acts as a thermal battery, absorbing heat during the day and releasing it at night, thereby reducing reliance on active heating and cooling systems and enhancing energy efficiency. Unlike traditional PCMs that tend to leak during phase transitions, this new composite leverages the natural porous cellular structure of wood. By removing lignin and saturating the cellulose skeleton with a blend of phase-change material and a stabilizing soft plastic, the team created a leak-proof, structurally reinforced material that maintains its integrity over repeated heating and cooling cycles. Lab tests demonstrated that the material could endure 1,000 thermal cycles without leakage or loss of mechanical strength, making it both energy efficient and durable for long-term building applications. This breakthrough addresses a key limitation of previous PCM implementations, where host materials diluted heat storage capacity and compromised performance. The interdisciplinary collaboration involving national laboratories and universities underscores the potential for
energymaterialsphase-change-technologythermal-energy-storagewood-based-materialsenergy-efficiencysustainable-building-materialsPowerful laser aboard US Navy warship destroys drones in sea trial
The US Navy has made significant progress in deploying ship-based laser weapons, demonstrated by a 2025 sea trial where the Arleigh Burke-class destroyer USS Preble used Lockheed Martin’s High-Energy Laser with Integrated Optical Dazzler and Surveillance (HELIOS) system to successfully shoot down four drones. This marked a major advancement from earlier tests that targeted only single drones. The demonstration highlights the Navy’s focus on laser weapons as a cost-effective, sustainable defense against increasingly sophisticated drone threats, preserving expensive missile stockpiles for more advanced attacks. HELIOS, a 60-kilowatt-class laser equipped with an optical dazzler, has been operational on USS Preble since 2022, with other destroyers carrying lower-powered lasers primarily for sensor disruption. Laser weapons offer critical advantages over traditional missile and gun systems, including virtually unlimited firing capacity constrained only by power and cooling availability, and significantly lower per-shot costs compared to missiles like the $1 million RIM-116. These benefits
energydirected-energy-weaponslaser-technologymilitary-defensedronesLockheed-Martinnaval-technologyVema predicts cheap hydrogen could change where data centers are built
Vema, a startup specializing in producing hydrogen deep underground from iron-rich rocks, is pioneering a new method called stimulated geologic hydrogen or "engineered mineral hydrogen." By drilling wells into specific rock formations and treating them with water, heat, pressure, and catalysts, Vema extracts hydrogen gas for industrial use. The company recently completed a pilot project in Quebec and has secured a deal to supply hydrogen to California data centers. Vema’s CEO, Pierre Levin, highlighted that supplying the Quebec market would require only a small land footprint, and the first commercial well, planned for next year, will reach 800 meters deep. The company aims to produce hydrogen at less than $1 per kilogram, potentially dropping below 50 cents per kilogram with further refinement, making it cheaper and cleaner than most current hydrogen production methods. This innovation could significantly impact the location and energy sourcing of data centers, especially in regions like California, which have abundant iron-rich ophiolite rock formations. These formations could enable local, dec
energyhydrogen-energyclean-energydata-centersindustrial-energysustainable-energyenergy-innovationAvalanche thinks the fusion power industry should think smaller
Avalanche, a fusion startup led by co-founder and CEO Robin Langtry, advocates for a smaller-scale approach to nuclear fusion, contrasting with the large reactors or extensive laser arrays commonly envisioned in the industry. Their method uses extremely high-voltage electric currents to confine plasma particles in orbit around an electrode, supplemented by modest magnetic fields, rather than relying on the powerful magnets of tokamaks or laser compression techniques. This compact design, with current reactors only nine centimeters in diameter, enables rapid experimentation and iteration—sometimes twice weekly—accelerating development compared to the slower, costlier testing cycles of larger devices. Inspired by Langtry’s experience at Blue Origin and the “new space” approach popularized by SpaceX, Avalanche aims to scale up their reactor to 25 centimeters, targeting about 1 megawatt of power output and improved plasma confinement time, which is critical for achieving a fusion gain (Q) greater than one, meaning more energy produced than consumed. Avalanche recently raised $29 million
energyfusion-powernuclear-fusionclean-energyplasma-physicsfusion-reactorsenergy-innovationElon Musk links SpaceX and xAI in a record-setting merger to boost AI
SpaceX has officially acquired xAI, merging two of Elon Musk’s leading ventures to form a potentially world-leading private company. This union combines SpaceX’s expertise in rockets and satellites with xAI’s rapid advancements in artificial intelligence, aligning with growing global demand for computing power. Musk highlighted this merger as a significant new phase in their joint mission, emphasizing the strategic focus on leveraging AI to advance space operations. The deal reflects the substantial valuations of both companies—SpaceX at approximately $800 billion and xAI at around $230 billion—underscoring strong investor confidence in space and AI innovation. Financial pressures in the AI sector, particularly the high costs of powering and cooling large-scale AI models, have driven the integration. By bringing xAI under its umbrella, SpaceX gains greater control over AI development and deployment, while xAI benefits from SpaceX’s infrastructure, capital, and launch capabilities. Musk noted that relocating AI computing efforts to space could address the immense power and cooling demands of terrestrial data centers
energyartificial-intelligenceSpaceXdata-centerscomputing-powersatellite-technologyAI-infrastructureVon optimistischen Modellen zu leeren Pipelines: Die intellektuelle Geschichte von Deutschlands Wasserstoff-Backbone* - CleanTechnica
The article traces the intellectual history behind Germany's hydrogen backbone infrastructure, emphasizing that the physical pipeline network is the visible outcome of a long period of optimistic modeling and policy-driven assumptions rather than a straightforward technical project. For years, studies and analyses portrayed hydrogen as not only plausible but necessary for large-scale energy use, extending its traditional industrial roles into general energy applications. However, these studies systematically overlooked or downplayed the significant challenges and energy losses involved in hydrogen production, distribution, storage, and utilization, leading to overly positive cost and efficiency assumptions. Key failures arose from stacking multiple optimistic assumptions—such as low electrolyzer investment costs, underestimated electricity prices, and simplified or omitted costs for compression, storage, and pipeline operation—without critical peer review. This created a distorted picture of hydrogen’s viability as a flexible energy carrier comparable to electricity. In reality, the energy conversion chain for hydrogen is marked by substantial losses, with often less than 30% of the original electrical energy reaching the end-use application. The normalization
energyhydrogenenergy-infrastructureenergy-storageenergy-lossesenergy-transportenergy-policyNIO Sales Soar 96% in January! - CleanTechnica
NIO experienced a significant surge in sales in January 2026, delivering 27,182 vehicles—a 96.1% increase compared to January 2025’s 13,863 deliveries. The breakdown of these deliveries included 20,894 NIO-branded vehicles, 3,481 ONVO, and 2,807 FIREFLY models. This strong start to the year follows a period of rapid growth that began in August 2025 and contributed to NIO reaching over one million cumulative deliveries (1,024,774) by the end of January 2026. In addition to sales growth, NIO introduced technological advancements with the rollout of the latest version of its NIO WorldModel (NWM) on January 28, 2026. This update, delivered to over 460,000 vehicles equipped with the Banyan system and soon to be extended to Cedar and Cedar S systems, incorporates full closed-loop reinforcement learning to enhance assisted and intelligent driving. Improvements also
energyelectric-vehiclesNIOautonomous-drivingsmart-parkingreinforcement-learningintelligent-driving-systemsXPENG Sales Drop 34% in January - CleanTechnica
XPENG experienced a significant slowdown in sales growth at the start of 2026 after a period of rapid expansion. While January 2025 sales surged by 268% compared to the previous year, reaching 30,350 units, January 2026 saw a 34% decline to 20,011 units. This drop may reflect broader market conditions or a temporary pause following the unsustainably rapid growth in 2025. The Chinese electric vehicle (EV) market’s complexity and competitiveness add uncertainty to interpreting these trends. Despite the slow start, XPENG aims to increase its vehicle sales by 28% to 40% in 2026, targeting 550,000 to 600,000 units compared to 429,445 in 2025, supported by planned new model launches and market expansions. The company is emphasizing the environmental benefits of its recent sales, noting that January 2026 deliveries are expected to reduce life-cycle greenhouse gas emissions by over 300,000 tons,
energyelectric-vehiclesXPENGgreenhouse-gas-emissionsclimate-benefitautomotive-industryclean-technologyWhy Waiting on Grid Batteries Will Cost Ontario More Than Acting Now - CleanTechnica
The article discusses the urgent need for Ontario to adopt grid-scale battery storage now rather than delay, emphasizing that waiting will ultimately cost the province more. The author highlights that Ontario already has experience with grid storage through the Sir Adam Beck pumped hydro facility, which manages electricity time-shifting by storing excess energy and releasing it during peak demand. Unlike pumped hydro, batteries offer greater flexibility as they can be installed near transmission congestion points without geographic constraints. The key benefits of grid batteries are their ability to reduce electricity costs by increasing asset utilization—flattening peak demand and raising infrastructure use from 30-60% to 70-80%—and thereby lowering the amortized cost per kWh. Real-world evidence from Australia shows grid batteries saved about AUD 116 million in one year by cutting peak prices, providing frequency response, and avoiding costly network upgrades. The article also addresses safety and health concerns related to battery fires, noting that modern grid batteries use lithium iron phosphate (LFP) chemistries with lower
energygrid-batteriesenergy-storagepumped-hydroelectricity-gridpeak-demand-managementrenewable-energy-integrationImportierte Materialien sind beherrschbar, importierte Energie bepreist Volkswirtschaften neu - CleanTechnica
The article from CleanTechnica analyzes the 2022 European gas crisis, emphasizing that its core issue was not general import dependence or shortages of industrial inputs, but the reliance on an imported energy source—natural gas—that set marginal prices in electricity and heating markets. Although gas was not the dominant energy source, its position as the marginal fuel meant that soaring gas prices triggered widespread increases in electricity and heating costs, leading to inflation, fiscal interventions by governments totaling hundreds of billions of euros, and tighter monetary policies. Unlike industrial inputs such as iron or ammonia, whose price shocks affect specific sectors, energy prices propagate rapidly and broadly through wholesale markets, consumer tariffs, and industrial contracts, impacting the entire economy. The crisis demonstrated that physical supply shortages were managed through demand reduction, storage withdrawals, and alternative supplies, but the economic damage stemmed from price spikes. Governments had to implement price caps and subsidies to prevent social and industrial collapse because energy prices simultaneously affect all economic actors. This dynamic has implications for hydrogen's role
energyenergy-pricesgas-crisisenergy-marketseconomic-impactenergy-import-dependencyenergy-policyTrump Goes Zero for Five Against Offshore Wind - CleanTechnica
The Trump administration faced a significant legal setback when all five offshore wind projects it attempted to halt through stop-work orders successfully challenged these actions in the U.S. District Court for the District of Columbia. These projects, which were over 40 percent complete—most notably Vineyard Wind off Massachusetts, nearly 95 percent finished and already supplying power—were abruptly stopped by the Department of the Interior in December. The halts disrupted billion-dollar projects, paused construction jobs during a critical time, and impeded progress toward clean energy goals. However, the courts consistently ruled in favor of the offshore wind initiatives, underscoring judicial resistance to the administration’s efforts to impede renewable energy development. Environmental advocates, including the Sierra Club, condemned the administration’s actions as attempts to favor fossil fuels over clean energy and emphasized the importance of offshore wind for a sustainable, affordable, and reliable energy future. They highlighted the economic and environmental benefits of projects like Sunrise Wind, which employs hundreds of local workers and is expected to power hundreds of
energyoffshore-windrenewable-energyclean-energywind-powerenergy-policysustainable-energyLynk & Co 08 Achieves Guinness World Record by Reaching 293 Kilometers in 100% Electric Mode - CleanTechnica
Lynk & Co has set a new Guinness World Record with its flagship SUV, the Lynk & Co 08, achieving 293 kilometers of driving in 100% electric mode—the longest electric-only range recorded for a plug-in hybrid SUV. This milestone highlights the vehicle’s advanced plug-in hybrid technology and real-world capability, surpassing its official WLTP electric range of up to 200 km. The extended electric range allows drivers to cover several days of typical travel solely on electric power, significantly cutting fuel use and emissions while maintaining the flexibility of a hybrid powertrain. Key engineering features enabling this achievement include a 39.6 kWh high-energy battery with IP68 certification, intelligent thermal management for efficiency, optimized aerodynamics with a drag coefficient below 0.30, and a high-performance modular platform balancing comfort, stability, and low energy consumption. The record-setting test was conducted under real-world conditions at the Centro Dinámico Pegaso racetrack in Mexico, involving rigorous verification by telemetry
energyelectric-vehicleplug-in-hybridbattery-technologyautomotive-engineeringenergy-efficiencysustainable-transportationEurope EV Sales — Record Month! - CleanTechnica
In December 2025, Europe experienced a record-breaking month for electric vehicle (EV) sales, with 453,000 plugin vehicles registered—surpassing the previous record of 412,000 units set three years earlier. Battery electric vehicles (BEVs) accounted for 327,000 of these registrations, marking a 57% year-over-year (YoY) increase, the highest growth rate in over two years. Plug-in hybrid electric vehicles (PHEVs) also saw a 34% YoY rise with 126,000 units registered. Overall, plugin vehicles grew by 50% YoY, the strongest growth since 2023, contributing significantly to an 8% YoY increase in the total auto market. The market share for BEVs reached 28%, while PHEVs held 11%, as traditional petrol and diesel vehicles continued to decline sharply. Hybrid electric vehicles (HEVs) without plug-in capability appear to have peaked in 2025, with December
energyelectric-vehiclesEV-salesbattery-electric-vehiclesplug-in-hybridsautomotive-marketclean-energyBYD’s Turquois T-Shaped Second-Generation Flash Chargers Seen At Dealers Ahead Of Launch - CleanTechnica
The article discusses BYD’s new second-generation flash chargers, which have been spotted at dealerships ahead of their official launch. These chargers feature a distinctive turquoise T-shaped design that allows charging cables to extend to either side of a vehicle or even to adjacent parking spaces, enhancing flexibility and convenience. The chargers include a power cabinet and buffer battery cabinets that help manage peak loads and reduce grid impact, enabling faster and more stable charging. The design also draws parallels to traditional fuel pumps, supporting a shift toward quicker, stop-and-go charging sessions as electric vehicle (EV) charging times approach those of refueling internal combustion engine cars. BYD’s current vehicles, such as the Tang L and Han L, can add 400 km of range in just five minutes using 10 C charging, and upcoming models like the Ocean 8 Sedan and SUV are expected to support the same 1000V architecture for rapid charging. Premium BYD brands are also anticipated to adopt this architecture, with flash chargers already appearing at dealerships
energyelectric-vehiclesfast-chargingBYDflash-chargersbattery-technologyEV-infrastructureDeutschlands Wasserstoffstrategie verzögerte die Elektrifizierung, indem sie die Arbeitskräfte in die falsche Richtung lenkte - CleanTechnica
The article critiques Germany's hydrogen strategy, arguing that it has delayed the country's electrification efforts by misdirecting workforce development and training priorities. Germany's decision to establish a regulated hydrogen pipeline infrastructure—framed as a long-term, central national asset—sent strong signals to regulators, industry, and educational institutions. This led to significant investments in hydrogen-related vocational training, certifications, and organizational restructuring within transmission system operators (TSOs) and other stakeholders. For example, a major German gas TSO invested around €10 million in a hydrogen training center focused on pipeline operation, maintenance, and safety, reflecting a belief in hydrogen's central role in the energy transition. While hydrogen-related skills largely build on existing technical professions such as electricians and engineers, the article emphasizes that these training efforts come with opportunity costs. Limited training time and institutional focus mean that resources devoted to hydrogen competencies detract from investments in electrification technologies like wind turbines, solar panels, heat pumps, and batteries. The author argues that Germany's
energyhydrogen-strategyelectrificationrenewable-energy-integrationenergy-policyworkforce-developmentinfrastructure-planningHydrofoil ferry sets 160-nautical-mile record in longest sea voyage
Sweden-based Candela has completed the world’s longest electric sea journey by a passenger vessel, with its electric hydrofoiling ferry, the P-12, traveling 160 nautical miles from Gothenburg to Oslo. This milestone demonstrates that electric ferries can operate beyond short, fixed routes and specialized charging infrastructure. The P-12 uses hydrofoil technology to lift its hull above water, drastically reducing drag and cutting energy consumption by about 80% compared to conventional vessels. With a service speed of 25 knots and a range of up to 40 nautical miles on a single charge, it is currently the fastest electric passenger vessel in operation. The voyage, conducted over three days with stops for charging and demonstrations, showcased the ferry’s flexibility in using existing DC fast-charging networks and a portable 360 kW charger to recharge, avoiding the costly, fixed battery-swapping infrastructure typical of traditional electric ferries. This contrasts sharply with Oslo’s fastest conventional electric ferry, which operates a fixed 10-na
energyelectric-ferryhydrofoil-technologybattery-chargingmaritime-transportationrenewable-energyelectric-vesselsElon Musk’s SpaceX officially acquires Elon Musk’s xAI, with plan to build data centers in space
SpaceX has officially acquired Elon Musk’s artificial intelligence startup, xAI, forming a combined entity valued at approximately $1.25 trillion. The acquisition aims primarily to develop space-based data centers, a concept Musk has emphasized due to the limitations and environmental impact of terrestrial AI data centers, which require vast amounts of power and cooling. Musk highlighted that current AI infrastructure on Earth cannot sustainably meet global electricity demands without causing hardship to communities and the environment. The merger unites two Musk-led companies facing financial challenges: xAI reportedly burns about $1 billion monthly, while SpaceX generates most of its revenue from launching Starlink satellites. The integration of SpaceX and xAI is expected to create a continuous revenue stream through the deployment of numerous satellites necessary for these space-based data centers, although Musk did not specify the exact number. This satellite deployment aligns with regulatory requirements mandating de-orbiting every five years, ensuring ongoing business activity. Despite the long-term goal of space data centers, the companies currently have
energydata-centersspace-technologysatellitesartificial-intelligenceSpaceXxAIOntario’s Nuclear Rate Shock Reveals a Deeper Affordability Problem - CleanTechnica
The article discusses Ontario Power Generation’s (OPG) request to the Ontario Energy Board for a significant increase in regulated nuclear payment amounts, particularly a more than 40% jump in 2027. This increase raises the weighted average regulated payment from about $78/MWh in 2026 to roughly $110/MWh in 2027, driven mainly by the nuclear payment amount nearly doubling from $111/MWh to $207/MWh. However, this does not translate to a 40% increase in typical household electricity bills; OPG estimates an increase of about $8 per month (5.6%) on a typical $142 bill. The difference arises because electricity bills include multiple charges beyond generation, such as transmission and distribution, which do not increase at the same rate. The sharp rise in nuclear payment amounts is primarily due to a planned drop in nuclear output in 2027 caused by refurbishment outages at Darlington and conservative assumptions about Pickering’s availability during life extension. Since nuclear plants
energynuclear-energyelectricity-ratesOntario-Power-Generationenergy-affordabilitypower-generationenergy-policyChina is leading the fight against hidden car door handles
China’s Ministry of Industry and Information Technology has introduced new safety regulations, effective January 1, 2027, that ban hidden, electronically actuated car door handles in favor of mechanical releases on all doors (except tailgates). This rule targets a design feature popularized by Tesla and now common among many electric vehicles (EVs) in China. The regulation requires both external and internal mechanical door releases to ensure occupants can exit vehicles safely in emergencies. The move follows several fatal incidents where occupants were trapped due to electronic door handles failing, often because of insufficient power to the locking mechanism. China is the first country to implement such a ban, prompted by safety concerns highlighted by crashes involving Tesla and other EVs, including a notable incident with a Xiaomi SU7 sedan. The Chinese government collaborated with over 40 domestic manufacturers, parts suppliers, and testing institutions, alongside more than 100 industry experts, to develop the new standard. Major automakers such as BYD, Geely, SAIC,
energyelectric-vehiclesautomotive-safetyChina-regulationsTeslaelectric-car-technologyvehicle-door-handlesWinter Storms Wreak Havoc - Blame Fossil Fuels, Not Renewables - CleanTechnica
The article from CleanTechnica addresses the recent winter storms impacting the US Eastern seaboard, emphasizing that fossil fuels, rather than renewable energy sources, are primarily responsible for the resulting power outages and extreme weather events. It explains that climate change, driven by fossil fuel emissions, is causing more frequent and severe weather patterns, including winter storms. The warming Arctic, which is heating up four times faster than the rest of the planet, disrupts the jet stream and contributes to these extreme weather phenomena. The article also clarifies the common misconception that cold weather disproves global warming, noting that climate change leads to more extreme and variable weather, not just warming temperatures. Regarding energy reliability during these storms, the article acknowledges that renewable energy sources like wind and solar can underperform in extreme cold, but fossil fuels and nuclear power also face significant challenges, such as frozen natural gas infrastructure. It highlights research showing that regions with higher renewable energy integration tend to experience fewer blackouts, countering claims that renewables are
energyrenewable-energyfossil-fuelsclimate-changepower-outagesextreme-weatherelectrical-gridElectric MINI Countryman Gets Range Boost To 311 Miles - CleanTechnica
The 2026 electric MINI Countryman has received a range upgrade, increasing its WLTP-rated driving range from approximately 286 miles to 311 miles per charge without enlarging the battery. This improvement was achieved by expanding the usable battery capacity, incorporating a new inverter, and using low-friction ball bearings. The all-wheel-drive version’s range also rose from 266 miles to about 290 miles. The vehicle supports fast charging, reaching 10–80% battery in around 30 minutes, making it well-suited for typical urban and regional driving needs. Priced affordably at about £29,255 in the UK (including national EV incentives), the Countryman offers a practical electric SUV option for many drivers. In terms of safety, the MINI Countryman earned a five-star rating, with good protection for the driver’s head and legs and the front passenger’s head and chest, though some slight injury risks were noted for the driver’s chest and the front passenger’s legs due to dashboard
energyelectric-vehiclebattery-technologyEV-rangecharging-infrastructureautomotive-innovationsustainable-transportationCATL Shares Details Of Next Generation 5C Battery - CleanTechnica
CATL has unveiled details of its next-generation 5C battery, which significantly advances rapid charging and battery longevity for electric vehicles (EVs). The 5C rating means the battery can theoretically be charged at five times its capacity rate, enabling a full charge in about 12 minutes with a 400 kW charger, compared to the typical slower charging rates currently experienced. This new battery reportedly offers about six times the life expectancy of current industry averages, potentially outlasting the vehicle itself. Under extreme heat conditions (60°C), it maintains 80% capacity after 1,400 cycles, equivalent to roughly 840,000 kilometers, far surpassing conventional lithium-ion cells. CATL attributes these improvements to three key innovations: a denser and more uniform cathode coating that reduces structural degradation, a proprietary electrolyte additive that repairs micro-cracks and reduces lithium loss, and a temperature-responsive coating on the separator that slows ion migration to prevent thermal runaway. Additionally, an upgraded cooling system targets hot spots
energybattery-technologyelectric-vehicleslithium-ion-batteriesCATLfast-chargingbattery-management-systemUK moon base dreams stall as Rolls-Royce halts nuclear reactor work
The UK Space Agency’s plan to develop a nuclear-powered Moon base has stalled after Rolls-Royce placed its lunar micro-reactor project on indefinite hold due to expired government funding and a lack of launch partners. The micro-reactor, designed to generate 100kW of power—sufficient for dozens of lunar homes—was seen as a critical technology to provide continuous energy during the Moon’s two-week-long nights, when solar power is ineffective. Launched three years ago with strong government backing, the project aimed to advance the UK’s position in space exploration and domestic technology but is now in limbo pending renewed support or partnerships. Meanwhile, the United States is aggressively pursuing its own lunar nuclear power initiative under an executive order signed by former President Trump, mandating deployment of a nuclear reactor on the Moon by 2030. This effort, led by NASA and the Department of Energy, is restricted to American companies to ensure national security and maintain industrial leadership, effectively excluding international players like Rolls-Roy
energynuclear-powerlunar-baseRolls-Roycespace-explorationmicro-reactorrenewable-energy-alternativesWorld’s most widely deployed nuclear reactor enters batch-scale builds
China’s third-generation nuclear reactor, Hualong One, has become the world’s most widely deployed single reactor design, with 41 units either operating or under construction nationwide. The reactor, entirely domestically produced, can generate approximately 10 billion kilowatt-hours of clean energy annually—enough to power about one million people in a moderately developed country. Several reactors, including the Cangnan project in Zhejiang Province, are nearing full operation, while new units are being built in Guangdong, Shandong, and Jiangsu provinces. China is also expanding the Changjiang Nuclear Power Base in Hainan, the world’s largest Hualong One complex, which recently completed its first construction phase. The first unit, Fuqing Unit 5, has operated for five years and generated over 43 billion kilowatt-hours of clean power, undergoing its first routine refueling outage in early 2024. The export version of Hualong One, known as HPR1000, has been adopted internationally,
energynuclear-powerclean-energyHualong-OneChina-energycarbon-emissionsnuclear-reactorNew US supercomputer to speed up nuclear reactor modeling, deployment
Idaho National Laboratory (INL) has launched its latest supercomputer, Teton, which quadruples the lab’s high-performance computing capacity and ranks as the 85th most powerful supercomputer globally according to TOP500. Teton, powered by AMD’s EPYC 9005 “Turin” processors and featuring 1,024 compute nodes with nearly 400,000 CPU cores, delivers 20.8 quadrillion calculations per second—four times the performance of its predecessor, Sawtooth, while occupying only one-third the physical space. This significant upgrade enables researchers to run complex modeling and simulation codes much faster, reducing computational tasks from days to hours. Designed specifically to accelerate nuclear reactor design and deployment, Teton supports the US Department of Energy’s Nuclear Science User Facilities (NSUF) by providing the computational power necessary for advanced reactor research. Its capabilities facilitate thousands of simulations to create Reduced Order Models (ROMs), which serve as accurate digital twins for optimizing reactor designs, speeding up
energynuclear-energysupercomputerhigh-performance-computingreactor-modelingsimulationAISpaceX seeks approval for solar-powered orbital data centers for AI
SpaceX, led by Elon Musk, has filed a request with the FCC to launch up to one million solar-powered satellites designed to serve as orbital data centers for artificial intelligence (AI). These satellites would leverage constant solar energy and natural vacuum cooling in low-Earth orbit (500-2,000 km altitude) to overcome the significant electricity and water consumption challenges faced by terrestrial AI infrastructure. The move aims to reduce environmental impact and operational costs while enabling AI growth beyond the limitations of Earth’s power grids. This filing coincides with SpaceX’s ongoing talks to merge with Musk’s AI startup, xAI, potentially positioning SpaceX ahead of competitors like Google, Meta, and OpenAI. The project’s feasibility depends heavily on SpaceX’s Starship rocket, which promises dramatically lower launch costs and the capacity to deliver millions of tons of payload to orbit annually. By securing FCC approval for a large satellite fleet, SpaceX aims to meet the anticipated demand from a billion AI users and establish space as the most
energysolar-powerorbital-data-centersSpaceXAI-infrastructuresatellitesStarship-rocketsSingapore to host world’s first airport testbed for open-fan engines
Singapore will become the world’s first airport to host a testbed for next-generation open-fan aircraft engines, following a memorandum of understanding signed by the Civil Aviation Authority of Singapore (CAAS), Airbus, and CFM International. This initiative, part of CFM’s Revolutionary Innovation for Sustainable Engines (RISE) program, aims to conduct real-world evaluations of open-fan engines at either Changi Airport or Seletar Airport over several years. The testbed will assess how these engines, which feature exposed fan blades and promise about 20% better fuel efficiency than current turbofans, integrate with existing airport infrastructure and operational procedures, focusing on safety, regulatory standards, and maintenance adaptations. The open-fan engine design offers aerodynamic advantages and compatibility with sustainable aviation fuels, supporting future propulsion technologies like hydrogen. Airbus plans to potentially equip its next-generation single-aisle aircraft, expected in the late 2030s, with open-fan engines. By testing in active, high-traffic airports
energyaviation-technologysustainable-aviation-fuelopen-fan-enginesaircraft-engine-innovationfuel-efficiencyhydrogen-propulsionNew Pumped Hydro Energy Storage System Needs No Mountains
The article discusses innovations in pumped hydro energy storage (PHES), a well-established method for storing electricity by using excess power to pump water uphill to a reservoir, which can later be released to generate electricity on demand. Traditional PHES systems require mountainous terrain to create sufficient elevation difference for efficient operation, limiting suitable site availability. Despite political support from the Trump administration for hydropower as part of a broader energy strategy, new dam construction remains challenging due to environmental and geographic constraints, and the administration’s energy emergency declaration controversially excluded wind and solar from baseload support, citing their intermittency. To overcome the elevation limitation, startups are developing novel PHES technologies that do not require mountainous sites. The UK-based company RheEnergise has created a compact system called HD Hydro (High-Density Hydropower) that can operate on low, hilly terrain without steep slopes. RheEnergise has identified thousands of potential sites in the US, especially in Texas, which could collectively provide significant energy storage
energypumped-hydro-storagerenewable-energyhydropowerenergy-storageclean-energysustainable-powerHow an Influential Energy Book Became a Drag on Decarbonization - CleanTechnica
The article critiques the continued reliance on David MacKay’s 2008 book *Sustainable Energy Without the Hot Air* as a definitive guide for energy policy in 2026, arguing that while the book was influential and valuable in its time, it no longer reflects current realities in energy systems. MacKay’s insistence on rigorous numerical analysis and physical constraints helped clarify the scale of energy challenges and the need for infrastructure to replace fossil fuels. However, his foundational approach, which anchored analysis in primary energy accounting, inadvertently exaggerated the scale of the problem by treating fossil fuel heat content as the baseline, thus underestimating the transformative potential of electrification and efficiency gains from technologies like electric vehicles and heat pumps. The article further highlights that MacKay’s assessment of renewable energy sources like solar and wind was accurate given the technology and costs of the late 2000s, but it failed to anticipate the dramatic cost reductions and performance improvements that have since occurred. By the early 2020s, solar and
energydecarbonizationsustainable-energynuclear-powerelectrificationrenewable-energyenergy-policyTechCrunch Mobility: The great Tesla rebranding
The article from TechCrunch Mobility examines Tesla’s ongoing efforts to rebrand itself beyond an electric vehicle (EV) manufacturer into a broader sustainable energy, AI, and robotics company. Despite Elon Musk’s ambitious vision, Tesla’s financials remain heavily dependent on EV sales, which accounted for $69.5 billion of its $94.8 billion revenue in 2025. The remainder comes from its solar energy, storage, and service businesses. However, with declining EV sales impacting profitability, Tesla is shifting focus toward expanding its non-vehicle ventures. Musk highlighted 2026 as a major capital expenditure year, with plans to more than double spending, resulting in negative cash flow as the company invests heavily in new initiatives. Key strategic moves include discontinuing the Model S and X, which represent a small but symbolic portion of sales, and pivoting production capacity toward Optimus humanoid robots at its Fremont factory. Tesla also aims to scale its robotaxi service to additional cities and is considering building a TerraFab
robotenergyTeslaelectric-vehiclesAIroboticshumanoid-robotsTesla Semi Chargers Planned For Pilot Travel Centers - CleanTechnica
Pilot Travel Centers, the largest travel center network in North America with over 900 locations, has partnered with Tesla to install Tesla Semi chargers at select centers in California, Georgia, Nevada, New Mexico, and Texas. These chargers will be strategically placed along major transportation routes such as California’s I-5 and I-10 freeways. Each Pilot location will feature 4 to 8 charging stalls capable of delivering 1.2 MW of power, primarily intended for Tesla Semi trucks, with potential future compatibility for other electric heavy-duty trucks. This development supports the growing adoption of electric vehicles (EVs), particularly in the heavy-duty vehicle (HDV) segment, which has seen rapid sales growth in recent years. Although the Tesla Semi, first announced in 2017, has faced production delays with expected availability around spring 2026, the installation of these chargers suggests anticipation of increased Tesla Semi deployment alongside other electric big rigs. The expansion of charging infrastructure at Pilot centers aligns with broader trends in electric
energyelectric-vehiclesTesla-SemiEV-chargersheavy-duty-truckscharging-infrastructurePilot-Travel-CentersIndia offers zero taxes through 2047 to lure global AI workloads
India has introduced a significant tax incentive to attract global AI workloads by offering foreign cloud providers zero taxes through 2047 on revenues from services sold outside India, provided these services are run from Indian data centers. Announced by Finance Minister Nirmala Sitharaman in the annual budget, this tax holiday aims to position India as a competitive hub for AI computing investment amid a global surge in demand for cloud infrastructure. The budget also includes a 15% cost-plus safe harbour tax provision for Indian data-center operators serving related foreign entities. However, sales to Indian customers will be taxed domestically through local resellers. This move aligns with major investments by global tech giants such as Google, Microsoft, and Amazon, who have collectively pledged tens of billions of dollars to expand AI and cloud infrastructure in India. Domestic players like Digital Connexion and Adani Group are also investing heavily in large-scale AI-focused data center projects, signaling strong interest from both international and local investors. Despite these positive developments, challenges remain,
energydata-centersAI-infrastructurecloud-computingIndiainvestmentpower-shortagesUnder 6,000-year-old ditch, elusive medieval erdstall tunnel found
Archaeologists in Saxony-Anhalt, Germany, uncovered a medieval erdstall tunnel beneath a Neolithic ditch while preparing a site for wind farm construction. Erdstall tunnels are narrow underground passageways widespread across Central Europe, dating from the 10th to 13th centuries, yet their purpose remains unclear. This newly found tunnel, about 3.28 feet tall and 19.7 to 27.6 inches wide, contained minimal artifacts—a horseshoe, animal bones, and signs of a low-intensity fire—and was deliberately blocked at the entrance, adding to the mystery surrounding these structures. Erdstalls are typically small, complex tunnels with connected levels, narrow crawl spaces called “Schlupf,” and are often located near churches, cemeteries, or remote areas. Archaeologists speculate they may have served as secret hideouts, sites for cultic or initiation rituals, or spiritual retreats, possibly linked to medieval perceptions of ancient pagan sites. Despite thousands of such tunnels
energywind-farmarchaeologymedieval-tunnelsunderground-structuresexcavationcultural-heritageSpaceX Proposes One Million Solar Powered Data Centers In Earth Orbit - CleanTechnica
SpaceX has proposed an ambitious plan to launch up to one million solar-powered satellites into Earth orbit to serve as data centers for artificial intelligence (AI) computing. Filed with the Federal Communications Commission on January 30, 2026, these satellites would operate between 500 and 2,000 kilometers altitude in sun-synchronous and 30-degree inclinations to maximize solar energy capture. The company claims this approach would offer transformative cost and energy efficiencies while significantly reducing the environmental impact compared to terrestrial data centers. The satellites would communicate via inter-satellite optical links and connect with Starlink spacecraft to relay data to the ground, though technical specifics and deployment timelines were not provided. The proposal highlights the growing challenge of powering AI data centers, which could consume up to 20% of global electricity in the future. While some governments push for renewable energy mandates for data centers, others continue to rely on fossil fuels, exacerbating pollution concerns. SpaceX’s concept aims to circumvent terrestrial energy limitations by harnessing near
energysolar-powerdata-centersSpaceXsatellite-technologyrenewable-energyartificial-intelligenceBye-bye corporate conglomerates. Hello personal conglomerates.
The article contrasts the corporate conglomerates of the past, exemplified by General Electric (GE) under Jack Welch, with the emerging model of "personal conglomerates" embodied by Elon Musk. Thirty years ago, GE was a sprawling industrial giant with diverse divisions spanning aerospace, energy, healthcare, and media. Under Welch’s leadership from 1981 to 2001, GE grew from $14 billion to over $400 billion through aggressive layoffs and acquisitions, including non-industrial businesses like NBC to expand influence. Welch’s management style was widely admired and emulated, but the conglomerate’s structure eventually revealed critical flaws, particularly during the 2008 financial crisis when GE Capital’s risky financial dealings led to a massive federal bailout. This prompted GE to begin dismantling its conglomerate structure five years ago. In contrast, Elon Musk operates a personal conglomerate encompassing Tesla, SpaceX, xAI, Neuralink, The Boring Company, and the social media platform X. While these companies have diverse
energyTeslaSpaceXneural-implantsThe-Boring-CompanyxAIElon-MuskCharge To The Parks Is Back! (Silverado EV Long Term Review Begins Now) - CleanTechnica
The article "Charge To The Parks Is Back! (Silverado EV Long Term Review Begins Now)" from CleanTechnica details the revival of the author’s ambitious project to visit national parks using all-electric vehicles. After previous attempts, including towing a trailer with a Bolt EUV and plans to build an electric Chevy Suburban that fell through due to complexity and cost, the project was delayed for nearly a year. Life events and caretaking responsibilities further postponed progress, but the author is now set to resume the journey in 2026 with a new 2025 Silverado EV LT Extended Range. The author chose the Silverado EV LT model with a 170 kWh battery pack, balancing affordability, towing capacity, and wheel size preferences. This battery capacity, while not the largest available, still surpasses competitors like Rivian and Ford’s electric trucks and is sufficient for most planned trips, including remote destinations with some reliance on RV park charging. The Silverado EV’s platform offers a unique middle ground between half-ton
energyelectric-vehiclesSilverado-EVbattery-technologyelectric-trucksEV-towing-capacityclean-energyNew sensor achieves record-level alcohol sensitivity at ultra-low power
Researchers from Yonsei University and collaborators have developed a novel low-power gas sensor that achieves ultra-sensitive detection of ethanol at parts-per-billion levels. The sensor integrates ultrathin ruthenium dioxide nanosheets with a tin dioxide thin film, creating a hybrid structure that significantly enhances ethanol detection. The ruthenium dioxide nanosheets provide a high surface area and strong catalytic activity, accelerating ethanol molecule reactions on the sensor surface. Additionally, interactions between the nanosheets and tin dioxide amplify the electron depletion layer, increasing changes in electrical resistance and making the sensor over three times more responsive than conventional devices. Built on a suspended membrane with a microheater, the sensor operates continuously using less than 30 milliwatts of power, detecting ethanol concentrations from 10 parts per million down to about 5 parts per billion. It demonstrated stable performance over nearly a month, resisted interference from common gases, and reliably tracked real-time breath alcohol levels consistent with commercial breathalyzers. The design’s compatibility with existing microfabrication techniques
energymaterialssensorslow-power-technologynanomaterialsgas-detectionethanol-sensingWenn Stahl Strategien überdauert: Die Klimakosten von Deutschlands Wasserstoff-Pipeline* - CleanTechnica
The article critically examines the climate impact of a 400 km German pipeline originally built around 2020 as a large-scale natural gas transmission line, later repurposed for hydrogen transport. Initially designed during a period of expected long-term high natural gas demand supported by Russian supplies, the pipeline’s construction involved significant carbon emissions, primarily due to the massive steel requirements—approximately 320,000 tons of steel, equating to about 1% of Germany’s annual steel demand. The steel production alone generated between 220,000 and 750,000 tons of CO₂ equivalent emissions, with a central estimate around 600,000 to 650,000 tons, all emitted before the pipeline transported any gas. This embedded carbon is irreversible, raising questions about whether the pipeline can deliver sufficient climate benefits over its lifetime to offset these upfront emissions. The article argues that simply rebranding or repurposing infrastructure as “hydrogen-ready” does not guarantee climate benefits. The pipeline currently operates under pressure with fossil
energyhydrogen-pipelinesteel-productioncarbon-emissionsdecarbonizationinfrastructureGermany-energy-transitionUnter Druck gesetzter Stahl, fehlende Nachfrage: Deutschlands Wasserstoff-Backbone in den Energieflüssen* - CleanTechnica
The article critically examines Germany's national hydrogen backbone infrastructure, highlighting a fundamental mismatch between its design assumptions and the actual energy system needs. The hydrogen pipeline network, described as "real steel in the ground, under pressure," is being built on the premise that hydrogen will be the primary energy carrier, especially to sustain raw-material-based industrial applications. However, detailed analysis using three comprehensive Sankey diagrams of Germany’s 2024 energy flows reveals that hydrogen plays at best a niche role and at worst represents an expensive detour in the energy transition. The current energy system is dominated by fossil fuels with significant energy losses, especially as waste heat from combustion engines and industrial processes, underscoring that Germany’s climate challenge is primarily an efficiency problem rather than just a fuel substitution issue. The first Sankey diagram illustrates Germany’s 2024 energy system, showing a total primary energy input of about 2,900 TWh, with over half lost as waste heat. This inefficiency highlights that decarbonization efforts
energyhydrogenenergy-transitionrenewable-energyenergy-efficiencyGermany-energy-systemdecarbonization4x more production of THAAD: US to make 400 key interceptors per year
The United States Department of War (DoW) has signed a framework agreement with Lockheed Martin to quadruple the production of Terminal High Altitude Area Defense (THAAD) interceptors from 96 to 400 units annually. This agreement follows a similar recent deal to accelerate production of PAC-3 Missile Segment Enhancement (MSE) interceptors. THAAD is a combat-proven missile defense system capable of intercepting short, medium, and intermediate-range ballistic missiles both inside and outside the atmosphere, making it a critical component of U.S. and allied defense capabilities. Lockheed Martin currently supports the THAAD program with over 2,000 U.S. employees and more than 340,000 square feet of dedicated operations space. The company plans to invest billions over the next three years to expand production capacity, modernize over 20 facilities across several states, and incorporate advanced manufacturing technologies. A new Munitions Acceleration Center will also be established in Camden, Arkansas, to enhance workforce capabilities
robotenergyadvanced-manufacturingdefense-technologyroboticsdigital-technologiesproduction-expansionNew 'sand-in-motion' battery offers 10x more heat transfer efficiency
Finnish cleantech startup TheStorage has launched its first industrial-scale thermal energy system at a brewery in January 2026, marking a significant advancement in industrial heat production. The system converts renewable electricity into heat stored in sand, which can then be used on demand for industrial processes. This "sand-in-motion" technology achieves up to 10 times higher heat transfer efficiency compared to traditional static storage methods, enabling energy cost reductions of up to 70% and carbon emission cuts of up to 90% for manufacturing facilities. The system is scalable, with storage capacities from 20 to 500 MWh and charging power between 1 to 20 MW, addressing the heavy-duty heat demands of various industries. The technology tackles a critical global issue, as industrial heat accounts for 20% of global energy use, with 80% currently derived from fossil fuels. By using cheap, abundant renewable electricity to heat sand to temperatures up to 800°C, the system stores thermal energy efficiently and delivers it
energyrenewable-energythermal-energy-storageindustrial-heatdecarbonizationcleantechenergy-efficiencyChina's new cooling system can touch sub-zero in seconds to save AI
Chinese researchers have developed a novel pressure-driven chemical cooling technique that can rapidly supercool a liquid medium to sub-zero temperatures within 30 seconds. Unlike traditional cooling methods that rely on continuous energy input such as fans or chilled water loops, this process uses the unusual solubility behavior of ammonium thiocyanate salt under pressure. When pressurized, a saturated salt solution forms, and upon sudden pressure release, the salt re-dissolves in a way that absorbs significant heat from the surroundings, causing a rapid temperature drop. This endothermic dissolution, enhanced by pressure control, offers a high cooling power burst ideal for managing sudden thermal spikes. This technology shows promise for energy-intensive AI data centers, which generate intense heat from GPUs and other hardware, often facing unpredictable heat surges during computationally demanding tasks. The rapid salt cooling process could act as a thermal buffer, reducing peak cooling loads and potentially lowering energy costs associated with traditional cooling systems that can consume 30-50% of a data center
energycooling-technologydata-centersAI-hardwarechemical-coolingthermal-managementammonium-thiocyanateSun’s magnetic interior mapped for first time using 30 years of data
A recent study has, for the first time, successfully mapped the Sun’s internal magnetic field by reconstructing a three-dimensional model using nearly 30 years of satellite data from 1996 to 2025. The Sun’s magnetic field, generated by the solar dynamo deep beneath its surface, drives the roughly 11-year solar cycles characterized by sunspots and bursts of energy affecting Earth’s space environment. Since direct measurements of the Sun’s interior magnetic fields are impossible, the researchers used daily surface magnetic field maps as inputs to a sophisticated computer model that continuously adjusted to remain physically consistent. This data-driven approach allowed them to infer the hidden magnetic structures and flows inside the Sun responsible for observed surface patterns. The model was validated by accurately reproducing multiple past solar cycles, including key features such as the migration of sunspots toward the equator and polar magnetic field evolution. Furthermore, it demonstrated predictive power by forecasting major solar activity features up to three or four years in advance without new input data. This breakthrough
energysolar-energymagnetic-fieldsolar-cyclessatellite-datasolar-dynamospace-weatherAquifer Thermal Energy System Comes To Minnesota - CleanTechnica
The article discusses the advantages and implementation of Aquifer Thermal Energy Storage (ATES) systems as an efficient and sustainable solution for heating and cooling. Unlike conventional air source heat pumps, which have limitations in extreme temperatures, ATES systems leverage the relatively stable temperature of groundwater year-round to provide consistent and efficient thermal energy. Research from the Karlsruhe Institute of Technology and Imperial College London, analyzing over 3,000 ATES systems globally, found that these systems can reduce greenhouse gas emissions by up to 74% compared to traditional methods. Additionally, the return on investment for ATES can be as short as two years, with infrastructure longevity extending beyond 80 years, making it a cost-effective and durable option. A practical example of this technology is underway in St. Paul, Minnesota, where Ever-Green Energy is developing an ATES system for the mixed-use Heights development. This system will extract thermal energy from an aquifer 300 to 500 feet underground to supply heating and cooling for 850 homes and
energygeothermal-energyheat-pumpsaquifer-thermal-energy-storagerenewable-energysustainable-heatingcooling-systemsDeutschlands Wasserstoff-Backbone und der lange Schatten des russischen Gases - CleanTechnica
The article analyzes a recently repurposed 400-kilometer pipeline section in Germany, originally built for Russian natural gas transport, now designated as part of the country’s hydrogen backbone. Despite being framed as a forward-looking investment in a hydrogen economy, the pipeline’s physical characteristics—such as its 1.4-meter diameter and capacity of about 55 billion cubic meters per year—align closely with those of the EUGAL pipeline corridor, a major gas infrastructure commissioned in 2020 to transport Nord Stream gas southward through Germany. This suggests that the hydrogen backbone is essentially a continuation of Germany’s former gas strategy rather than a new greenfield project. The pipeline infrastructure is still largely financed under gas network regulations, with an estimated residual book value of around 2 billion euros, reflecting long depreciation periods of 45 to 65 years. The article further situates this infrastructure within Germany’s broader political and economic context, highlighting decades of reliance on Russian pipeline gas to ensure industrial competitiveness, price stability
energyhydrogen-economypipeline-infrastructurenatural-gasenergy-transitionGermany-energy-policyhydrogen-backboneSpaceX seeks federal approval to launch 1 million solar-powered satellite data centers
SpaceX has filed an application with the Federal Communications Commission (FCC) to launch a massive constellation of up to 1 million solar-powered satellites designed to function as data centers for artificial intelligence (AI) computing. The company describes these satellites as an efficient solution to meet the rapidly growing demand for AI processing power and envisions this project as a step toward achieving a Kardashev II-level civilization—one capable of harnessing the full energy output of the Sun—and supporting humanity’s long-term multi-planetary future. The filing comes amid ongoing regulatory scrutiny and concerns about space debris, as the FCC recently authorized only a fraction of a large satellite proposal, deferring decisions on nearly 15,000 satellites. The European Space Agency has also highlighted the increasing problem of space pollution caused by existing satellites. This proposal by SpaceX coincides with Amazon’s plans to deploy over 1,600 satellites, despite rocket availability challenges. Additionally, SpaceX is reportedly expanding its AI ambitions through collaborations with Tesla and x
energysolar-powersatellite-technologySpaceXdata-centersartificial-intelligencespace-energy-harvestingCanada & South Korea Discuss Trade Deal As BYD Eyes India - CleanTechnica
The article discusses recent developments in international trade and automotive manufacturing involving Canada, South Korea, and India amid shifting global economic dynamics. Canadian Prime Minister Mark Carney emphasized the need for "middle power" nations to strengthen ties to counteract the economic coercion and geopolitical aggression by major powers like the US, China, and Russia. In line with this, Canada and South Korea announced a framework agreement to explore bringing Korean automotive manufacturing to Canada, aiming to grow the auto sector and create jobs. This move contrasts sharply with the US administration's aggressive tariff policies, including a 25% tariff on Canadian vehicles, which have disrupted longstanding duty-free trade. Meanwhile, in India, tensions with the US—exacerbated by insults from the American president toward Prime Minister Narendra Modi—have pushed India to reconsider its alliances. Despite historical border disputes with China, India is now seen as potentially more aligned with China than the US. Chinese electric vehicle manufacturer BYD is reportedly turning its attention to the Indian market, reflecting
energyautomotive-manufacturingtrade-agreementCanadaSouth-Koreaglobal-supply-chainstariffsFighting Back: Utilities Challenge Coal Power Plant Emergency
The article discusses the controversy surrounding the U.S. Department of Energy's emergency orders to keep aging coal power plants operational, despite the declining role of coal in U.S. power generation. Since the early 2000s, coal's share has dropped significantly, with natural gas and renewables like wind and solar gaining prominence. By 2023, coal accounted for only 19% of U.S. power generation, while renewables reached 21%, with projections indicating further growth in renewable energy. Utilities have been planning the retirement of old coal plants, including the Craig Unit 1 plant in Colorado, co-owned by Tri-State Generation and Transmission Association and Platte River Power Authority, which was scheduled to retire at the end of 2025. However, just before the planned retirement, the two utilities received an emergency order to keep the coal plant running for an additional 90 days. Both utilities, which are member-owned rural cooperatives, have pushed back, requesting a hearing and relief from the order
energycoal-powerrenewable-energyutilitiespower-generationenergy-policyenergy-emergencyA Balance Of Incentives & Penalties Works Best For Clean Energy Adoption - CleanTechnica
The article from CleanTechnica highlights research by the University of California San Diego and Princeton University, which finds that a balanced combination of financial incentives and penalties is most effective in accelerating the adoption of clean energy and reducing greenhouse gas emissions. While subsidies and incentives—such as tax credits for electric vehicles and renewable energy, government grants, and rebates for energy-efficient home upgrades—are crucial for rapidly increasing clean technology uptake in the short term, penalties like carbon pricing are necessary to create strong, unambiguous signals that reduce reliance on fossil fuels and drive long-term structural change. The researchers emphasize that relying solely on incentives can lead to political and economic instability, with inconsistent policies that slow progress and increase costs over time. Their analysis of real-world federal and state programs shows that starting with incentives and gradually introducing penalties yields better outcomes than either approach alone. This dual strategy aligns with economic models and addresses the political realities of climate policy, bridging the gap between what is economically efficient and politically feasible. The findings suggest that effective
energyclean-energyclimate-changesubsidiescarbon-pricingrenewable-energyemissions-reductionDie Opportunitätskosten des deutschen Wasserstoff-Backbones* - CleanTechnica
The article discusses the significant opportunity costs associated with Germany's hydrogen backbone pipeline infrastructure, which currently spans about 400 kilometers and is operational but lacks connected suppliers or committed customers. This situation reflects a broader European assumption that building hydrogen infrastructure ahead of demand would stimulate that demand. However, the core issue is not hydrogen availability but the capital tied up in assets that do not deliver usable energy outcomes. The article highlights the mismatch between the extensive planned hydrogen infrastructure and realistically expected demand, emphasizing that the pipeline, effectively a "pipeline from nowhere to nowhere," is not yet serving paying customers. Converting existing high-pressure natural gas pipelines to hydrogen service is complex and costly, involving detailed assessments for hydrogen embrittlement, weld quality, and material compatibility. Often, internal polymer linings are needed to limit hydrogen permeation and leaks, increasing material and installation costs. Components such as valves, seals, compressors, and measurement systems require replacement or significant modification to handle hydrogen's distinct properties, leading to substantial additional investment and operational expenses
energyhydrogen-infrastructurepipeline-conversionmaterial-compatibilityenergy-transitionindustrial-energyhydrogen-economyPhotos: US site turns Manhattan Project, Cold War-era radioactive waste into stable glass
The Hanford Site in the United States has commenced the vitrification of low-activity radioactive waste, a significant milestone in the long-standing environmental cleanup of waste generated during the Manhattan Project and Cold War plutonium production. The Waste Treatment and Immobilization Plant (Vit Plant) converts millions of gallons of hazardous waste into stable glass through a process developed over six decades by Pacific Northwest National Laboratory (PNNL). This vitrification process involves melting the waste with glass-forming chemicals at high temperatures (around 2,100°F), resulting in a durable glass that safely immobilizes radionuclides for thousands of years, facilitating secure long-term storage. PNNL's extensive research since the 1960s has been critical to this achievement, including the development of the liquid-fed ceramic melter technology now used worldwide. The Hanford Site's waste is chemically diverse, requiring customized glass recipes for each batch to ensure stability and safety. To accelerate this complex process, PNNL created computational models and algorithms that reduce recipe
energyradioactive-wastevitrificationglass-immobilizationnuclear-waste-treatmentmaterials-scienceenvironmental-cleanup